F463801

General Info

Members Datasets Scaffolds Average Seq Length
561 310 545 293

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100760583|Ga0068856_1007605831
Length 282
Sequence MDTRGIILAGGSGTRLYPVTRSVSKQLLPVYDKPMIYYPLSTLMLAGVRTLLIITTPRDRQAFEDLLGSGCEWGLEISYAVQDKPNGLAEAFIIGRDFVGGHPSELATAVQTAAKRERGATVFAYRVSNPQAYGVVEFDAAGRAISIEEKPKTPRSNFAVTGLYFYDRRVVDIAANLKPSPRGELEITDVNRAYLEASDLHVEILGRGSAWLDTGTHDSLVQATHFVQTVEQRQGLKIAAPEEVAFRMGYIDRTKLLELADALGKSDYGGYLRAIADEVPSP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
3 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
4 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
5 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
6 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
7 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
8 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
9 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
10 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
11 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
12 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
13 2865014394 Pantoea sp. R-71966 Isolate Unclassified
14 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
15 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
16 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
17 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
215 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
219 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
220 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 0
Isolates 2.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.53
Nodule 0
Rhizoplane 3.74
Rhizosphere 83.78
Stem 0
Stem Tuber 0.53
Unclassified 6.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4539084 2162886012 Bacteria 2062
2 Ga0055524_1004355 3300003775 Bacteria 6548
3 Ga0055528_1018983 3300003790 Bacteria 2304
4 Ga0058692_1000468 3300003856 Bacteria 18161
5 Ga0065712_10165267 3300005290 Bacteria 1276
6 Ga0065715_10121597 3300005293 Bacteria 2225
7 Ga0065715_10149355 3300005293 Bacteria 1748
8 Ga0070676_10038217 3300005328 Bacteria 2772
9 Ga0070676_10143023 3300005328 Bacteria 1525
10 Ga0070683_100006765 3300005329 Bacteria 9633
11 Ga0070683_100017146 3300005329 Bacteria 6396
12 Ga0070690_100002713 3300005330 Bacteria 9552
13 Ga0070690_100008468 3300005330 Bacteria 5926
14 Ga0070670_100020242 3300005331 Bacteria 5718
15 Ga0070670_100179730 3300005331 Bacteria 1837
16 Ga0070670_100207587 3300005331 Bacteria 1703
17 Ga0068869_100001264 3300005334 Bacteria 14952
18 Ga0068869_100015212 3300005334 Bacteria 5156
19 Ga0068869_100077559 3300005334 Bacteria 2472
20 Ga0070666_10013029 3300005335 Bacteria 5265
21 Ga0070666_10041563 3300005335 Bacteria 3073
22 Ga0070666_10259252 3300005335 Bacteria 1232
23 Ga0070666_10267784 3300005335 Bacteria 1212
24 Ga0070682_100004413 3300005337 Bacteria 7806
25 Ga0068868_100007794 3300005338 Bacteria 7644
26 Ga0068868_100015359 3300005338 Bacteria 5661
27 Ga0068868_100226695 3300005338 Bacteria 1566
28 Ga0070660_100015976 3300005339 Bacteria 5436
29 Ga0070689_100033652 3300005340 Bacteria 3906
30 Ga0070689_100088246 3300005340 Bacteria 2441
31 Ga0070689_100111848 3300005340 Bacteria 2173
32 Ga0070687_100047568 3300005343 Bacteria 2201
33 Ga0070687_100095761 3300005343 Bacteria 1651
34 Ga0070687_100107145 3300005343 Bacteria 1575
35 Ga0070661_100007601 3300005344 Bacteria 7476
36 Ga0070661_100061651 3300005344 Bacteria 2753
37 Ga0070692_10014398 3300005345 Bacteria 3715
38 Ga0070668_100058865 3300005347 Bacteria 2973
39 Ga0070668_100137492 3300005347 Bacteria 1966
40 Ga0070668_100139401 3300005347 Bacteria 1953
41 Ga0070669_100018690 3300005353 Bacteria 4954
42 Ga0070669_100267835 3300005353 Bacteria 1365
43 Ga0070669_100395958 3300005353 Bacteria 1129
44 Ga0070675_100002517 3300005354 Bacteria 13713
45 Ga0070675_100067343 3300005354 Bacteria 2963
46 Ga0070675_100166375 3300005354 Bacteria 1899
47 Ga0070671_100332789 3300005355 Bacteria 1295
48 Ga0070674_100028242 3300005356 Bacteria 3683
49 Ga0070674_100067345 3300005356 Bacteria 2518
50 Ga0070673_100023513 3300005364 Bacteria 4503
51 Ga0070688_100026284 3300005365 Bacteria 3457
52 Ga0070688_100156858 3300005365 Bacteria 1560
53 Ga0070659_100002538 3300005366 Bacteria 12980
54 Ga0070659_100024267 3300005366 Bacteria 4648
55 Ga0070667_100016211 3300005367 Bacteria 6166
56 Ga0070667_100027798 3300005367 Bacteria 4707
57 Ga0070667_100030430 3300005367 Bacteria 4503
58 Ga0070667_100099591 3300005367 Bacteria 2509
59 Ga0070667_100153384 3300005367 Bacteria 2025
60 Ga0070701_10082453 3300005438 Bacteria 1744
61 Ga0070700_100076299 3300005441 Bacteria 2152
62 Ga0070694_100052656 3300005444 Bacteria 2752
63 Ga0070694_100086379 3300005444 Bacteria 2192
64 Ga0070694_100088071 3300005444 Bacteria 2173
65 Ga0070663_100052839 3300005455 Bacteria 2899
66 Ga0070663_100061814 3300005455 Bacteria 2698
67 Ga0070663_100201876 3300005455 Bacteria 1552
68 Ga0070678_100111757 3300005456 Bacteria 2138
69 Ga0070662_100001389 3300005457 Bacteria 14908
70 Ga0070662_100022123 3300005457 Bacteria 4348
71 Ga0070662_100087815 3300005457 Bacteria 2329
72 Ga0070681_10015591 3300005458 Bacteria 7569
73 Ga0070681_10166655 3300005458 Bacteria 2126
74 Ga0070707_100513745 3300005468 Bacteria 1160
75 Ga0070699_100011473 3300005518 Bacteria 7652
76 Ga0070679_100001134 3300005530 Bacteria 23290
77 Ga0070679_100502802 3300005530 Bacteria 1156
78 Ga0070684_100005964 3300005535 Bacteria 9386
79 Ga0070684_100021138 3300005535 Bacteria 5408
80 Ga0070684_100210353 3300005535 Bacteria 1773
81 Ga0070697_100001922 3300005536 Bacteria 15904
82 Ga0068853_100025150 3300005539 Bacteria 4995
83 Ga0068853_100066343 3300005539 Bacteria 3134
84 Ga0068853_100150960 3300005539 Bacteria 2092
85 Ga0070672_100106872 3300005543 Bacteria 2277
86 Ga0070672_100169887 3300005543 Bacteria 1813
87 Ga0070686_100093397 3300005544 Bacteria 2017
88 Ga0070695_100036812 3300005545 Bacteria 3081
89 Ga0070696_100001123 3300005546 Bacteria 17326
90 Ga0070696_100194126 3300005546 Bacteria 1512
91 Ga0070693_100003115 3300005547 Bacteria 7698
92 Ga0070665_100000048 3300005548 Bacteria 265077
93 Ga0070665_100002252 3300005548 Bacteria 21445
94 Ga0070665_100080245 3300005548 Bacteria 3268
95 Ga0070665_100157623 3300005548 Bacteria 2272
96 Ga0070704_100003369 3300005549 Bacteria 9160
97 Ga0068855_100001082 3300005563 Bacteria 33864
98 Ga0068855_100033389 3300005563 Bacteria 6141
99 Ga0070664_100005461 3300005564 Bacteria 10205
100 Ga0070664_100020780 3300005564 Bacteria 5408
101 Ga0068857_100004179 3300005577 Bacteria 12158
102 Ga0068857_100113316 3300005577 Bacteria 2438
103 Ga0068857_100150154 3300005577 Bacteria 2110
104 Ga0068856_100004319 3300005614 Bacteria 14184
105 Ga0068856_100079629 3300005614 Bacteria 3249
106 Ga0068856_100112652 3300005614 Bacteria 2718
107 Ga0068856_100157855 3300005614 Bacteria 2278
108 Ga0068856_100338603 3300005614 Bacteria 1522
109 Ga0068856_100760583 3300005614 Bacteria 989
110 Ga0070702_100000739 3300005615 Bacteria 12365
111 Ga0070702_100097195 3300005615 Bacteria 1799
112 Ga0068852_100022978 3300005616 Bacteria 5011
113 Ga0068852_100035429 3300005616 Bacteria 4163
114 Ga0068859_100011259 3300005617 Bacteria 9001
115 Ga0068859_100022742 3300005617 Bacteria 6286
116 Ga0068859_100025462 3300005617 Bacteria 5935
117 Ga0068859_100073429 3300005617 Bacteria 3459
118 Ga0068864_100007311 3300005618 Bacteria 9086
119 Ga0068864_100018905 3300005618 Bacteria 5761
120 Ga0068864_100216627 3300005618 Bacteria 1765
121 Ga0068866_10149004 3300005718 Bacteria 1352
122 Ga0068861_100015487 3300005719 Bacteria 5375
123 Ga0068863_100002080 3300005841 Bacteria 19842
124 Ga0068863_100004607 3300005841 Bacteria 13580
125 Ga0068863_100010794 3300005841 Bacteria 8858
126 Ga0068863_100040645 3300005841 Bacteria 4422
127 Ga0068863_100278577 3300005841 Bacteria 1620
128 Ga0068858_100005691 3300005842 Bacteria 12182
129 Ga0068858_100007120 3300005842 Bacteria 10861
130 Ga0068858_100026305 3300005842 Bacteria 5409
131 Ga0068860_100000054 3300005843 Bacteria 206114
132 Ga0068860_100001647 3300005843 Bacteria 23884
133 Ga0068860_100010975 3300005843 Bacteria 8929
134 Ga0068860_100052234 3300005843 Bacteria 3888
135 Ga0068860_100155355 3300005843 Bacteria 2204
136 Ga0068862_100000032 3300005844 Bacteria 179887
137 Ga0068862_100032747 3300005844 Bacteria 4390
138 Ga0068862_100032971 3300005844 Bacteria 4375
139 Ga0068862_100034166 3300005844 Bacteria 4301
140 Ga0070717_10213807 3300006028 Bacteria 1693
141 Ga0075368_10000663 3300006042 Bacteria 10447
142 Ga0075368_10001089 3300006042 Bacteria 8526
143 Ga0075363_100000245 3300006048 Bacteria 15302
144 Ga0075364_10002698 3300006051 Bacteria 9972
145 Ga0075364_10006458 3300006051 Bacteria 6888
146 Ga0075362_10007400 3300006177 Bacteria 4157
147 Ga0075369_10005211 3300006186 Bacteria 4842
148 Ga0075366_10013774 3300006195 Bacteria 4609
149 Ga0075366_10081240 3300006195 Bacteria 1936
150 Ga0075366_10129868 3300006195 Bacteria 1520
151 Ga0097621_100023497 3300006237 Bacteria 4801
152 Ga0097621_100071450 3300006237 Bacteria 2868
153 Ga0097621_100313027 3300006237 Bacteria 1389
154 Ga0068871_100180083 3300006358 Bacteria 1816
155 Ga0068871_100183070 3300006358 Bacteria 1801
156 Ga0075428_100021700 3300006844 Bacteria 7108
157 Ga0075430_100001250 3300006846 Bacteria 20446
158 Ga0075430_100302949 3300006846 Bacteria 1322
159 Ga0075434_100059153 3300006871 Bacteria 3810
160 Ga0068865_100101280 3300006881 Bacteria 2109
161 Ga0068865_100434524 3300006881 Bacteria 1082
162 Ga0097620_100011259 3300006931 Bacteria 9001
163 Ga0097620_100022742 3300006931 Bacteria 6286
164 Ga0097620_100025463 3300006931 Bacteria 5935
165 Ga0097620_100073421 3300006931 Bacteria 3459
166 Ga0105240_10009952 3300009093 Bacteria 13403
167 Ga0105240_10011621 3300009093 Bacteria 12245
168 Ga0105240_10152023 3300009093 Bacteria 2756
169 Ga0105240_10366227 3300009093 Bacteria 1631
170 Ga0111539_10108770 3300009094 Bacteria 3253
171 Ga0111539_10770196 3300009094 Bacteria 1120
172 Ga0105245_10001793 3300009098 Bacteria 19550
173 Ga0105245_10004384 3300009098 Bacteria 12493
174 Ga0105245_10032489 3300009098 Bacteria 4621
175 Ga0105245_10167461 3300009098 Bacteria 2090
176 Ga0105245_10187615 3300009098 Bacteria 1979
177 Ga0105247_10002408 3300009101 Bacteria 12723
178 Ga0105247_10004527 3300009101 Bacteria 8865
179 Ga0105241_10001690 3300009174 Bacteria 16770
180 Ga0105241_10008910 3300009174 Bacteria 7378
181 Ga0105241_10065064 3300009174 Bacteria 2817
182 Ga0105241_10067774 3300009174 Bacteria 2763
183 Ga0105241_10318812 3300009174 Bacteria 1340
184 Ga0105241_10426017 3300009174 Bacteria 1169
185 Ga0105242_10003032 3300009176 Bacteria 13125
186 Ga0105242_10028835 3300009176 Bacteria 4421
187 Ga0105242_10114501 3300009176 Bacteria 2304
188 Ga0105242_10299583 3300009176 Bacteria 1467
189 Ga0105248_10001949 3300009177 Bacteria 22933
190 Ga0105248_10166848 3300009177 Bacteria 2482
191 Ga0105237_10091841 3300009545 Bacteria 3026
192 Ga0105237_10151322 3300009545 Bacteria 2317
193 Ga0105238_10038984 3300009551 Bacteria 4821
194 Ga0105238_10079410 3300009551 Bacteria 3271
195 Ga0105238_10114493 3300009551 Bacteria 2676
196 Ga0105238_10136382 3300009551 Bacteria 2432
197 Ga0105238_10203551 3300009551 Bacteria 1955
198 Ga0105238_10712086 3300009551 Bacteria 1016
199 Ga0105249_10000017 3300009553 Bacteria 277115
200 Ga0105249_10076120 3300009553 Bacteria 3110
201 Ga0105249_10083760 3300009553 Bacteria 2969
202 Ga0105249_10214874 3300009553 Bacteria 1889
203 Ga0105239_10012089 3300010375 Bacteria 9627
204 Ga0105239_10029865 3300010375 Bacteria 5995
205 Ga0105239_10321852 3300010375 Bacteria 1744
206 Ga0105246_10002722 3300011119 Bacteria 10690
207 Ga0105246_10036248 3300011119 Bacteria 3303
208 Ga0157373_10003590 3300013100 Bacteria 11719
209 Ga0157371_10005635 3300013102 Bacteria 10517
210 Ga0157371_10044401 3300013102 Bacteria 3165
211 Ga0157370_10105347 3300013104 Bacteria 2639
212 Ga0157369_10053723 3300013105 Bacteria 4352
213 Ga0157369_10178479 3300013105 Bacteria 2235
214 Ga0157369_10202439 3300013105 Bacteria 2083
215 Ga0157369_10345880 3300013105 Bacteria 1545
216 Ga0157374_10001347 3300013296 Bacteria 20902
217 Ga0157374_10229849 3300013296 Bacteria 1822
218 Ga0157378_10007882 3300013297 Bacteria 9294
219 Ga0157378_10033156 3300013297 Bacteria 4564
220 Ga0163162_10010090 3300013306 Bacteria 9183
221 Ga0157372_10000973 3300013307 Bacteria 31256
222 Ga0157372_10012098 3300013307 Bacteria 9191
223 Ga0157372_10016907 3300013307 Bacteria 7830
224 Ga0157372_10035924 3300013307 Bacteria 5457
225 Ga0157372_10109400 3300013307 Bacteria 3165
226 Ga0157375_10021465 3300013308 Bacteria 5922
227 Ga0157375_10092857 3300013308 Bacteria 3082
228 Ga0157375_10121711 3300013308 Bacteria 2719
229 Ga0157375_10259566 3300013308 Bacteria 1899
230 Ga0163163_10013909 3300014325 Bacteria 7382
231 Ga0163163_10036462 3300014325 Bacteria 4777
232 Ga0163163_10150925 3300014325 Bacteria 2367
233 Ga0163163_10400809 3300014325 Bacteria 1430
234 Ga0157380_10002196 3300014326 Bacteria 13116
235 Ga0157380_10080040 3300014326 Bacteria 2670
236 Ga0182008_10081109 3300014497 Bacteria 1597
237 Ga0157377_10052642 3300014745 Bacteria 2299
238 Ga0157379_10071870 3300014968 Bacteria 3095
239 Ga0157379_10090155 3300014968 Bacteria 2751
240 Ga0157376_10062637 3300014969 Bacteria 3130
241 Ga0157376_10094339 3300014969 Bacteria 2600
242 Ga0213872_10041516 3300021361 Bacteria 2099
243 Ga0213876_10000454 3300021384 Bacteria 32974
244 Ga0213876_10002349 3300021384 Bacteria 11145
245 Ga0209565_1000090 3300025263 Bacteria 146540
246 Ga0209673_1001000 3300025273 Bacteria 34384
247 Ga0209025_1000794 3300025294 Bacteria 51442
248 Ga0209025_1045647 3300025294 Bacteria 1814
249 Ga0209564_1030784 3300025295 Bacteria 1655
250 Ga0209758_1000017 3300025297 Bacteria 754393
251 Ga0209758_1000999 3300025297 Bacteria 37624
252 Ga0209050_1045173 3300025298 Bacteria 1171
253 Ga0209256_1002391 3300025299 Bacteria 15466
254 Ga0209256_1006740 3300025299 Bacteria 5947
255 Ga0209257_1003672 3300025304 Bacteria 12835
256 Ga0207697_10059972 3300025315 Bacteria 1582
257 Ga0207655_1000111 3300025728 Bacteria 170772
258 Ga0207655_1033430 3300025728 Bacteria 2331
259 Ga0207710_10002630 3300025900 Bacteria 8285
260 Ga0207710_10031808 3300025900 Bacteria 2310
261 Ga0207688_10089979 3300025901 Bacteria 1761
262 Ga0207680_10013288 3300025903 Bacteria 4225
263 Ga0207680_10024830 3300025903 Bacteria 3296
264 Ga0207680_10241738 3300025903 Bacteria 1244
265 Ga0207647_10019815 3300025904 Bacteria 4518
266 Ga0207699_10012681 3300025906 Bacteria 4291
267 Ga0207645_10054274 3300025907 Bacteria 2559
268 Ga0207654_10011431 3300025911 Bacteria 4530
269 Ga0207654_10015066 3300025911 Bacteria 4005
270 Ga0207654_10016786 3300025911 Bacteria 3817
271 Ga0207654_10046447 3300025911 Bacteria 2476
272 Ga0207707_10003020 3300025912 Bacteria 14960
273 Ga0207707_10350682 3300025912 Bacteria 1272
274 Ga0207695_10009190 3300025913 Bacteria 12256
275 Ga0207695_10013078 3300025913 Bacteria 9909
276 Ga0207695_10314254 3300025913 Bacteria 1457
277 Ga0207671_10017691 3300025914 Bacteria 5491
278 Ga0207671_10041276 3300025914 Bacteria 3414
279 Ga0207662_10051259 3300025918 Bacteria 2455
280 Ga0207662_10124499 3300025918 Bacteria 1620
281 Ga0207657_10008501 3300025919 Bacteria 10413
282 Ga0207657_10072407 3300025919 Bacteria 2915
283 Ga0207649_10002582 3300025920 Bacteria 10078
284 Ga0207652_10050525 3300025921 Bacteria 3563
285 Ga0207652_10061252 3300025921 Bacteria 3249
286 Ga0207681_10048289 3300025923 Bacteria 2872
287 Ga0207681_10063334 3300025923 Bacteria 2550
288 Ga0207681_10317158 3300025923 Bacteria 1238
289 Ga0207694_10026802 3300025924 Bacteria 4388
290 Ga0207694_10064528 3300025924 Bacteria 2854
291 Ga0207694_10088439 3300025924 Bacteria 2442
292 Ga0207694_10158058 3300025924 Bacteria 1829
293 Ga0207650_10015501 3300025925 Bacteria 5309
294 Ga0207659_10003260 3300025926 Bacteria 9718
295 Ga0207659_10029557 3300025926 Bacteria 3737
296 Ga0207687_10007391 3300025927 Bacteria 7231
297 Ga0207687_10008601 3300025927 Bacteria 6675
298 Ga0207687_10052406 3300025927 Bacteria 2847
299 Ga0207700_10053211 3300025928 Bacteria 3032
300 Ga0207644_10242621 3300025931 Bacteria 1435
301 Ga0207690_10003637 3300025932 Bacteria 9180
302 Ga0207690_10089660 3300025932 Bacteria 2169
303 Ga0207706_10006981 3300025933 Bacteria 10439
304 Ga0207706_10007452 3300025933 Bacteria 10120
305 Ga0207706_10044032 3300025933 Bacteria 3955
306 Ga0207706_10398998 3300025933 Bacteria 1192
307 Ga0207686_10023986 3300025934 Bacteria 3528
308 Ga0207709_10038488 3300025935 Bacteria 2849
309 Ga0207670_10015909 3300025936 Bacteria 4506
310 Ga0207670_10110963 3300025936 Bacteria 1976
311 Ga0207691_10171941 3300025940 Bacteria 1897
312 Ga0207711_10198250 3300025941 Bacteria 1831
313 Ga0207689_10006749 3300025942 Bacteria 10112
314 Ga0207689_10019002 3300025942 Bacteria 5796
315 Ga0207689_10020796 3300025942 Bacteria 5520
316 Ga0207689_10078384 3300025942 Bacteria 2715
317 Ga0207689_10086274 3300025942 Bacteria 2580
318 Ga0207689_10092977 3300025942 Bacteria 2477
319 Ga0207661_10001091 3300025944 Bacteria 18020
320 Ga0207661_10018071 3300025944 Bacteria 5234
321 Ga0207661_10052037 3300025944 Bacteria 3270
322 Ga0207661_10167775 3300025944 Bacteria 1909
323 Ga0207679_10009547 3300025945 Bacteria 6220
324 Ga0207679_10394644 3300025945 Bacteria 1216
325 Ga0207667_10005618 3300025949 Bacteria 15301
326 Ga0207667_10207986 3300025949 Bacteria 2006
327 Ga0207651_10016551 3300025960 Bacteria 4324
328 Ga0207712_10000012 3300025961 Bacteria 392363
329 Ga0207712_10020610 3300025961 Bacteria 4320
330 Ga0207712_10097476 3300025961 Bacteria 2178
331 Ga0207668_10002310 3300025972 Bacteria 11137
332 Ga0207668_10044684 3300025972 Bacteria 3015
333 Ga0207668_10099946 3300025972 Bacteria 2153
334 Ga0207668_10181897 3300025972 Bacteria 1659
335 Ga0207668_10212808 3300025972 Bacteria 1547
336 Ga0207658_10008834 3300025986 Bacteria 6837
337 Ga0207658_10020845 3300025986 Bacteria 4541
338 Ga0207658_10314687 3300025986 Bacteria 1353
339 Ga0207677_10005731 3300026023 Bacteria 6754
340 Ga0207677_10056521 3300026023 Bacteria 2689
341 Ga0207677_10244218 3300026023 Bacteria 1454
342 Ga0207703_10003928 3300026035 Bacteria 12333
343 Ga0207703_10026524 3300026035 Bacteria 4561
344 Ga0207703_10028305 3300026035 Bacteria 4417
345 Ga0207703_10210794 3300026035 Bacteria 1732
346 Ga0207639_10026452 3300026041 Bacteria 4217
347 Ga0207639_10028432 3300026041 Bacteria 4082
348 Ga0207639_10051215 3300026041 Bacteria 3140
349 Ga0207678_10002473 3300026067 Bacteria 16788
350 Ga0207678_10074025 3300026067 Bacteria 2918
351 Ga0207708_10015924 3300026075 Bacteria 5646
352 Ga0207702_10009589 3300026078 Bacteria 8129
353 Ga0207702_10015199 3300026078 Bacteria 6383
354 Ga0207702_10022661 3300026078 Bacteria 5208
355 Ga0207702_10096694 3300026078 Bacteria 2598
356 Ga0207702_10168389 3300026078 Bacteria 2007
357 Ga0207702_10674195 3300026078 Bacteria 1018
358 Ga0207641_10002117 3300026088 Bacteria 18786
359 Ga0207641_10003207 3300026088 Bacteria 14643
360 Ga0207641_10003750 3300026088 Bacteria 13357
361 Ga0207641_10007852 3300026088 Bacteria 8857
362 Ga0207641_10154558 3300026088 Bacteria 2081
363 Ga0207641_10444384 3300026088 Bacteria 1252
364 Ga0207648_10104132 3300026089 Bacteria 2488
365 Ga0207676_10003252 3300026095 Bacteria 11569
366 Ga0207676_10110394 3300026095 Bacteria 2300
367 Ga0207674_10001148 3300026116 Bacteria 34315
368 Ga0207674_10441158 3300026116 Bacteria 1258
369 Ga0207675_100001878 3300026118 Bacteria 21012
370 Ga0207675_100013270 3300026118 Bacteria 7691
371 Ga0207683_10003236 3300026121 Bacteria 14212
372 Ga0207698_10104911 3300026142 Bacteria 2353
373 Ga0207698_10205429 3300026142 Bacteria 1768
374 Ga0209371_1000002 3300027312 Bacteria 1551985
375 Ga0209371_1000120 3300027312 Bacteria 132938
376 Ga0209971_1013186 3300027682 Bacteria 1958
377 Ga0209974_10021074 3300027876 Bacteria 2160
378 Ga0268266_10000358 3300028379 Bacteria 70786
379 Ga0268266_10001523 3300028379 Bacteria 27130
380 Ga0268266_10105073 3300028379 Bacteria 2494
381 Ga0268265_10000081 3300028380 Bacteria 120869
382 Ga0268265_10018071 3300028380 Bacteria 4882
383 Ga0268265_10028396 3300028380 Bacteria 4004
384 Ga0268264_10000097 3300028381 Bacteria 229722
385 Ga0268264_10003030 3300028381 Bacteria 14572
386 Ga0268264_10024197 3300028381 Bacteria 4956
387 Ga0268264_10295882 3300028381 Bacteria 1522
388 Ga0268264_10449350 3300028381 Bacteria 1248
389 Ga0268256_1000002 3300030500 Bacteria 1535763
390 Ga0268256_1001088 3300030500 Bacteria 17848
391 Ga0265328_10011567 3300031239 Bacteria 3521
392 Ga0265331_10000390 3300031250 Bacteria 45388
393 Ga0265327_10000859 3300031251 Bacteria 45360
394 Ga0265316_10009108 3300031344 Bacteria 9144
395 Ga0307513_10057264 3300031456 Bacteria 4154
396 Ga0316575_10071080 3300031665 Bacteria 1398
397 Ga0265314_10027930 3300031711 Bacteria 4216
398 Ga0307410_10013663 3300031852 Bacteria 4746
399 Ga0307407_10004284 3300031903 Bacteria 6024
400 Ga0307416_100036400 3300032002 Bacteria 3774
401 Ga0307414_10010035 3300032004 Bacteria 5472
402 Ga0307411_10006780 3300032005 Bacteria 5765
403 Ga0307415_100008640 3300032126 Bacteria 5659
404 Ga0307510_10017468 3300033180 Bacteria 8459
405 Ga0373934_0053581 3300035086 Bacteria 1600
406 Ga0373923_0101566 3300035111 Bacteria 1269
407 Ga0373941_0011048 3300035115 Bacteria 2324
408 Ga0373955_0014369 3300035172 Bacteria 3850
409 Ga0373955_0057627 3300035172 Bacteria 2135
410 Ga0373961_0000150 3300035241 Bacteria 34332
411 Ga0373962_0043098 3300035242 Bacteria 1278
412 Ga0373935_0108097 3300035692 Bacteria 1843
413 Ga0373933_0201885 3300035724 Bacteria 1272
414 Ga0373933_0315460 3300035724 Bacteria 1013
415 Ga0373937_0111000 3300036401 Bacteria 2550
416 Ga0395898_0058786 3300037466 Bacteria 3742
417 Ga0395905_0017780 3300037471 Bacteria 6753
418 Ga0395905_0285999 3300037471 Bacteria 1536
419 Ga0395901_0109455 3300038443 Bacteria 2901
420 Ga0400490_01037 3300038726 Bacteria 12310
421 Ga0400483_209481 3300039062 Bacteria 2395
422 Ga0436365_0499375 3300039437 Bacteria 98723
423 Ga0436365_0866656 3300039437 Bacteria 2064
424 Ga0436365_1326821 3300039437 Bacteria 37380
425 Ga0436363_0359992 3300039450 Bacteria 2727
426 Ga0436363_1626008 3300039450 Bacteria 4615
427 Ga0439447_003273 3300041407 Bacteria 5761
428 Ga0439466_0000450 3300041411 Bacteria 15663
429 Ga0439452_003762 3300042010 Bacteria 5226
430 Ga0451577_0000041 3300042876 Bacteria 335318
431 Ga0451577_0001488 3300042876 Bacteria 31005
432 Ga0453683_0007367 3300044673 Bacteria 7472
433 Ga0453684_0000066 3300044712 Bacteria 465545
434 Ga0451576_0017861 3300045051 Bacteria 7792
435 Ga0451576_0083175 3300045051 Bacteria 3330
436 Ga0466967_0032202 3300045976 Bacteria 4424
437 Ga0466967_0412241 3300045976 Bacteria 1316
438 Ga0466967_0497249 3300045976 Bacteria 1196
439 Ga0495629_0060216 3300046459 Bacteria 2654
440 Ga0495629_0068291 3300046459 Bacteria 2480
441 Ga0495638_0000996 3300046460 Bacteria 28464
442 Ga0495650_0056345 3300046471 Bacteria 1595
443 Ga0495580_0145717 3300046472 Bacteria 1641
444 Ga0495594_0242043 3300046499 Bacteria 1028
445 Ga0495583_0000003 3300046506 Bacteria 709273
446 Ga0495610_0032003 3300046512 Bacteria 2738
447 Ga0495616_0044405 3300046513 Bacteria 2254
448 Ga0495628_0019871 3300046516 Bacteria 5549
449 Ga0495630_0076272 3300046517 Bacteria 2526
450 Ga0495632_0014505 3300046519 Bacteria 4453
451 Ga0495637_0002909 3300046520 Bacteria 9256
452 Ga0495643_0000824 3300046522 Bacteria 33778
453 Ga0495643_0009015 3300046522 Bacteria 6261
454 Ga0495648_0043134 3300046524 Bacteria 2831
455 Ga0495642_0004720 3300046528 Bacteria 5278
456 Ga0495654_0000016 3300046530 Bacteria 306416
457 Ga0495665_0059580 3300046531 Bacteria 2015
458 Ga0495587_0006235 3300046536 Bacteria 7784
459 Ga0495587_0059100 3300046536 Bacteria 2251
460 Ga0495645_0003877 3300046543 Bacteria 10187
461 Ga0495667_0165949 3300046559 Bacteria 1419
462 Ga0495668_0000013 3300046616 Bacteria 452938
463 Ga0495625_0000795 3300046660 Bacteria 43736
464 Ga0495625_0046381 3300046660 Bacteria 3136
465 Ga0495625_0355080 3300046660 Bacteria 925
466 Ga0495635_0039386 3300046663 Bacteria 3270
467 Ga0495657_0251021 3300046675 Bacteria 1065
468 Ga0495599_0000961 3300046678 Bacteria 16113
469 Ga0495599_0021874 3300046678 Bacteria 3992
470 Ga0495623_0013898 3300046679 Bacteria 5219
471 Ga0495670_0013523 3300046691 Bacteria 4014
472 Ga0495600_0141369 3300046809 Bacteria 1562
473 Ga0495581_0031555 3300047315 Bacteria 3070
474 Ga0495604_0045665 3300047317 Bacteria 3418
475 Ga0495674_0133679 3300047319 Bacteria 2089
476 Ga0495680_0217098 3300047322 Bacteria 1367
477 Ga0495687_000080 3300047443 Bacteria 147467
478 Ga0495677_0000148 3300047445 Bacteria 33532
479 Ga0495684_0004932 3300047471 Bacteria 10418
480 Ga0495602_0118215 3300048088 Bacteria 2138
481 Ga0496101_0056454 3300048904 Bacteria 2839
482 Ga0496102_0007448 3300048905 Bacteria 9354
483 Ga0496103_0196676 3300048906 Bacteria 1296
484 Ga0496104_0142596 3300048907 Bacteria 2302
485 Ga0496105_0094154 3300048908 Bacteria 2474
486 Ga0496106_0047605 3300048909 Bacteria 3227
487 Ga0496107_0000034 3300048910 Bacteria 91621
488 Ga0496108_0041945 3300048911 Bacteria 3820
489 Ga0496109_0077664 3300048912 Bacteria 3056
490 Ga0496109_0099064 3300048912 Bacteria 2703
491 Ga0496110_0377879 3300048913 Bacteria 1291
492 Ga0496111_0392170 3300048914 Bacteria 1026
493 Ga0496112_0005603 3300048915 Bacteria 10891
494 Ga0496113_0033623 3300048916 Bacteria 3736
495 Ga0496115_0000617 3300048918 Bacteria 27037
496 Ga0496116_0003497 3300048919 Bacteria 15462
497 Ga0496116_0004238 3300048919 Bacteria 13773
498 Ga0496117_0000154 3300048920 Bacteria 146606
499 Ga0496117_0075034 3300048920 Bacteria 2248
500 Ga0496118_0000150 3300048921 Bacteria 123251
501 Ga0496119_0010270 3300048922 Bacteria 7893
502 Ga0496119_0012367 3300048922 Bacteria 6939
503 Ga0496120_0000476 3300048923 Bacteria 62924
504 Ga0496120_0020471 3300048923 Bacteria 4203
505 Ga0496121_0000389 3300048924 Bacteria 89759
506 Ga0496121_0032620 3300048924 Bacteria 4731
507 Ga0496121_0036886 3300048924 Bacteria 4350
508 Ga0496124_0002597 3300048927 Bacteria 23374
509 Ga0496124_0005736 3300048927 Bacteria 13822
510 Ga0496124_0006334 3300048927 Bacteria 12918
511 Ga0496124_0025013 3300048927 Bacteria 5414
512 Ga0496124_0121588 3300048927 Bacteria 2085
513 Ga0496125_0000006 3300048928 Bacteria 759385
514 Ga0496125_0167293 3300048928 Bacteria 1484
515 Ga0496126_0008533 3300048929 Bacteria 11048
516 Ga0501034_0382247 3300049571 Bacteria 1333
517 Ga0501036_0407289 3300049572 Bacteria 1134
518 Ga0501037_0044318 3300049573 Bacteria 3267
519 Ga0501040_0102244 3300049576 Bacteria 2000
520 Ga0501047_0000742 3300049581 Bacteria 33985
521 Ga0501072_0082089 3300049588 Bacteria 2555
522 Ga0501073_0023217 3300049589 Bacteria 4457
523 Ga0501075_0154222 3300049591 Bacteria 1751
524 Ga0501238_002629 3300049671 Bacteria 2160
525 Ga0501079_0140598 3300049741 Bacteria 1881
526 Ga0501083_0000809 3300049744 Bacteria 20519
527 nmdc:mga0k408_53786_c1 3300050493 Bacteria 2333
528 nmdc:mga07m45_32541_c1 3300050496 Bacteria 2892
529 nmdc:mga05p37_47878_c1 3300050507 Bacteria 5257
530 nmdc:mga09592_292920_c1 3300050508 Bacteria 1411
531 nmdc:mga0qj67_17874_c1 3300050509 Bacteria 5397
532 nmdc:mga0qj67_94559_c1 3300050509 Bacteria 2404
533 nmdc:mga08y16_218354_c1 3300050511 Bacteria 1974
534 nmdc:mga0n895_144000_c1 3300050512 Bacteria 2412
535 nmdc:mga0n895_687993_c1 3300050512 Bacteria 1019
536 nmdc:mga0sz30_22420_c1 3300050516 Bacteria 2563
537 Ga0495619_0168060 3300053085 Bacteria 1516
538 Ga0500556_0000401 3300053104 Bacteria 31673
539 Ga0500616_0014124 3300053153 Bacteria 4601
540 Ga0500616_0017070 3300053153 Bacteria 4121
541 Ga0500636_0028996 3300053177 Bacteria 3268
542 Ga0500645_001858 3300053730 Bacteria 10118
543 Ga0501084_0247846 3300054114 Bacteria 1504
544 Ga0501082_0012135 3300060353 Bacteria 7402
545 Ga0501082_0086135 3300060353 Bacteria 2710

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048088 Ga0495602_0118215 Ga0495602_0118215_530_1417 257
2 3300005614 Ga0068856_100760583 Ga0068856_1007605831 282
3 3300013105 Ga0157369_10345880 Ga0157369_103458802 282
4 3300013307 Ga0157372_10016907 Ga0157372_100169077 282
5 3300025924 Ga0207694_10026802 Ga0207694_100268023 282
6 3300025933 Ga0207706_10044032 Ga0207706_100440324 282
7 3300026078 Ga0207702_10674195 Ga0207702_106741951 282
8 iso_pu_bacteria 2849573788 2849577329 283
9 iso_pu_bacteria 2865014394 2865017424 283
10 iso_pu_bacteria 2602042067 2603705184 284
11 iso_pu_bacteria 2855195626 2855199392 285
12 iso_pu_bacteria 2858466076 2858470185 285
13 iso_pu_bacteria 2871272651 2871275362 285
14 iso_pu_bacteria 2919108558 2919111260 285
15 3300005290 Ga0065712_10165267 Ga0065712_101652672 287
16 3300005330 Ga0070690_100008468 Ga0070690_1000084682 287
17 3300005331 Ga0070670_100207587 Ga0070670_1002075873 287
18 3300005335 Ga0070666_10041563 Ga0070666_100415632 287
19 3300005353 Ga0070669_100267835 Ga0070669_1002678351 287
20 3300005354 Ga0070675_100166375 Ga0070675_1001663752 287
21 3300005365 Ga0070688_100026284 Ga0070688_1000262844 287
22 3300005367 Ga0070667_100016211 Ga0070667_1000162113 287
23 3300005577 Ga0068857_100113316 Ga0068857_1001133163 287
24 3300005617 Ga0068859_100073429 Ga0068859_1000734294 287
25 3300005618 Ga0068864_100216627 Ga0068864_1002166272 287
26 3300005844 Ga0068862_100032747 Ga0068862_1000327474 287
27 3300006195 Ga0075366_10081240 Ga0075366_100812401 287
28 3300006881 Ga0068865_100434524 Ga0068865_1004345242 287
29 3300006931 Ga0097620_100073421 Ga0097620_1000734214 287
30 3300025294 Ga0209025_1045647 Ga0209025_10456472 287
31 3300025903 Ga0207680_10024830 Ga0207680_100248304 287
32 3300025913 Ga0207695_10314254 Ga0207695_103142541 287
33 3300025923 Ga0207681_10317158 Ga0207681_103171582 287
34 3300025926 Ga0207659_10029557 Ga0207659_100295572 287
35 3300025942 Ga0207689_10020796 Ga0207689_100207962 287
36 3300025944 Ga0207661_10052037 Ga0207661_100520372 287
37 3300025949 Ga0207667_10207986 Ga0207667_102079862 287
38 3300025961 Ga0207712_10020610 Ga0207712_100206103 287
39 3300025972 Ga0207668_10002310 Ga0207668_1000231010 287
40 3300025972 Ga0207668_10212808 Ga0207668_102128082 287
41 3300025986 Ga0207658_10314687 Ga0207658_103146871 287
42 3300026088 Ga0207641_10154558 Ga0207641_101545582 287
43 3300027312 Ga0209371_1000120 Ga0209371_100012054 287
44 3300030500 Ga0268256_1001088 Ga0268256_10010883 287
45 3300039062 Ga0400483_209481 Ga0400483_209481_704_1573 287
46 3300041411 Ga0439466_0000450 Ga0439466_0000450_1575_2438 287
47 3300046520 Ga0495637_0002909 Ga0495637_0002909_4390_5253 287
48 3300048919 Ga0496116_0004238 Ga0496116_0004238_1408_2271 287
49 3300048920 Ga0496117_0000154 Ga0496117_0000154_67535_68398 287
50 3300048921 Ga0496118_0000150 Ga0496118_0000150_67535_68398 287
51 3300048922 Ga0496119_0012367 Ga0496119_0012367_4646_5509 287
52 3300048923 Ga0496120_0020471 Ga0496120_0020471_1454_2317 287
53 3300048924 Ga0496121_0000389 Ga0496121_0000389_87476_88339 287
54 3300048927 Ga0496124_0005736 Ga0496124_0005736_1430_2293 287
55 3300048927 Ga0496124_0006334 Ga0496124_0006334_9844_10707 287
56 3300048929 Ga0496126_0008533 Ga0496126_0008533_1430_2293 287
57 3300049671 Ga0501238_002629 Ga0501238_002629_765_1628 287
58 3300050493 nmdc:mga0k408_53786_c1 nmdc:mga0k408_53786_c1_697_1560 287
59 3300053104 Ga0500556_0000401 Ga0500556_0000401_8336_9199 287
60 3300053730 Ga0500645_001858 Ga0500645_001858_1731_2594 287
61 iso_pu_bacteria 2600255256 2601534817 287
62 iso_pu_bacteria 2600255257 2601539554 287
63 iso_pu_bacteria 2600255310 2601757904 287
64 iso_pu_bacteria 2600255311 2601764262 287
65 iso_pu_bacteria 2847797336 2847799125 287
66 3300003775 Ga0055524_1004355 Ga0055524_10043552 288
67 3300003790 Ga0055528_1018983 Ga0055528_10189832 288
68 3300005335 Ga0070666_10013029 Ga0070666_100130295 288
69 3300005367 Ga0070667_100099591 Ga0070667_1000995912 288
70 3300005617 Ga0068859_100022742 Ga0068859_1000227422 288
71 3300005841 Ga0068863_100004607 Ga0068863_10000460711 288
72 3300005841 Ga0068863_100040645 Ga0068863_1000406453 288
73 3300005843 Ga0068860_100000054 Ga0068860_100000054159 288
74 3300005843 Ga0068860_100001647 Ga0068860_1000016477 288
75 3300005844 Ga0068862_100000032 Ga0068862_10000003212 288
76 3300006931 Ga0097620_100022742 Ga0097620_1000227422 288
77 3300009101 Ga0105247_10002408 Ga0105247_100024089 288
78 3300009545 Ga0105237_10091841 Ga0105237_100918414 288
79 3300009553 Ga0105249_10000017 Ga0105249_10000017260 288
80 3300009553 Ga0105249_10214874 Ga0105249_102148742 288
81 3300014968 Ga0157379_10071870 Ga0157379_100718704 288
82 3300025263 Ga0209565_1000090 Ga0209565_100009062 288
83 3300025273 Ga0209673_1001000 Ga0209673_100100025 288
84 3300025295 Ga0209564_1030784 Ga0209564_10307841 288
85 3300025297 Ga0209758_1000999 Ga0209758_100099925 288
86 3300025299 Ga0209256_1002391 Ga0209256_100239111 288
87 3300025299 Ga0209256_1006740 Ga0209256_10067403 288
88 3300025900 Ga0207710_10002630 Ga0207710_100026307 288
89 3300025961 Ga0207712_10000012 Ga0207712_1000001291 288
90 3300025961 Ga0207712_10097476 Ga0207712_100974763 288
91 3300025972 Ga0207668_10181897 Ga0207668_101818972 288
92 3300026088 Ga0207641_10002117 Ga0207641_1000211711 288
93 3300026088 Ga0207641_10003207 Ga0207641_100032072 288
94 3300028379 Ga0268266_10001523 Ga0268266_100015239 288
95 3300028380 Ga0268265_10000081 Ga0268265_1000008197 288
96 3300028381 Ga0268264_10000097 Ga0268264_1000009768 288
97 3300028381 Ga0268264_10003030 Ga0268264_100030302 288
98 3300046460 Ga0495638_0000996 Ga0495638_0000996_9470_10336 288
99 3300046506 Ga0495583_0000003 Ga0495583_0000003_611597_612463 288
100 3300046512 Ga0495610_0032003 Ga0495610_0032003_1768_2634 288
101 3300046519 Ga0495632_0014505 Ga0495632_0014505_3466_4332 288
102 3300046524 Ga0495648_0043134 Ga0495648_0043134_1359_2225 288
103 3300046530 Ga0495654_0000016 Ga0495654_0000016_34700_35566 288
104 3300046660 Ga0495625_0000795 Ga0495625_0000795_1490_2356 288
105 3300046660 Ga0495625_0046381 Ga0495625_0046381_92_958 288
106 3300046660 Ga0495625_0355080 Ga0495625_0355080_12_878 288
107 3300046691 Ga0495670_0013523 Ga0495670_0013523_601_1467 288
108 3300048904 Ga0496101_0056454 Ga0496101_0056454_553_1419 288
109 3300048909 Ga0496106_0047605 Ga0496106_0047605_2113_2979 288
110 3300048910 Ga0496107_0000034 Ga0496107_0000034_79641_80507 288
111 3300048918 Ga0496115_0000617 Ga0496115_0000617_89_955 288
112 3300053153 Ga0500616_0014124 Ga0500616_0014124_22_888 288
113 iso_pu_bacteria 2608642108 2608671392 288
114 iso_pu_bacteria 2870782633 2870788478 288
115 3300005343 Ga0070687_100107145 Ga0070687_1001071452 289
116 3300005444 Ga0070694_100052656 Ga0070694_1000526563 289
117 3300005549 Ga0070704_100003369 Ga0070704_1000033699 289
118 3300005617 Ga0068859_100025462 Ga0068859_1000254626 289
119 3300005719 Ga0068861_100015487 Ga0068861_1000154874 289
120 3300005842 Ga0068858_100005691 Ga0068858_1000056917 289
121 3300005844 Ga0068862_100034166 Ga0068862_1000341663 289
122 3300006931 Ga0097620_100025463 Ga0097620_1000254632 289
123 3300009098 Ga0105245_10032489 Ga0105245_100324892 289
124 3300009174 Ga0105241_10318812 Ga0105241_103188122 289
125 3300021384 Ga0213876_10000454 Ga0213876_100004543 289
126 3300025918 Ga0207662_10124499 Ga0207662_101244992 289
127 3300025927 Ga0207687_10052406 Ga0207687_100524062 289
128 3300025942 Ga0207689_10092977 Ga0207689_100929772 289
129 3300026035 Ga0207703_10003928 Ga0207703_100039287 289
130 3300026075 Ga0207708_10015924 Ga0207708_100159246 289
131 3300026118 Ga0207675_100013270 Ga0207675_1000132706 289
132 3300031852 Ga0307410_10013663 Ga0307410_100136633 289
133 3300031903 Ga0307407_10004284 Ga0307407_100042844 289
134 3300032002 Ga0307416_100036400 Ga0307416_1000364003 289
135 3300032004 Ga0307414_10010035 Ga0307414_100100352 289
136 3300032005 Ga0307411_10006780 Ga0307411_100067802 289
137 3300032126 Ga0307415_100008640 Ga0307415_1000086402 289
138 3300039437 Ga0436365_0499375 Ga0436365_0499375_27239_28108 289
139 3300039450 Ga0436363_0359992 Ga0436363_0359992_1640_2515 289
140 3300046471 Ga0495650_0056345 Ga0495650_0056345_53_925 289
141 3300047315 Ga0495581_0031555 Ga0495581_0031555_1795_2688 289
142 3300049571 Ga0501034_0382247 Ga0501034_0382247_154_1023 289
143 3300050507 nmdc:mga05p37_47878_c1 nmdc:mga05p37_47878_c1_888_1760 289
144 iso_pu_bacteria 2600255067 2600812697 289
145 iso_pu_bacteria 2883291878 2883295138 289
146 3300005293 Ga0065715_10149355 Ga0065715_101493552 290
147 3300005328 Ga0070676_10143023 Ga0070676_101430231 290
148 3300005331 Ga0070670_100179730 Ga0070670_1001797302 290
149 3300005334 Ga0068869_100015212 Ga0068869_1000152124 290
150 3300005334 Ga0068869_100077559 Ga0068869_1000775592 290
151 3300005335 Ga0070666_10259252 Ga0070666_102592521 290
152 3300005338 Ga0068868_100015359 Ga0068868_1000153596 290
153 3300005340 Ga0070689_100088246 Ga0070689_1000882462 290
154 3300005343 Ga0070687_100047568 Ga0070687_1000475682 290
155 3300005343 Ga0070687_100095761 Ga0070687_1000957612 290
156 3300005344 Ga0070661_100061651 Ga0070661_1000616513 290
157 3300005347 Ga0070668_100058865 Ga0070668_1000588652 290
158 3300005347 Ga0070668_100139401 Ga0070668_1001394012 290
159 3300005353 Ga0070669_100395958 Ga0070669_1003959581 290
160 3300005354 Ga0070675_100067343 Ga0070675_1000673432 290
161 3300005355 Ga0070671_100332789 Ga0070671_1003327892 290
162 3300005356 Ga0070674_100028242 Ga0070674_1000282422 290
163 3300005365 Ga0070688_100156858 Ga0070688_1001568581 290
164 3300005366 Ga0070659_100024267 Ga0070659_1000242674 290
165 3300005367 Ga0070667_100027798 Ga0070667_1000277984 290
166 3300005438 Ga0070701_10082453 Ga0070701_100824532 290
167 3300005441 Ga0070700_100076299 Ga0070700_1000762992 290
168 3300005444 Ga0070694_100086379 Ga0070694_1000863792 290
169 3300005455 Ga0070663_100061814 Ga0070663_1000618143 290
170 3300005455 Ga0070663_100201876 Ga0070663_1002018762 290
171 3300005456 Ga0070678_100111757 Ga0070678_1001117573 290
172 3300005457 Ga0070662_100087815 Ga0070662_1000878152 290
173 3300005530 Ga0070679_100502802 Ga0070679_1005028021 290
174 3300005539 Ga0068853_100066343 Ga0068853_1000663432 290
175 3300005539 Ga0068853_100150960 Ga0068853_1001509601 290
176 3300005543 Ga0070672_100169887 Ga0070672_1001698872 290
177 3300005546 Ga0070696_100194126 Ga0070696_1001941261 290
178 3300005548 Ga0070665_100002252 Ga0070665_1000022524 290
179 3300005548 Ga0070665_100080245 Ga0070665_1000802452 290
180 3300005563 Ga0068855_100001082 Ga0068855_10000108228 290
181 3300005563 Ga0068855_100033389 Ga0068855_1000333896 290
182 3300005577 Ga0068857_100150154 Ga0068857_1001501542 290
183 3300005614 Ga0068856_100079629 Ga0068856_1000796292 290
184 3300005614 Ga0068856_100112652 Ga0068856_1001126521 290
185 3300005614 Ga0068856_100338603 Ga0068856_1003386032 290
186 3300005615 Ga0070702_100097195 Ga0070702_1000971951 290
187 3300005616 Ga0068852_100035429 Ga0068852_1000354291 290
188 3300005618 Ga0068864_100018905 Ga0068864_1000189052 290
189 3300005718 Ga0068866_10149004 Ga0068866_101490041 290
190 3300005842 Ga0068858_100026305 Ga0068858_1000263056 290
191 3300005843 Ga0068860_100052234 Ga0068860_1000522342 290
192 3300005844 Ga0068862_100032971 Ga0068862_1000329713 290
193 3300006042 Ga0075368_10001089 Ga0075368_100010896 290
194 3300006051 Ga0075364_10002698 Ga0075364_100026982 290
195 3300006186 Ga0075369_10005211 Ga0075369_100052112 290
196 3300006195 Ga0075366_10129868 Ga0075366_101298681 290
197 3300006237 Ga0097621_100071450 Ga0097621_1000714503 290
198 3300006358 Ga0068871_100180083 Ga0068871_1001800832 290
199 3300006358 Ga0068871_100183070 Ga0068871_1001830701 290
200 3300006871 Ga0075434_100059153 Ga0075434_1000591532 290
201 3300009093 Ga0105240_10011621 Ga0105240_100116218 290
202 3300009094 Ga0111539_10770196 Ga0111539_107701961 290
203 3300009098 Ga0105245_10004384 Ga0105245_100043842 290
204 3300009101 Ga0105247_10004527 Ga0105247_100045276 290
205 3300009174 Ga0105241_10001690 Ga0105241_100016907 290
206 3300009174 Ga0105241_10065064 Ga0105241_100650642 290
207 3300009545 Ga0105237_10151322 Ga0105237_101513223 290
208 3300009551 Ga0105238_10079410 Ga0105238_100794103 290
209 3300009551 Ga0105238_10136382 Ga0105238_101363822 290
210 3300009551 Ga0105238_10203551 Ga0105238_102035512 290
211 3300009553 Ga0105249_10076120 Ga0105249_100761202 290
212 3300011119 Ga0105246_10002722 Ga0105246_100027226 290
213 3300013105 Ga0157369_10178479 Ga0157369_101784792 290
214 3300013297 Ga0157378_10007882 Ga0157378_100078822 290
215 3300013306 Ga0163162_10010090 Ga0163162_100100903 290
216 3300013308 Ga0157375_10259566 Ga0157375_102595662 290
217 3300014325 Ga0163163_10013909 Ga0163163_100139092 290
218 3300014326 Ga0157380_10002196 Ga0157380_100021964 290
219 3300014969 Ga0157376_10062637 Ga0157376_100626372 290
220 3300014969 Ga0157376_10094339 Ga0157376_100943392 290
221 3300025297 Ga0209758_1000017 Ga0209758_1000017161 290
222 3300025900 Ga0207710_10031808 Ga0207710_100318082 290
223 3300025904 Ga0207647_10019815 Ga0207647_100198152 290
224 3300025911 Ga0207654_10016786 Ga0207654_100167862 290
225 3300025911 Ga0207654_10046447 Ga0207654_100464472 290
226 3300025913 Ga0207695_10013078 Ga0207695_100130785 290
227 3300025914 Ga0207671_10017691 Ga0207671_100176916 290
228 3300025918 Ga0207662_10051259 Ga0207662_100512593 290
229 3300025919 Ga0207657_10072407 Ga0207657_100724072 290
230 3300025921 Ga0207652_10061252 Ga0207652_100612522 290
231 3300025923 Ga0207681_10063334 Ga0207681_100633342 290
232 3300025924 Ga0207694_10064528 Ga0207694_100645282 290
233 3300025924 Ga0207694_10158058 Ga0207694_101580582 290
234 3300025927 Ga0207687_10007391 Ga0207687_100073912 290
235 3300025931 Ga0207644_10242621 Ga0207644_102426212 290
236 3300025932 Ga0207690_10089660 Ga0207690_100896603 290
237 3300025933 Ga0207706_10007452 Ga0207706_100074526 290
238 3300025935 Ga0207709_10038488 Ga0207709_100384883 290
239 3300025942 Ga0207689_10019002 Ga0207689_100190026 290
240 3300025942 Ga0207689_10078384 Ga0207689_100783843 290
241 3300025942 Ga0207689_10086274 Ga0207689_100862743 290
242 3300025949 Ga0207667_10005618 Ga0207667_100056187 290
243 3300025972 Ga0207668_10044684 Ga0207668_100446842 290
244 3300025972 Ga0207668_10099946 Ga0207668_100999462 290
245 3300026023 Ga0207677_10056521 Ga0207677_100565212 290
246 3300026035 Ga0207703_10026524 Ga0207703_100265246 290
247 3300026041 Ga0207639_10028432 Ga0207639_100284324 290
248 3300026041 Ga0207639_10051215 Ga0207639_100512153 290
249 3300026067 Ga0207678_10002473 Ga0207678_100024738 290
250 3300026078 Ga0207702_10022661 Ga0207702_100226614 290
251 3300026078 Ga0207702_10168389 Ga0207702_101683892 290
252 3300026095 Ga0207676_10110394 Ga0207676_101103942 290
253 3300026116 Ga0207674_10441158 Ga0207674_104411581 290
254 3300026118 Ga0207675_100001878 Ga0207675_1000018787 290
255 3300026121 Ga0207683_10003236 Ga0207683_100032367 290
256 3300026142 Ga0207698_10104911 Ga0207698_101049113 290
257 3300026142 Ga0207698_10205429 Ga0207698_102054292 290
258 3300028379 Ga0268266_10105073 Ga0268266_101050732 290
259 3300028380 Ga0268265_10018071 Ga0268265_100180713 290
260 3300028380 Ga0268265_10028396 Ga0268265_100283962 290
261 3300028381 Ga0268264_10295882 Ga0268264_102958822 290
262 3300031456 Ga0307513_10057264 Ga0307513_100572643 290
263 3300035115 Ga0373941_0011048 Ga0373941_0011048_1296_2168 290
264 3300035241 Ga0373961_0000150 Ga0373961_0000150_13567_14439 290
265 3300037466 Ga0395898_0058786 Ga0395898_0058786_2667_3563 290
266 3300037471 Ga0395905_0017780 Ga0395905_0017780_3770_4666 290
267 3300038443 Ga0395901_0109455 Ga0395901_0109455_1412_2308 290
268 3300039437 Ga0436365_0866656 Ga0436365_0866656_580_1470 290
269 3300045976 Ga0466967_0032202 Ga0466967_0032202_388_1260 290
270 3300046513 Ga0495616_0044405 Ga0495616_0044405_770_1642 290
271 3300046522 Ga0495643_0000824 Ga0495643_0000824_30550_31422 290
272 3300046522 Ga0495643_0009015 Ga0495643_0009015_2477_3349 290
273 3300046528 Ga0495642_0004720 Ga0495642_0004720_1661_2533 290
274 3300046616 Ga0495668_0000013 Ga0495668_0000013_345302_346174 290
275 3300047443 Ga0495687_000080 Ga0495687_000080_96918_97790 290
276 3300047445 Ga0495677_0000148 Ga0495677_0000148_8850_9722 290
277 3300048906 Ga0496103_0196676 Ga0496103_0196676_367_1245 290
278 3300048907 Ga0496104_0142596 Ga0496104_0142596_867_1745 290
279 3300048912 Ga0496109_0077664 Ga0496109_0077664_188_1066 290
280 3300048913 Ga0496110_0377879 Ga0496110_0377879_87_965 290
281 3300048924 Ga0496121_0032620 Ga0496121_0032620_2296_3174 290
282 3300048928 Ga0496125_0167293 Ga0496125_0167293_157_1035 290
283 3300049572 Ga0501036_0407289 Ga0501036_0407289_136_1008 290
284 3300049576 Ga0501040_0102244 Ga0501040_0102244_493_1365 290
285 3300049581 Ga0501047_0000742 Ga0501047_0000742_4367_5263 290
286 3300049591 Ga0501075_0154222 Ga0501075_0154222_526_1398 290
287 3300049741 Ga0501079_0140598 Ga0501079_0140598_628_1506 290
288 3300050496 nmdc:mga07m45_32541_c1 nmdc:mga07m45_32541_c1_1413_2291 290
289 3300050512 nmdc:mga0n895_144000_c1 nmdc:mga0n895_144000_c1_202_1080 290
290 3300050512 nmdc:mga0n895_687993_c1 nmdc:mga0n895_687993_c1_80_952 290
291 3300050516 nmdc:mga0sz30_22420_c1 nmdc:mga0sz30_22420_c1_675_1553 290
292 3300053153 Ga0500616_0017070 Ga0500616_0017070_1806_2678 290
293 3300053177 Ga0500636_0028996 Ga0500636_0028996_1880_2752 290
294 3300060353 Ga0501082_0086135 Ga0501082_0086135_383_1255 290
295 3300003856 Ga0058692_1000468 Ga0058692_100046815 291
296 3300005367 Ga0070667_100030430 Ga0070667_1000304308 291
297 3300005548 Ga0070665_100000048 Ga0070665_10000004896 291
298 3300005841 Ga0068863_100010794 Ga0068863_1000107943 291
299 3300006846 Ga0075430_100001250 Ga0075430_1000012505 291
300 3300009093 Ga0105240_10009952 Ga0105240_100099525 291
301 3300009093 Ga0105240_10152023 Ga0105240_101520232 291
302 3300021361 Ga0213872_10041516 Ga0213872_100415162 291
303 3300021384 Ga0213876_10002349 Ga0213876_100023497 291
304 3300025294 Ga0209025_1000794 Ga0209025_100079445 291
305 3300025912 Ga0207707_10350682 Ga0207707_103506821 291
306 3300025913 Ga0207695_10009190 Ga0207695_100091902 291
307 3300025986 Ga0207658_10020845 Ga0207658_100208452 291
308 3300026088 Ga0207641_10007852 Ga0207641_100078523 291
309 3300027312 Ga0209371_1000002 Ga0209371_10000021313 291
310 3300027682 Ga0209971_1013186 Ga0209971_10131861 291
311 3300027876 Ga0209974_10021074 Ga0209974_100210742 291
312 3300028379 Ga0268266_10000358 Ga0268266_1000035863 291
313 3300030500 Ga0268256_1000002 Ga0268256_1000002149 291
314 3300031239 Ga0265328_10011567 Ga0265328_100115672 291
315 3300031250 Ga0265331_10000390 Ga0265331_1000039020 291
316 3300031251 Ga0265327_10000859 Ga0265327_1000085920 291
317 3300035724 Ga0373933_0201885 Ga0373933_0201885_127_1002 291
318 3300038726 Ga0400490_01037 Ga0400490_01037_1380_2255 291
319 3300039437 Ga0436365_1326821 Ga0436365_1326821_5281_6159 291
320 3300045976 Ga0466967_0497249 Ga0466967_0497249_55_930 291
321 3300048928 Ga0496125_0000006 Ga0496125_0000006_365951_366826 291
322 3300050509 nmdc:mga0qj67_17874_c1 nmdc:mga0qj67_17874_c1_333_1217 291
323 3300005329 Ga0070683_100006765 Ga0070683_1000067658 292
324 3300005335 Ga0070666_10267784 Ga0070666_102677842 292
325 3300005340 Ga0070689_100111848 Ga0070689_1001118483 292
326 3300005535 Ga0070684_100210353 Ga0070684_1002103532 292
327 3300005564 Ga0070664_100005461 Ga0070664_1000054612 292
328 3300005843 Ga0068860_100155355 Ga0068860_1001553553 292
329 3300006237 Ga0097621_100313027 Ga0097621_1003130272 292
330 3300009093 Ga0105240_10366227 Ga0105240_103662271 292
331 3300009174 Ga0105241_10067774 Ga0105241_100677743 292
332 3300009174 Ga0105241_10426017 Ga0105241_104260172 292
333 3300009551 Ga0105238_10114493 Ga0105238_101144932 292
334 3300009551 Ga0105238_10712086 Ga0105238_107120861 292
335 3300010375 Ga0105239_10029865 Ga0105239_100298652 292
336 3300010375 Ga0105239_10321852 Ga0105239_103218522 292
337 3300011119 Ga0105246_10036248 Ga0105246_100362483 292
338 3300013102 Ga0157371_10044401 Ga0157371_100444013 292
339 3300013105 Ga0157369_10053723 Ga0157369_100537233 292
340 3300013307 Ga0157372_10035924 Ga0157372_100359243 292
341 3300013307 Ga0157372_10109400 Ga0157372_101094003 292
342 3300014326 Ga0157380_10080040 Ga0157380_100800402 292
343 3300014497 Ga0182008_10081109 Ga0182008_100811092 292
344 3300014745 Ga0157377_10052642 Ga0157377_100526421 292
345 3300014968 Ga0157379_10090155 Ga0157379_100901552 292
346 3300025304 Ga0209257_1003672 Ga0209257_10036727 292
347 3300025728 Ga0207655_1000111 Ga0207655_100011158 292
348 3300025728 Ga0207655_1033430 Ga0207655_10334301 292
349 3300025903 Ga0207680_10013288 Ga0207680_100132884 292
350 3300025903 Ga0207680_10241738 Ga0207680_102417382 292
351 3300025911 Ga0207654_10015066 Ga0207654_100150663 292
352 3300025914 Ga0207671_10041276 Ga0207671_100412761 292
353 3300025924 Ga0207694_10088439 Ga0207694_100884393 292
354 3300025933 Ga0207706_10398998 Ga0207706_103989981 292
355 3300025944 Ga0207661_10018071 Ga0207661_100180713 292
356 3300025944 Ga0207661_10167775 Ga0207661_101677752 292
357 3300025986 Ga0207658_10008834 Ga0207658_100088347 292
358 3300026078 Ga0207702_10015199 Ga0207702_100151994 292
359 3300026088 Ga0207641_10444384 Ga0207641_104443842 292
360 3300026089 Ga0207648_10104132 Ga0207648_101041322 292
361 3300028381 Ga0268264_10449350 Ga0268264_104493502 292
362 3300031344 Ga0265316_10009108 Ga0265316_100091085 292
363 3300031665 Ga0316575_10071080 Ga0316575_100710802 292
364 3300031711 Ga0265314_10027930 Ga0265314_100279304 292
365 3300033180 Ga0307510_10017468 Ga0307510_100174685 292
366 3300039450 Ga0436363_1626008 Ga0436363_1626008_2705_3586 292
367 3300041407 Ga0439447_003273 Ga0439447_003273_2858_3739 292
368 3300042010 Ga0439452_003762 Ga0439452_003762_2675_3556 292
369 3300048905 Ga0496102_0007448 Ga0496102_0007448_7773_8654 292
370 3300048912 Ga0496109_0099064 Ga0496109_0099064_720_1610 292
371 3300048914 Ga0496111_0392170 Ga0496111_0392170_14_904 292
372 3300048919 Ga0496116_0003497 Ga0496116_0003497_6205_7089 292
373 3300048920 Ga0496117_0075034 Ga0496117_0075034_46_927 292
374 3300048922 Ga0496119_0010270 Ga0496119_0010270_6112_6996 292
375 3300048923 Ga0496120_0000476 Ga0496120_0000476_55771_56655 292
376 3300048924 Ga0496121_0036886 Ga0496121_0036886_319_1200 292
377 3300048927 Ga0496124_0002597 Ga0496124_0002597_8478_9362 292
378 3300048927 Ga0496124_0025013 Ga0496124_0025013_2103_2984 292
379 3300048927 Ga0496124_0121588 Ga0496124_0121588_47_928 292
380 3300049573 Ga0501037_0044318 Ga0501037_0044318_2330_3208 292
381 3300049588 Ga0501072_0082089 Ga0501072_0082089_1364_2266 292
382 3300049589 Ga0501073_0023217 Ga0501073_0023217_1657_2550 292
383 3300049744 Ga0501083_0000809 Ga0501083_0000809_2828_3721 292
384 3300054114 Ga0501084_0247846 Ga0501084_0247846_132_1034 292
385 3300060353 Ga0501082_0012135 Ga0501082_0012135_4467_5360 292
386 3300005458 Ga0070681_10166655 Ga0070681_101666553 293
387 3300006028 Ga0070717_10213807 Ga0070717_102138072 293
388 3300006844 Ga0075428_100021700 Ga0075428_1000217006 293
389 3300006846 Ga0075430_100302949 Ga0075430_1003029492 293
390 3300009094 Ga0111539_10108770 Ga0111539_101087702 293
391 3300009098 Ga0105245_10167461 Ga0105245_101674613 293
392 3300009176 Ga0105242_10028835 Ga0105242_100288355 293
393 3300009177 Ga0105248_10166848 Ga0105248_101668483 293
394 3300013307 Ga0157372_10012098 Ga0157372_100120982 293
395 3300013308 Ga0157375_10092857 Ga0157375_100928572 293
396 3300014325 Ga0163163_10400809 Ga0163163_104008092 293
397 3300037471 Ga0395905_0285999 Ga0395905_0285999_209_1090 293
398 3300042876 Ga0451577_0000041 Ga0451577_0000041_139845_140732 293
399 3300044673 Ga0453683_0007367 Ga0453683_0007367_131_1018 293
400 3300044712 Ga0453684_0000066 Ga0453684_0000066_301232_302119 293
401 3300045051 Ga0451576_0017861 Ga0451576_0017861_5091_5978 293
402 3300050508 nmdc:mga09592_292920_c1 nmdc:mga09592_292920_c1_408_1289 293
403 3300050509 nmdc:mga0qj67_94559_c1 nmdc:mga0qj67_94559_c1_1448_2329 293
404 3300050511 nmdc:mga08y16_218354_c1 nmdc:mga08y16_218354_c1_223_1104 293
405 3300005329 Ga0070683_100017146 Ga0070683_1000171464 294
406 3300005330 Ga0070690_100002713 Ga0070690_1000027132 294
407 3300005331 Ga0070670_100020242 Ga0070670_1000202424 294
408 3300005334 Ga0068869_100001264 Ga0068869_1000012648 294
409 3300005337 Ga0070682_100004413 Ga0070682_1000044135 294
410 3300005338 Ga0068868_100007794 Ga0068868_1000077944 294
411 3300005339 Ga0070660_100015976 Ga0070660_1000159762 294
412 3300005340 Ga0070689_100033652 Ga0070689_1000336524 294
413 3300005344 Ga0070661_100007601 Ga0070661_1000076015 294
414 3300005345 Ga0070692_10014398 Ga0070692_100143984 294
415 3300005353 Ga0070669_100018690 Ga0070669_1000186902 294
416 3300005354 Ga0070675_100002517 Ga0070675_1000025178 294
417 3300005364 Ga0070673_100023513 Ga0070673_1000235132 294
418 3300005366 Ga0070659_100002538 Ga0070659_1000025389 294
419 3300005455 Ga0070663_100052839 Ga0070663_1000528393 294
420 3300005457 Ga0070662_100001389 Ga0070662_1000013896 294
421 3300005457 Ga0070662_100022123 Ga0070662_1000221234 294
422 3300005458 Ga0070681_10015591 Ga0070681_100155915 294
423 3300005468 Ga0070707_100513745 Ga0070707_1005137451 294
424 3300005530 Ga0070679_100001134 Ga0070679_1000011345 294
425 3300005535 Ga0070684_100005964 Ga0070684_1000059648 294
426 3300005535 Ga0070684_100021138 Ga0070684_1000211384 294
427 3300005539 Ga0068853_100025150 Ga0068853_1000251502 294
428 3300005544 Ga0070686_100093397 Ga0070686_1000933972 294
429 3300005545 Ga0070695_100036812 Ga0070695_1000368122 294
430 3300005547 Ga0070693_100003115 Ga0070693_1000031154 294
431 3300005548 Ga0070665_100157623 Ga0070665_1001576232 294
432 3300005564 Ga0070664_100020780 Ga0070664_1000207803 294
433 3300005577 Ga0068857_100004179 Ga0068857_1000041798 294
434 3300005614 Ga0068856_100004319 Ga0068856_1000043199 294
435 3300005614 Ga0068856_100157855 Ga0068856_1001578552 294
436 3300005615 Ga0070702_100000739 Ga0070702_1000007393 294
437 3300005616 Ga0068852_100022978 Ga0068852_1000229785 294
438 3300005617 Ga0068859_100011259 Ga0068859_1000112595 294
439 3300005618 Ga0068864_100007311 Ga0068864_1000073117 294
440 3300005841 Ga0068863_100002080 Ga0068863_10000208021 294
441 3300005841 Ga0068863_100278577 Ga0068863_1002785772 294
442 3300005842 Ga0068858_100007120 Ga0068858_1000071209 294
443 3300005843 Ga0068860_100010975 Ga0068860_1000109754 294
444 3300006237 Ga0097621_100023497 Ga0097621_1000234974 294
445 3300006931 Ga0097620_100011259 Ga0097620_1000112595 294
446 3300009098 Ga0105245_10001793 Ga0105245_100017936 294
447 3300009098 Ga0105245_10187615 Ga0105245_101876152 294
448 3300009174 Ga0105241_10008910 Ga0105241_100089104 294
449 3300009176 Ga0105242_10114501 Ga0105242_101145013 294
450 3300009176 Ga0105242_10299583 Ga0105242_102995832 294
451 3300009177 Ga0105248_10001949 Ga0105248_1000194919 294
452 3300009551 Ga0105238_10038984 Ga0105238_100389844 294
453 3300009553 Ga0105249_10083760 Ga0105249_100837603 294
454 3300010375 Ga0105239_10012089 Ga0105239_100120896 294
455 3300013100 Ga0157373_10003590 Ga0157373_100035904 294
456 3300013102 Ga0157371_10005635 Ga0157371_100056354 294
457 3300013105 Ga0157369_10202439 Ga0157369_102024391 294
458 3300013296 Ga0157374_10001347 Ga0157374_1000134722 294
459 3300013296 Ga0157374_10229849 Ga0157374_102298492 294
460 3300013297 Ga0157378_10033156 Ga0157378_100331564 294
461 3300013307 Ga0157372_10000973 Ga0157372_1000097328 294
462 3300013308 Ga0157375_10021465 Ga0157375_100214656 294
463 3300014325 Ga0163163_10036462 Ga0163163_100364624 294
464 3300014325 Ga0163163_10150925 Ga0163163_101509253 294
465 3300025298 Ga0209050_1045173 Ga0209050_10451731 294
466 3300025315 Ga0207697_10059972 Ga0207697_100599722 294
467 3300025901 Ga0207688_10089979 Ga0207688_100899791 294
468 3300025906 Ga0207699_10012681 Ga0207699_100126813 294
469 3300025907 Ga0207645_10054274 Ga0207645_100542743 294
470 3300025911 Ga0207654_10011431 Ga0207654_100114313 294
471 3300025912 Ga0207707_10003020 Ga0207707_100030209 294
472 3300025919 Ga0207657_10008501 Ga0207657_100085015 294
473 3300025920 Ga0207649_10002582 Ga0207649_100025824 294
474 3300025921 Ga0207652_10050525 Ga0207652_100505253 294
475 3300025923 Ga0207681_10048289 Ga0207681_100482892 294
476 3300025925 Ga0207650_10015501 Ga0207650_100155014 294
477 3300025926 Ga0207659_10003260 Ga0207659_100032603 294
478 3300025927 Ga0207687_10008601 Ga0207687_100086013 294
479 3300025928 Ga0207700_10053211 Ga0207700_100532114 294
480 3300025932 Ga0207690_10003637 Ga0207690_100036377 294
481 3300025933 Ga0207706_10006981 Ga0207706_100069815 294
482 3300025936 Ga0207670_10015909 Ga0207670_100159094 294
483 3300025936 Ga0207670_10110963 Ga0207670_101109632 294
484 3300025941 Ga0207711_10198250 Ga0207711_101982503 294
485 3300025942 Ga0207689_10006749 Ga0207689_100067495 294
486 3300025944 Ga0207661_10001091 Ga0207661_1000109112 294
487 3300025945 Ga0207679_10009547 Ga0207679_100095475 294
488 3300025960 Ga0207651_10016551 Ga0207651_100165512 294
489 3300026023 Ga0207677_10005731 Ga0207677_100057315 294
490 3300026035 Ga0207703_10028305 Ga0207703_100283054 294
491 3300026035 Ga0207703_10210794 Ga0207703_102107942 294
492 3300026041 Ga0207639_10026452 Ga0207639_100264522 294
493 3300026067 Ga0207678_10074025 Ga0207678_100740253 294
494 3300026078 Ga0207702_10009589 Ga0207702_100095895 294
495 3300026078 Ga0207702_10096694 Ga0207702_100966942 294
496 3300026088 Ga0207641_10003750 Ga0207641_100037507 294
497 3300026095 Ga0207676_10003252 Ga0207676_100032527 294
498 3300026116 Ga0207674_10001148 Ga0207674_1000114834 294
499 3300028381 Ga0268264_10024197 Ga0268264_100241973 294
500 3300035086 Ga0373934_0053581 Ga0373934_0053581_290_1174 294
501 3300035111 Ga0373923_0101566 Ga0373923_0101566_237_1121 294
502 3300035172 Ga0373955_0014369 Ga0373955_0014369_235_1119 294
503 3300035172 Ga0373955_0057627 Ga0373955_0057627_68_952 294
504 3300035242 Ga0373962_0043098 Ga0373962_0043098_321_1205 294
505 3300035692 Ga0373935_0108097 Ga0373935_0108097_576_1460 294
506 3300035724 Ga0373933_0315460 Ga0373933_0315460_78_962 294
507 3300036401 Ga0373937_0111000 Ga0373937_0111000_412_1296 294
508 3300045051 Ga0451576_0083175 Ga0451576_0083175_320_1204 294
509 3300045976 Ga0466967_0412241 Ga0466967_0412241_324_1208 294
510 3300046459 Ga0495629_0060216 Ga0495629_0060216_744_1628 294
511 3300046459 Ga0495629_0068291 Ga0495629_0068291_404_1288 294
512 3300046472 Ga0495580_0145717 Ga0495580_0145717_480_1364 294
513 3300046499 Ga0495594_0242043 Ga0495594_0242043_103_987 294
514 3300046516 Ga0495628_0019871 Ga0495628_0019871_4605_5489 294
515 3300046517 Ga0495630_0076272 Ga0495630_0076272_782_1666 294
516 3300046531 Ga0495665_0059580 Ga0495665_0059580_484_1368 294
517 3300046536 Ga0495587_0006235 Ga0495587_0006235_325_1209 294
518 3300046536 Ga0495587_0059100 Ga0495587_0059100_911_1795 294
519 3300046543 Ga0495645_0003877 Ga0495645_0003877_6464_7348 294
520 3300046559 Ga0495667_0165949 Ga0495667_0165949_166_1050 294
521 3300046663 Ga0495635_0039386 Ga0495635_0039386_183_1067 294
522 3300046675 Ga0495657_0251021 Ga0495657_0251021_40_924 294
523 3300046678 Ga0495599_0000961 Ga0495599_0000961_5207_6091 294
524 3300046678 Ga0495599_0021874 Ga0495599_0021874_2753_3637 294
525 3300046679 Ga0495623_0013898 Ga0495623_0013898_287_1171 294
526 3300046809 Ga0495600_0141369 Ga0495600_0141369_70_954 294
527 3300047317 Ga0495604_0045665 Ga0495604_0045665_1794_2678 294
528 3300047319 Ga0495674_0133679 Ga0495674_0133679_123_1007 294
529 3300047322 Ga0495680_0217098 Ga0495680_0217098_314_1198 294
530 3300047471 Ga0495684_0004932 Ga0495684_0004932_381_1265 294
531 3300048908 Ga0496105_0094154 Ga0496105_0094154_1537_2421 294
532 3300048911 Ga0496108_0041945 Ga0496108_0041945_2504_3388 294
533 3300048915 Ga0496112_0005603 Ga0496112_0005603_9834_10718 294
534 3300048916 Ga0496113_0033623 Ga0496113_0033623_2159_3043 294
535 3300053085 Ga0495619_0168060 Ga0495619_0168060_46_930 294
536 3300006042 Ga0075368_10000663 Ga0075368_100006638 295
537 3300006048 Ga0075363_100000245 Ga0075363_10000024513 295
538 3300006051 Ga0075364_10006458 Ga0075364_100064581 295
539 3300006177 Ga0075362_10007400 Ga0075362_100074003 295
540 3300006195 Ga0075366_10013774 Ga0075366_100137743 295
541 3300013104 Ga0157370_10105347 Ga0157370_101053473 295
542 3300042876 Ga0451577_0001488 Ga0451577_0001488_10206_11147 295
543 3300025945 Ga0207679_10394644 Ga0207679_103946442 297
544 2162886012 MBSR1b_contig_4539084 MBSR1b_0395.00003400 299
545 3300005293 Ga0065715_10121597 Ga0065715_101215973 299
546 3300005328 Ga0070676_10038217 Ga0070676_100382171 299
547 3300005338 Ga0068868_100226695 Ga0068868_1002266951 299
548 3300005347 Ga0070668_100137492 Ga0070668_1001374922 299
549 3300005356 Ga0070674_100067345 Ga0070674_1000673452 299
550 3300005367 Ga0070667_100153384 Ga0070667_1001533842 299
551 3300005444 Ga0070694_100088071 Ga0070694_1000880712 299
552 3300005518 Ga0070699_100011473 Ga0070699_1000114734 299
553 3300005536 Ga0070697_100001922 Ga0070697_10000192213 299
554 3300005543 Ga0070672_100106872 Ga0070672_1001068722 299
555 3300005546 Ga0070696_100001123 Ga0070696_1000011233 299
556 3300006881 Ga0068865_100101280 Ga0068865_1001012802 299
557 3300009176 Ga0105242_10003032 Ga0105242_100030329 299
558 3300013308 Ga0157375_10121711 Ga0157375_101217112 299
559 3300025934 Ga0207686_10023986 Ga0207686_100239863 299
560 3300025940 Ga0207691_10171941 Ga0207691_101719412 299
561 3300026023 Ga0207677_10244218 Ga0207677_102442182 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

4

230

0.98

PF12804

NTP_transf_3

MobA-like NTP transferase domain

5

95

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t38-assembly1.cif.gz_A pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9922 8 298
6tqg-assembly1.cif.gz_A pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9914 8 298
4b4b-assembly1.cif.gz_B-2 pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9908 7 298
5ftv-assembly2.cif.gz_C pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9908 7 298
1mp4-assembly1.cif.gz_A w224h variant of s. enterica rmla 0.9908 7 292
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.989 7 298 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.958 7 244 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9126 7 244 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9022 9 230 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8891 9 230 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6I3TEG1-F1-model_v4 deleted 1.003 21 133
AF-A0A2V8EYQ2-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.002 9 153 GO:0008879
GO:0045226
AF-A0A351VA12-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.002 9 119 GO:0008879
GO:0045226
AF-A0A561DDF8-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.001 9 145 GO:0008879
GO:0045226
AF-A0A434W677-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.001 9 151 GO:0008879
GO:0045226

Feature Viewer

pLDDT pTM Quality
93.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map