F463801
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 561 | 310 | 545 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100760583|Ga0068856_1007605831 |
| Length | 282 |
| Sequence | MDTRGIILAGGSGTRLYPVTRSVSKQLLPVYDKPMIYYPLSTLMLAGVRTLLIITTPRDRQAFEDLLGSGCEWGLEISYAVQDKPNGLAEAFIIGRDFVGGHPSELATAVQTAAKRERGATVFAYRVSNPQAYGVVEFDAAGRAISIEEKPKTPRSNFAVTGLYFYDRRVVDIAANLKPSPRGELEITDVNRAYLEASDLHVEILGRGSAWLDTGTHDSLVQATHFVQTVEQRQGLKIAAPEEVAFRMGYIDRTKLLELADALGKSDYGGYLRAIADEVPSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 3 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 4 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 5 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 6 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 7 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 8 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 9 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 10 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 11 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 12 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 13 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 14 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 15 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 16 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 17 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 215 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 219 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 220 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 221 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 222 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 277 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 278 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 279 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 294 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 306 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.15 |
| Metatranscriptomes | 0 |
| Isolates | 2.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.53 |
| Nodule | 0 |
| Rhizoplane | 3.74 |
| Rhizosphere | 83.78 |
| Stem | 0 |
| Stem Tuber | 0.53 |
| Unclassified | 6.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4539084 | 2162886012 | Bacteria | 2062 |
| 2 | Ga0055524_1004355 | 3300003775 | Bacteria | 6548 |
| 3 | Ga0055528_1018983 | 3300003790 | Bacteria | 2304 |
| 4 | Ga0058692_1000468 | 3300003856 | Bacteria | 18161 |
| 5 | Ga0065712_10165267 | 3300005290 | Bacteria | 1276 |
| 6 | Ga0065715_10121597 | 3300005293 | Bacteria | 2225 |
| 7 | Ga0065715_10149355 | 3300005293 | Bacteria | 1748 |
| 8 | Ga0070676_10038217 | 3300005328 | Bacteria | 2772 |
| 9 | Ga0070676_10143023 | 3300005328 | Bacteria | 1525 |
| 10 | Ga0070683_100006765 | 3300005329 | Bacteria | 9633 |
| 11 | Ga0070683_100017146 | 3300005329 | Bacteria | 6396 |
| 12 | Ga0070690_100002713 | 3300005330 | Bacteria | 9552 |
| 13 | Ga0070690_100008468 | 3300005330 | Bacteria | 5926 |
| 14 | Ga0070670_100020242 | 3300005331 | Bacteria | 5718 |
| 15 | Ga0070670_100179730 | 3300005331 | Bacteria | 1837 |
| 16 | Ga0070670_100207587 | 3300005331 | Bacteria | 1703 |
| 17 | Ga0068869_100001264 | 3300005334 | Bacteria | 14952 |
| 18 | Ga0068869_100015212 | 3300005334 | Bacteria | 5156 |
| 19 | Ga0068869_100077559 | 3300005334 | Bacteria | 2472 |
| 20 | Ga0070666_10013029 | 3300005335 | Bacteria | 5265 |
| 21 | Ga0070666_10041563 | 3300005335 | Bacteria | 3073 |
| 22 | Ga0070666_10259252 | 3300005335 | Bacteria | 1232 |
| 23 | Ga0070666_10267784 | 3300005335 | Bacteria | 1212 |
| 24 | Ga0070682_100004413 | 3300005337 | Bacteria | 7806 |
| 25 | Ga0068868_100007794 | 3300005338 | Bacteria | 7644 |
| 26 | Ga0068868_100015359 | 3300005338 | Bacteria | 5661 |
| 27 | Ga0068868_100226695 | 3300005338 | Bacteria | 1566 |
| 28 | Ga0070660_100015976 | 3300005339 | Bacteria | 5436 |
| 29 | Ga0070689_100033652 | 3300005340 | Bacteria | 3906 |
| 30 | Ga0070689_100088246 | 3300005340 | Bacteria | 2441 |
| 31 | Ga0070689_100111848 | 3300005340 | Bacteria | 2173 |
| 32 | Ga0070687_100047568 | 3300005343 | Bacteria | 2201 |
| 33 | Ga0070687_100095761 | 3300005343 | Bacteria | 1651 |
| 34 | Ga0070687_100107145 | 3300005343 | Bacteria | 1575 |
| 35 | Ga0070661_100007601 | 3300005344 | Bacteria | 7476 |
| 36 | Ga0070661_100061651 | 3300005344 | Bacteria | 2753 |
| 37 | Ga0070692_10014398 | 3300005345 | Bacteria | 3715 |
| 38 | Ga0070668_100058865 | 3300005347 | Bacteria | 2973 |
| 39 | Ga0070668_100137492 | 3300005347 | Bacteria | 1966 |
| 40 | Ga0070668_100139401 | 3300005347 | Bacteria | 1953 |
| 41 | Ga0070669_100018690 | 3300005353 | Bacteria | 4954 |
| 42 | Ga0070669_100267835 | 3300005353 | Bacteria | 1365 |
| 43 | Ga0070669_100395958 | 3300005353 | Bacteria | 1129 |
| 44 | Ga0070675_100002517 | 3300005354 | Bacteria | 13713 |
| 45 | Ga0070675_100067343 | 3300005354 | Bacteria | 2963 |
| 46 | Ga0070675_100166375 | 3300005354 | Bacteria | 1899 |
| 47 | Ga0070671_100332789 | 3300005355 | Bacteria | 1295 |
| 48 | Ga0070674_100028242 | 3300005356 | Bacteria | 3683 |
| 49 | Ga0070674_100067345 | 3300005356 | Bacteria | 2518 |
| 50 | Ga0070673_100023513 | 3300005364 | Bacteria | 4503 |
| 51 | Ga0070688_100026284 | 3300005365 | Bacteria | 3457 |
| 52 | Ga0070688_100156858 | 3300005365 | Bacteria | 1560 |
| 53 | Ga0070659_100002538 | 3300005366 | Bacteria | 12980 |
| 54 | Ga0070659_100024267 | 3300005366 | Bacteria | 4648 |
| 55 | Ga0070667_100016211 | 3300005367 | Bacteria | 6166 |
| 56 | Ga0070667_100027798 | 3300005367 | Bacteria | 4707 |
| 57 | Ga0070667_100030430 | 3300005367 | Bacteria | 4503 |
| 58 | Ga0070667_100099591 | 3300005367 | Bacteria | 2509 |
| 59 | Ga0070667_100153384 | 3300005367 | Bacteria | 2025 |
| 60 | Ga0070701_10082453 | 3300005438 | Bacteria | 1744 |
| 61 | Ga0070700_100076299 | 3300005441 | Bacteria | 2152 |
| 62 | Ga0070694_100052656 | 3300005444 | Bacteria | 2752 |
| 63 | Ga0070694_100086379 | 3300005444 | Bacteria | 2192 |
| 64 | Ga0070694_100088071 | 3300005444 | Bacteria | 2173 |
| 65 | Ga0070663_100052839 | 3300005455 | Bacteria | 2899 |
| 66 | Ga0070663_100061814 | 3300005455 | Bacteria | 2698 |
| 67 | Ga0070663_100201876 | 3300005455 | Bacteria | 1552 |
| 68 | Ga0070678_100111757 | 3300005456 | Bacteria | 2138 |
| 69 | Ga0070662_100001389 | 3300005457 | Bacteria | 14908 |
| 70 | Ga0070662_100022123 | 3300005457 | Bacteria | 4348 |
| 71 | Ga0070662_100087815 | 3300005457 | Bacteria | 2329 |
| 72 | Ga0070681_10015591 | 3300005458 | Bacteria | 7569 |
| 73 | Ga0070681_10166655 | 3300005458 | Bacteria | 2126 |
| 74 | Ga0070707_100513745 | 3300005468 | Bacteria | 1160 |
| 75 | Ga0070699_100011473 | 3300005518 | Bacteria | 7652 |
| 76 | Ga0070679_100001134 | 3300005530 | Bacteria | 23290 |
| 77 | Ga0070679_100502802 | 3300005530 | Bacteria | 1156 |
| 78 | Ga0070684_100005964 | 3300005535 | Bacteria | 9386 |
| 79 | Ga0070684_100021138 | 3300005535 | Bacteria | 5408 |
| 80 | Ga0070684_100210353 | 3300005535 | Bacteria | 1773 |
| 81 | Ga0070697_100001922 | 3300005536 | Bacteria | 15904 |
| 82 | Ga0068853_100025150 | 3300005539 | Bacteria | 4995 |
| 83 | Ga0068853_100066343 | 3300005539 | Bacteria | 3134 |
| 84 | Ga0068853_100150960 | 3300005539 | Bacteria | 2092 |
| 85 | Ga0070672_100106872 | 3300005543 | Bacteria | 2277 |
| 86 | Ga0070672_100169887 | 3300005543 | Bacteria | 1813 |
| 87 | Ga0070686_100093397 | 3300005544 | Bacteria | 2017 |
| 88 | Ga0070695_100036812 | 3300005545 | Bacteria | 3081 |
| 89 | Ga0070696_100001123 | 3300005546 | Bacteria | 17326 |
| 90 | Ga0070696_100194126 | 3300005546 | Bacteria | 1512 |
| 91 | Ga0070693_100003115 | 3300005547 | Bacteria | 7698 |
| 92 | Ga0070665_100000048 | 3300005548 | Bacteria | 265077 |
| 93 | Ga0070665_100002252 | 3300005548 | Bacteria | 21445 |
| 94 | Ga0070665_100080245 | 3300005548 | Bacteria | 3268 |
| 95 | Ga0070665_100157623 | 3300005548 | Bacteria | 2272 |
| 96 | Ga0070704_100003369 | 3300005549 | Bacteria | 9160 |
| 97 | Ga0068855_100001082 | 3300005563 | Bacteria | 33864 |
| 98 | Ga0068855_100033389 | 3300005563 | Bacteria | 6141 |
| 99 | Ga0070664_100005461 | 3300005564 | Bacteria | 10205 |
| 100 | Ga0070664_100020780 | 3300005564 | Bacteria | 5408 |
| 101 | Ga0068857_100004179 | 3300005577 | Bacteria | 12158 |
| 102 | Ga0068857_100113316 | 3300005577 | Bacteria | 2438 |
| 103 | Ga0068857_100150154 | 3300005577 | Bacteria | 2110 |
| 104 | Ga0068856_100004319 | 3300005614 | Bacteria | 14184 |
| 105 | Ga0068856_100079629 | 3300005614 | Bacteria | 3249 |
| 106 | Ga0068856_100112652 | 3300005614 | Bacteria | 2718 |
| 107 | Ga0068856_100157855 | 3300005614 | Bacteria | 2278 |
| 108 | Ga0068856_100338603 | 3300005614 | Bacteria | 1522 |
| 109 | Ga0068856_100760583 | 3300005614 | Bacteria | 989 |
| 110 | Ga0070702_100000739 | 3300005615 | Bacteria | 12365 |
| 111 | Ga0070702_100097195 | 3300005615 | Bacteria | 1799 |
| 112 | Ga0068852_100022978 | 3300005616 | Bacteria | 5011 |
| 113 | Ga0068852_100035429 | 3300005616 | Bacteria | 4163 |
| 114 | Ga0068859_100011259 | 3300005617 | Bacteria | 9001 |
| 115 | Ga0068859_100022742 | 3300005617 | Bacteria | 6286 |
| 116 | Ga0068859_100025462 | 3300005617 | Bacteria | 5935 |
| 117 | Ga0068859_100073429 | 3300005617 | Bacteria | 3459 |
| 118 | Ga0068864_100007311 | 3300005618 | Bacteria | 9086 |
| 119 | Ga0068864_100018905 | 3300005618 | Bacteria | 5761 |
| 120 | Ga0068864_100216627 | 3300005618 | Bacteria | 1765 |
| 121 | Ga0068866_10149004 | 3300005718 | Bacteria | 1352 |
| 122 | Ga0068861_100015487 | 3300005719 | Bacteria | 5375 |
| 123 | Ga0068863_100002080 | 3300005841 | Bacteria | 19842 |
| 124 | Ga0068863_100004607 | 3300005841 | Bacteria | 13580 |
| 125 | Ga0068863_100010794 | 3300005841 | Bacteria | 8858 |
| 126 | Ga0068863_100040645 | 3300005841 | Bacteria | 4422 |
| 127 | Ga0068863_100278577 | 3300005841 | Bacteria | 1620 |
| 128 | Ga0068858_100005691 | 3300005842 | Bacteria | 12182 |
| 129 | Ga0068858_100007120 | 3300005842 | Bacteria | 10861 |
| 130 | Ga0068858_100026305 | 3300005842 | Bacteria | 5409 |
| 131 | Ga0068860_100000054 | 3300005843 | Bacteria | 206114 |
| 132 | Ga0068860_100001647 | 3300005843 | Bacteria | 23884 |
| 133 | Ga0068860_100010975 | 3300005843 | Bacteria | 8929 |
| 134 | Ga0068860_100052234 | 3300005843 | Bacteria | 3888 |
| 135 | Ga0068860_100155355 | 3300005843 | Bacteria | 2204 |
| 136 | Ga0068862_100000032 | 3300005844 | Bacteria | 179887 |
| 137 | Ga0068862_100032747 | 3300005844 | Bacteria | 4390 |
| 138 | Ga0068862_100032971 | 3300005844 | Bacteria | 4375 |
| 139 | Ga0068862_100034166 | 3300005844 | Bacteria | 4301 |
| 140 | Ga0070717_10213807 | 3300006028 | Bacteria | 1693 |
| 141 | Ga0075368_10000663 | 3300006042 | Bacteria | 10447 |
| 142 | Ga0075368_10001089 | 3300006042 | Bacteria | 8526 |
| 143 | Ga0075363_100000245 | 3300006048 | Bacteria | 15302 |
| 144 | Ga0075364_10002698 | 3300006051 | Bacteria | 9972 |
| 145 | Ga0075364_10006458 | 3300006051 | Bacteria | 6888 |
| 146 | Ga0075362_10007400 | 3300006177 | Bacteria | 4157 |
| 147 | Ga0075369_10005211 | 3300006186 | Bacteria | 4842 |
| 148 | Ga0075366_10013774 | 3300006195 | Bacteria | 4609 |
| 149 | Ga0075366_10081240 | 3300006195 | Bacteria | 1936 |
| 150 | Ga0075366_10129868 | 3300006195 | Bacteria | 1520 |
| 151 | Ga0097621_100023497 | 3300006237 | Bacteria | 4801 |
| 152 | Ga0097621_100071450 | 3300006237 | Bacteria | 2868 |
| 153 | Ga0097621_100313027 | 3300006237 | Bacteria | 1389 |
| 154 | Ga0068871_100180083 | 3300006358 | Bacteria | 1816 |
| 155 | Ga0068871_100183070 | 3300006358 | Bacteria | 1801 |
| 156 | Ga0075428_100021700 | 3300006844 | Bacteria | 7108 |
| 157 | Ga0075430_100001250 | 3300006846 | Bacteria | 20446 |
| 158 | Ga0075430_100302949 | 3300006846 | Bacteria | 1322 |
| 159 | Ga0075434_100059153 | 3300006871 | Bacteria | 3810 |
| 160 | Ga0068865_100101280 | 3300006881 | Bacteria | 2109 |
| 161 | Ga0068865_100434524 | 3300006881 | Bacteria | 1082 |
| 162 | Ga0097620_100011259 | 3300006931 | Bacteria | 9001 |
| 163 | Ga0097620_100022742 | 3300006931 | Bacteria | 6286 |
| 164 | Ga0097620_100025463 | 3300006931 | Bacteria | 5935 |
| 165 | Ga0097620_100073421 | 3300006931 | Bacteria | 3459 |
| 166 | Ga0105240_10009952 | 3300009093 | Bacteria | 13403 |
| 167 | Ga0105240_10011621 | 3300009093 | Bacteria | 12245 |
| 168 | Ga0105240_10152023 | 3300009093 | Bacteria | 2756 |
| 169 | Ga0105240_10366227 | 3300009093 | Bacteria | 1631 |
| 170 | Ga0111539_10108770 | 3300009094 | Bacteria | 3253 |
| 171 | Ga0111539_10770196 | 3300009094 | Bacteria | 1120 |
| 172 | Ga0105245_10001793 | 3300009098 | Bacteria | 19550 |
| 173 | Ga0105245_10004384 | 3300009098 | Bacteria | 12493 |
| 174 | Ga0105245_10032489 | 3300009098 | Bacteria | 4621 |
| 175 | Ga0105245_10167461 | 3300009098 | Bacteria | 2090 |
| 176 | Ga0105245_10187615 | 3300009098 | Bacteria | 1979 |
| 177 | Ga0105247_10002408 | 3300009101 | Bacteria | 12723 |
| 178 | Ga0105247_10004527 | 3300009101 | Bacteria | 8865 |
| 179 | Ga0105241_10001690 | 3300009174 | Bacteria | 16770 |
| 180 | Ga0105241_10008910 | 3300009174 | Bacteria | 7378 |
| 181 | Ga0105241_10065064 | 3300009174 | Bacteria | 2817 |
| 182 | Ga0105241_10067774 | 3300009174 | Bacteria | 2763 |
| 183 | Ga0105241_10318812 | 3300009174 | Bacteria | 1340 |
| 184 | Ga0105241_10426017 | 3300009174 | Bacteria | 1169 |
| 185 | Ga0105242_10003032 | 3300009176 | Bacteria | 13125 |
| 186 | Ga0105242_10028835 | 3300009176 | Bacteria | 4421 |
| 187 | Ga0105242_10114501 | 3300009176 | Bacteria | 2304 |
| 188 | Ga0105242_10299583 | 3300009176 | Bacteria | 1467 |
| 189 | Ga0105248_10001949 | 3300009177 | Bacteria | 22933 |
| 190 | Ga0105248_10166848 | 3300009177 | Bacteria | 2482 |
| 191 | Ga0105237_10091841 | 3300009545 | Bacteria | 3026 |
| 192 | Ga0105237_10151322 | 3300009545 | Bacteria | 2317 |
| 193 | Ga0105238_10038984 | 3300009551 | Bacteria | 4821 |
| 194 | Ga0105238_10079410 | 3300009551 | Bacteria | 3271 |
| 195 | Ga0105238_10114493 | 3300009551 | Bacteria | 2676 |
| 196 | Ga0105238_10136382 | 3300009551 | Bacteria | 2432 |
| 197 | Ga0105238_10203551 | 3300009551 | Bacteria | 1955 |
| 198 | Ga0105238_10712086 | 3300009551 | Bacteria | 1016 |
| 199 | Ga0105249_10000017 | 3300009553 | Bacteria | 277115 |
| 200 | Ga0105249_10076120 | 3300009553 | Bacteria | 3110 |
| 201 | Ga0105249_10083760 | 3300009553 | Bacteria | 2969 |
| 202 | Ga0105249_10214874 | 3300009553 | Bacteria | 1889 |
| 203 | Ga0105239_10012089 | 3300010375 | Bacteria | 9627 |
| 204 | Ga0105239_10029865 | 3300010375 | Bacteria | 5995 |
| 205 | Ga0105239_10321852 | 3300010375 | Bacteria | 1744 |
| 206 | Ga0105246_10002722 | 3300011119 | Bacteria | 10690 |
| 207 | Ga0105246_10036248 | 3300011119 | Bacteria | 3303 |
| 208 | Ga0157373_10003590 | 3300013100 | Bacteria | 11719 |
| 209 | Ga0157371_10005635 | 3300013102 | Bacteria | 10517 |
| 210 | Ga0157371_10044401 | 3300013102 | Bacteria | 3165 |
| 211 | Ga0157370_10105347 | 3300013104 | Bacteria | 2639 |
| 212 | Ga0157369_10053723 | 3300013105 | Bacteria | 4352 |
| 213 | Ga0157369_10178479 | 3300013105 | Bacteria | 2235 |
| 214 | Ga0157369_10202439 | 3300013105 | Bacteria | 2083 |
| 215 | Ga0157369_10345880 | 3300013105 | Bacteria | 1545 |
| 216 | Ga0157374_10001347 | 3300013296 | Bacteria | 20902 |
| 217 | Ga0157374_10229849 | 3300013296 | Bacteria | 1822 |
| 218 | Ga0157378_10007882 | 3300013297 | Bacteria | 9294 |
| 219 | Ga0157378_10033156 | 3300013297 | Bacteria | 4564 |
| 220 | Ga0163162_10010090 | 3300013306 | Bacteria | 9183 |
| 221 | Ga0157372_10000973 | 3300013307 | Bacteria | 31256 |
| 222 | Ga0157372_10012098 | 3300013307 | Bacteria | 9191 |
| 223 | Ga0157372_10016907 | 3300013307 | Bacteria | 7830 |
| 224 | Ga0157372_10035924 | 3300013307 | Bacteria | 5457 |
| 225 | Ga0157372_10109400 | 3300013307 | Bacteria | 3165 |
| 226 | Ga0157375_10021465 | 3300013308 | Bacteria | 5922 |
| 227 | Ga0157375_10092857 | 3300013308 | Bacteria | 3082 |
| 228 | Ga0157375_10121711 | 3300013308 | Bacteria | 2719 |
| 229 | Ga0157375_10259566 | 3300013308 | Bacteria | 1899 |
| 230 | Ga0163163_10013909 | 3300014325 | Bacteria | 7382 |
| 231 | Ga0163163_10036462 | 3300014325 | Bacteria | 4777 |
| 232 | Ga0163163_10150925 | 3300014325 | Bacteria | 2367 |
| 233 | Ga0163163_10400809 | 3300014325 | Bacteria | 1430 |
| 234 | Ga0157380_10002196 | 3300014326 | Bacteria | 13116 |
| 235 | Ga0157380_10080040 | 3300014326 | Bacteria | 2670 |
| 236 | Ga0182008_10081109 | 3300014497 | Bacteria | 1597 |
| 237 | Ga0157377_10052642 | 3300014745 | Bacteria | 2299 |
| 238 | Ga0157379_10071870 | 3300014968 | Bacteria | 3095 |
| 239 | Ga0157379_10090155 | 3300014968 | Bacteria | 2751 |
| 240 | Ga0157376_10062637 | 3300014969 | Bacteria | 3130 |
| 241 | Ga0157376_10094339 | 3300014969 | Bacteria | 2600 |
| 242 | Ga0213872_10041516 | 3300021361 | Bacteria | 2099 |
| 243 | Ga0213876_10000454 | 3300021384 | Bacteria | 32974 |
| 244 | Ga0213876_10002349 | 3300021384 | Bacteria | 11145 |
| 245 | Ga0209565_1000090 | 3300025263 | Bacteria | 146540 |
| 246 | Ga0209673_1001000 | 3300025273 | Bacteria | 34384 |
| 247 | Ga0209025_1000794 | 3300025294 | Bacteria | 51442 |
| 248 | Ga0209025_1045647 | 3300025294 | Bacteria | 1814 |
| 249 | Ga0209564_1030784 | 3300025295 | Bacteria | 1655 |
| 250 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 251 | Ga0209758_1000999 | 3300025297 | Bacteria | 37624 |
| 252 | Ga0209050_1045173 | 3300025298 | Bacteria | 1171 |
| 253 | Ga0209256_1002391 | 3300025299 | Bacteria | 15466 |
| 254 | Ga0209256_1006740 | 3300025299 | Bacteria | 5947 |
| 255 | Ga0209257_1003672 | 3300025304 | Bacteria | 12835 |
| 256 | Ga0207697_10059972 | 3300025315 | Bacteria | 1582 |
| 257 | Ga0207655_1000111 | 3300025728 | Bacteria | 170772 |
| 258 | Ga0207655_1033430 | 3300025728 | Bacteria | 2331 |
| 259 | Ga0207710_10002630 | 3300025900 | Bacteria | 8285 |
| 260 | Ga0207710_10031808 | 3300025900 | Bacteria | 2310 |
| 261 | Ga0207688_10089979 | 3300025901 | Bacteria | 1761 |
| 262 | Ga0207680_10013288 | 3300025903 | Bacteria | 4225 |
| 263 | Ga0207680_10024830 | 3300025903 | Bacteria | 3296 |
| 264 | Ga0207680_10241738 | 3300025903 | Bacteria | 1244 |
| 265 | Ga0207647_10019815 | 3300025904 | Bacteria | 4518 |
| 266 | Ga0207699_10012681 | 3300025906 | Bacteria | 4291 |
| 267 | Ga0207645_10054274 | 3300025907 | Bacteria | 2559 |
| 268 | Ga0207654_10011431 | 3300025911 | Bacteria | 4530 |
| 269 | Ga0207654_10015066 | 3300025911 | Bacteria | 4005 |
| 270 | Ga0207654_10016786 | 3300025911 | Bacteria | 3817 |
| 271 | Ga0207654_10046447 | 3300025911 | Bacteria | 2476 |
| 272 | Ga0207707_10003020 | 3300025912 | Bacteria | 14960 |
| 273 | Ga0207707_10350682 | 3300025912 | Bacteria | 1272 |
| 274 | Ga0207695_10009190 | 3300025913 | Bacteria | 12256 |
| 275 | Ga0207695_10013078 | 3300025913 | Bacteria | 9909 |
| 276 | Ga0207695_10314254 | 3300025913 | Bacteria | 1457 |
| 277 | Ga0207671_10017691 | 3300025914 | Bacteria | 5491 |
| 278 | Ga0207671_10041276 | 3300025914 | Bacteria | 3414 |
| 279 | Ga0207662_10051259 | 3300025918 | Bacteria | 2455 |
| 280 | Ga0207662_10124499 | 3300025918 | Bacteria | 1620 |
| 281 | Ga0207657_10008501 | 3300025919 | Bacteria | 10413 |
| 282 | Ga0207657_10072407 | 3300025919 | Bacteria | 2915 |
| 283 | Ga0207649_10002582 | 3300025920 | Bacteria | 10078 |
| 284 | Ga0207652_10050525 | 3300025921 | Bacteria | 3563 |
| 285 | Ga0207652_10061252 | 3300025921 | Bacteria | 3249 |
| 286 | Ga0207681_10048289 | 3300025923 | Bacteria | 2872 |
| 287 | Ga0207681_10063334 | 3300025923 | Bacteria | 2550 |
| 288 | Ga0207681_10317158 | 3300025923 | Bacteria | 1238 |
| 289 | Ga0207694_10026802 | 3300025924 | Bacteria | 4388 |
| 290 | Ga0207694_10064528 | 3300025924 | Bacteria | 2854 |
| 291 | Ga0207694_10088439 | 3300025924 | Bacteria | 2442 |
| 292 | Ga0207694_10158058 | 3300025924 | Bacteria | 1829 |
| 293 | Ga0207650_10015501 | 3300025925 | Bacteria | 5309 |
| 294 | Ga0207659_10003260 | 3300025926 | Bacteria | 9718 |
| 295 | Ga0207659_10029557 | 3300025926 | Bacteria | 3737 |
| 296 | Ga0207687_10007391 | 3300025927 | Bacteria | 7231 |
| 297 | Ga0207687_10008601 | 3300025927 | Bacteria | 6675 |
| 298 | Ga0207687_10052406 | 3300025927 | Bacteria | 2847 |
| 299 | Ga0207700_10053211 | 3300025928 | Bacteria | 3032 |
| 300 | Ga0207644_10242621 | 3300025931 | Bacteria | 1435 |
| 301 | Ga0207690_10003637 | 3300025932 | Bacteria | 9180 |
| 302 | Ga0207690_10089660 | 3300025932 | Bacteria | 2169 |
| 303 | Ga0207706_10006981 | 3300025933 | Bacteria | 10439 |
| 304 | Ga0207706_10007452 | 3300025933 | Bacteria | 10120 |
| 305 | Ga0207706_10044032 | 3300025933 | Bacteria | 3955 |
| 306 | Ga0207706_10398998 | 3300025933 | Bacteria | 1192 |
| 307 | Ga0207686_10023986 | 3300025934 | Bacteria | 3528 |
| 308 | Ga0207709_10038488 | 3300025935 | Bacteria | 2849 |
| 309 | Ga0207670_10015909 | 3300025936 | Bacteria | 4506 |
| 310 | Ga0207670_10110963 | 3300025936 | Bacteria | 1976 |
| 311 | Ga0207691_10171941 | 3300025940 | Bacteria | 1897 |
| 312 | Ga0207711_10198250 | 3300025941 | Bacteria | 1831 |
| 313 | Ga0207689_10006749 | 3300025942 | Bacteria | 10112 |
| 314 | Ga0207689_10019002 | 3300025942 | Bacteria | 5796 |
| 315 | Ga0207689_10020796 | 3300025942 | Bacteria | 5520 |
| 316 | Ga0207689_10078384 | 3300025942 | Bacteria | 2715 |
| 317 | Ga0207689_10086274 | 3300025942 | Bacteria | 2580 |
| 318 | Ga0207689_10092977 | 3300025942 | Bacteria | 2477 |
| 319 | Ga0207661_10001091 | 3300025944 | Bacteria | 18020 |
| 320 | Ga0207661_10018071 | 3300025944 | Bacteria | 5234 |
| 321 | Ga0207661_10052037 | 3300025944 | Bacteria | 3270 |
| 322 | Ga0207661_10167775 | 3300025944 | Bacteria | 1909 |
| 323 | Ga0207679_10009547 | 3300025945 | Bacteria | 6220 |
| 324 | Ga0207679_10394644 | 3300025945 | Bacteria | 1216 |
| 325 | Ga0207667_10005618 | 3300025949 | Bacteria | 15301 |
| 326 | Ga0207667_10207986 | 3300025949 | Bacteria | 2006 |
| 327 | Ga0207651_10016551 | 3300025960 | Bacteria | 4324 |
| 328 | Ga0207712_10000012 | 3300025961 | Bacteria | 392363 |
| 329 | Ga0207712_10020610 | 3300025961 | Bacteria | 4320 |
| 330 | Ga0207712_10097476 | 3300025961 | Bacteria | 2178 |
| 331 | Ga0207668_10002310 | 3300025972 | Bacteria | 11137 |
| 332 | Ga0207668_10044684 | 3300025972 | Bacteria | 3015 |
| 333 | Ga0207668_10099946 | 3300025972 | Bacteria | 2153 |
| 334 | Ga0207668_10181897 | 3300025972 | Bacteria | 1659 |
| 335 | Ga0207668_10212808 | 3300025972 | Bacteria | 1547 |
| 336 | Ga0207658_10008834 | 3300025986 | Bacteria | 6837 |
| 337 | Ga0207658_10020845 | 3300025986 | Bacteria | 4541 |
| 338 | Ga0207658_10314687 | 3300025986 | Bacteria | 1353 |
| 339 | Ga0207677_10005731 | 3300026023 | Bacteria | 6754 |
| 340 | Ga0207677_10056521 | 3300026023 | Bacteria | 2689 |
| 341 | Ga0207677_10244218 | 3300026023 | Bacteria | 1454 |
| 342 | Ga0207703_10003928 | 3300026035 | Bacteria | 12333 |
| 343 | Ga0207703_10026524 | 3300026035 | Bacteria | 4561 |
| 344 | Ga0207703_10028305 | 3300026035 | Bacteria | 4417 |
| 345 | Ga0207703_10210794 | 3300026035 | Bacteria | 1732 |
| 346 | Ga0207639_10026452 | 3300026041 | Bacteria | 4217 |
| 347 | Ga0207639_10028432 | 3300026041 | Bacteria | 4082 |
| 348 | Ga0207639_10051215 | 3300026041 | Bacteria | 3140 |
| 349 | Ga0207678_10002473 | 3300026067 | Bacteria | 16788 |
| 350 | Ga0207678_10074025 | 3300026067 | Bacteria | 2918 |
| 351 | Ga0207708_10015924 | 3300026075 | Bacteria | 5646 |
| 352 | Ga0207702_10009589 | 3300026078 | Bacteria | 8129 |
| 353 | Ga0207702_10015199 | 3300026078 | Bacteria | 6383 |
| 354 | Ga0207702_10022661 | 3300026078 | Bacteria | 5208 |
| 355 | Ga0207702_10096694 | 3300026078 | Bacteria | 2598 |
| 356 | Ga0207702_10168389 | 3300026078 | Bacteria | 2007 |
| 357 | Ga0207702_10674195 | 3300026078 | Bacteria | 1018 |
| 358 | Ga0207641_10002117 | 3300026088 | Bacteria | 18786 |
| 359 | Ga0207641_10003207 | 3300026088 | Bacteria | 14643 |
| 360 | Ga0207641_10003750 | 3300026088 | Bacteria | 13357 |
| 361 | Ga0207641_10007852 | 3300026088 | Bacteria | 8857 |
| 362 | Ga0207641_10154558 | 3300026088 | Bacteria | 2081 |
| 363 | Ga0207641_10444384 | 3300026088 | Bacteria | 1252 |
| 364 | Ga0207648_10104132 | 3300026089 | Bacteria | 2488 |
| 365 | Ga0207676_10003252 | 3300026095 | Bacteria | 11569 |
| 366 | Ga0207676_10110394 | 3300026095 | Bacteria | 2300 |
| 367 | Ga0207674_10001148 | 3300026116 | Bacteria | 34315 |
| 368 | Ga0207674_10441158 | 3300026116 | Bacteria | 1258 |
| 369 | Ga0207675_100001878 | 3300026118 | Bacteria | 21012 |
| 370 | Ga0207675_100013270 | 3300026118 | Bacteria | 7691 |
| 371 | Ga0207683_10003236 | 3300026121 | Bacteria | 14212 |
| 372 | Ga0207698_10104911 | 3300026142 | Bacteria | 2353 |
| 373 | Ga0207698_10205429 | 3300026142 | Bacteria | 1768 |
| 374 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 375 | Ga0209371_1000120 | 3300027312 | Bacteria | 132938 |
| 376 | Ga0209971_1013186 | 3300027682 | Bacteria | 1958 |
| 377 | Ga0209974_10021074 | 3300027876 | Bacteria | 2160 |
| 378 | Ga0268266_10000358 | 3300028379 | Bacteria | 70786 |
| 379 | Ga0268266_10001523 | 3300028379 | Bacteria | 27130 |
| 380 | Ga0268266_10105073 | 3300028379 | Bacteria | 2494 |
| 381 | Ga0268265_10000081 | 3300028380 | Bacteria | 120869 |
| 382 | Ga0268265_10018071 | 3300028380 | Bacteria | 4882 |
| 383 | Ga0268265_10028396 | 3300028380 | Bacteria | 4004 |
| 384 | Ga0268264_10000097 | 3300028381 | Bacteria | 229722 |
| 385 | Ga0268264_10003030 | 3300028381 | Bacteria | 14572 |
| 386 | Ga0268264_10024197 | 3300028381 | Bacteria | 4956 |
| 387 | Ga0268264_10295882 | 3300028381 | Bacteria | 1522 |
| 388 | Ga0268264_10449350 | 3300028381 | Bacteria | 1248 |
| 389 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 390 | Ga0268256_1001088 | 3300030500 | Bacteria | 17848 |
| 391 | Ga0265328_10011567 | 3300031239 | Bacteria | 3521 |
| 392 | Ga0265331_10000390 | 3300031250 | Bacteria | 45388 |
| 393 | Ga0265327_10000859 | 3300031251 | Bacteria | 45360 |
| 394 | Ga0265316_10009108 | 3300031344 | Bacteria | 9144 |
| 395 | Ga0307513_10057264 | 3300031456 | Bacteria | 4154 |
| 396 | Ga0316575_10071080 | 3300031665 | Bacteria | 1398 |
| 397 | Ga0265314_10027930 | 3300031711 | Bacteria | 4216 |
| 398 | Ga0307410_10013663 | 3300031852 | Bacteria | 4746 |
| 399 | Ga0307407_10004284 | 3300031903 | Bacteria | 6024 |
| 400 | Ga0307416_100036400 | 3300032002 | Bacteria | 3774 |
| 401 | Ga0307414_10010035 | 3300032004 | Bacteria | 5472 |
| 402 | Ga0307411_10006780 | 3300032005 | Bacteria | 5765 |
| 403 | Ga0307415_100008640 | 3300032126 | Bacteria | 5659 |
| 404 | Ga0307510_10017468 | 3300033180 | Bacteria | 8459 |
| 405 | Ga0373934_0053581 | 3300035086 | Bacteria | 1600 |
| 406 | Ga0373923_0101566 | 3300035111 | Bacteria | 1269 |
| 407 | Ga0373941_0011048 | 3300035115 | Bacteria | 2324 |
| 408 | Ga0373955_0014369 | 3300035172 | Bacteria | 3850 |
| 409 | Ga0373955_0057627 | 3300035172 | Bacteria | 2135 |
| 410 | Ga0373961_0000150 | 3300035241 | Bacteria | 34332 |
| 411 | Ga0373962_0043098 | 3300035242 | Bacteria | 1278 |
| 412 | Ga0373935_0108097 | 3300035692 | Bacteria | 1843 |
| 413 | Ga0373933_0201885 | 3300035724 | Bacteria | 1272 |
| 414 | Ga0373933_0315460 | 3300035724 | Bacteria | 1013 |
| 415 | Ga0373937_0111000 | 3300036401 | Bacteria | 2550 |
| 416 | Ga0395898_0058786 | 3300037466 | Bacteria | 3742 |
| 417 | Ga0395905_0017780 | 3300037471 | Bacteria | 6753 |
| 418 | Ga0395905_0285999 | 3300037471 | Bacteria | 1536 |
| 419 | Ga0395901_0109455 | 3300038443 | Bacteria | 2901 |
| 420 | Ga0400490_01037 | 3300038726 | Bacteria | 12310 |
| 421 | Ga0400483_209481 | 3300039062 | Bacteria | 2395 |
| 422 | Ga0436365_0499375 | 3300039437 | Bacteria | 98723 |
| 423 | Ga0436365_0866656 | 3300039437 | Bacteria | 2064 |
| 424 | Ga0436365_1326821 | 3300039437 | Bacteria | 37380 |
| 425 | Ga0436363_0359992 | 3300039450 | Bacteria | 2727 |
| 426 | Ga0436363_1626008 | 3300039450 | Bacteria | 4615 |
| 427 | Ga0439447_003273 | 3300041407 | Bacteria | 5761 |
| 428 | Ga0439466_0000450 | 3300041411 | Bacteria | 15663 |
| 429 | Ga0439452_003762 | 3300042010 | Bacteria | 5226 |
| 430 | Ga0451577_0000041 | 3300042876 | Bacteria | 335318 |
| 431 | Ga0451577_0001488 | 3300042876 | Bacteria | 31005 |
| 432 | Ga0453683_0007367 | 3300044673 | Bacteria | 7472 |
| 433 | Ga0453684_0000066 | 3300044712 | Bacteria | 465545 |
| 434 | Ga0451576_0017861 | 3300045051 | Bacteria | 7792 |
| 435 | Ga0451576_0083175 | 3300045051 | Bacteria | 3330 |
| 436 | Ga0466967_0032202 | 3300045976 | Bacteria | 4424 |
| 437 | Ga0466967_0412241 | 3300045976 | Bacteria | 1316 |
| 438 | Ga0466967_0497249 | 3300045976 | Bacteria | 1196 |
| 439 | Ga0495629_0060216 | 3300046459 | Bacteria | 2654 |
| 440 | Ga0495629_0068291 | 3300046459 | Bacteria | 2480 |
| 441 | Ga0495638_0000996 | 3300046460 | Bacteria | 28464 |
| 442 | Ga0495650_0056345 | 3300046471 | Bacteria | 1595 |
| 443 | Ga0495580_0145717 | 3300046472 | Bacteria | 1641 |
| 444 | Ga0495594_0242043 | 3300046499 | Bacteria | 1028 |
| 445 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 446 | Ga0495610_0032003 | 3300046512 | Bacteria | 2738 |
| 447 | Ga0495616_0044405 | 3300046513 | Bacteria | 2254 |
| 448 | Ga0495628_0019871 | 3300046516 | Bacteria | 5549 |
| 449 | Ga0495630_0076272 | 3300046517 | Bacteria | 2526 |
| 450 | Ga0495632_0014505 | 3300046519 | Bacteria | 4453 |
| 451 | Ga0495637_0002909 | 3300046520 | Bacteria | 9256 |
| 452 | Ga0495643_0000824 | 3300046522 | Bacteria | 33778 |
| 453 | Ga0495643_0009015 | 3300046522 | Bacteria | 6261 |
| 454 | Ga0495648_0043134 | 3300046524 | Bacteria | 2831 |
| 455 | Ga0495642_0004720 | 3300046528 | Bacteria | 5278 |
| 456 | Ga0495654_0000016 | 3300046530 | Bacteria | 306416 |
| 457 | Ga0495665_0059580 | 3300046531 | Bacteria | 2015 |
| 458 | Ga0495587_0006235 | 3300046536 | Bacteria | 7784 |
| 459 | Ga0495587_0059100 | 3300046536 | Bacteria | 2251 |
| 460 | Ga0495645_0003877 | 3300046543 | Bacteria | 10187 |
| 461 | Ga0495667_0165949 | 3300046559 | Bacteria | 1419 |
| 462 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 463 | Ga0495625_0000795 | 3300046660 | Bacteria | 43736 |
| 464 | Ga0495625_0046381 | 3300046660 | Bacteria | 3136 |
| 465 | Ga0495625_0355080 | 3300046660 | Bacteria | 925 |
| 466 | Ga0495635_0039386 | 3300046663 | Bacteria | 3270 |
| 467 | Ga0495657_0251021 | 3300046675 | Bacteria | 1065 |
| 468 | Ga0495599_0000961 | 3300046678 | Bacteria | 16113 |
| 469 | Ga0495599_0021874 | 3300046678 | Bacteria | 3992 |
| 470 | Ga0495623_0013898 | 3300046679 | Bacteria | 5219 |
| 471 | Ga0495670_0013523 | 3300046691 | Bacteria | 4014 |
| 472 | Ga0495600_0141369 | 3300046809 | Bacteria | 1562 |
| 473 | Ga0495581_0031555 | 3300047315 | Bacteria | 3070 |
| 474 | Ga0495604_0045665 | 3300047317 | Bacteria | 3418 |
| 475 | Ga0495674_0133679 | 3300047319 | Bacteria | 2089 |
| 476 | Ga0495680_0217098 | 3300047322 | Bacteria | 1367 |
| 477 | Ga0495687_000080 | 3300047443 | Bacteria | 147467 |
| 478 | Ga0495677_0000148 | 3300047445 | Bacteria | 33532 |
| 479 | Ga0495684_0004932 | 3300047471 | Bacteria | 10418 |
| 480 | Ga0495602_0118215 | 3300048088 | Bacteria | 2138 |
| 481 | Ga0496101_0056454 | 3300048904 | Bacteria | 2839 |
| 482 | Ga0496102_0007448 | 3300048905 | Bacteria | 9354 |
| 483 | Ga0496103_0196676 | 3300048906 | Bacteria | 1296 |
| 484 | Ga0496104_0142596 | 3300048907 | Bacteria | 2302 |
| 485 | Ga0496105_0094154 | 3300048908 | Bacteria | 2474 |
| 486 | Ga0496106_0047605 | 3300048909 | Bacteria | 3227 |
| 487 | Ga0496107_0000034 | 3300048910 | Bacteria | 91621 |
| 488 | Ga0496108_0041945 | 3300048911 | Bacteria | 3820 |
| 489 | Ga0496109_0077664 | 3300048912 | Bacteria | 3056 |
| 490 | Ga0496109_0099064 | 3300048912 | Bacteria | 2703 |
| 491 | Ga0496110_0377879 | 3300048913 | Bacteria | 1291 |
| 492 | Ga0496111_0392170 | 3300048914 | Bacteria | 1026 |
| 493 | Ga0496112_0005603 | 3300048915 | Bacteria | 10891 |
| 494 | Ga0496113_0033623 | 3300048916 | Bacteria | 3736 |
| 495 | Ga0496115_0000617 | 3300048918 | Bacteria | 27037 |
| 496 | Ga0496116_0003497 | 3300048919 | Bacteria | 15462 |
| 497 | Ga0496116_0004238 | 3300048919 | Bacteria | 13773 |
| 498 | Ga0496117_0000154 | 3300048920 | Bacteria | 146606 |
| 499 | Ga0496117_0075034 | 3300048920 | Bacteria | 2248 |
| 500 | Ga0496118_0000150 | 3300048921 | Bacteria | 123251 |
| 501 | Ga0496119_0010270 | 3300048922 | Bacteria | 7893 |
| 502 | Ga0496119_0012367 | 3300048922 | Bacteria | 6939 |
| 503 | Ga0496120_0000476 | 3300048923 | Bacteria | 62924 |
| 504 | Ga0496120_0020471 | 3300048923 | Bacteria | 4203 |
| 505 | Ga0496121_0000389 | 3300048924 | Bacteria | 89759 |
| 506 | Ga0496121_0032620 | 3300048924 | Bacteria | 4731 |
| 507 | Ga0496121_0036886 | 3300048924 | Bacteria | 4350 |
| 508 | Ga0496124_0002597 | 3300048927 | Bacteria | 23374 |
| 509 | Ga0496124_0005736 | 3300048927 | Bacteria | 13822 |
| 510 | Ga0496124_0006334 | 3300048927 | Bacteria | 12918 |
| 511 | Ga0496124_0025013 | 3300048927 | Bacteria | 5414 |
| 512 | Ga0496124_0121588 | 3300048927 | Bacteria | 2085 |
| 513 | Ga0496125_0000006 | 3300048928 | Bacteria | 759385 |
| 514 | Ga0496125_0167293 | 3300048928 | Bacteria | 1484 |
| 515 | Ga0496126_0008533 | 3300048929 | Bacteria | 11048 |
| 516 | Ga0501034_0382247 | 3300049571 | Bacteria | 1333 |
| 517 | Ga0501036_0407289 | 3300049572 | Bacteria | 1134 |
| 518 | Ga0501037_0044318 | 3300049573 | Bacteria | 3267 |
| 519 | Ga0501040_0102244 | 3300049576 | Bacteria | 2000 |
| 520 | Ga0501047_0000742 | 3300049581 | Bacteria | 33985 |
| 521 | Ga0501072_0082089 | 3300049588 | Bacteria | 2555 |
| 522 | Ga0501073_0023217 | 3300049589 | Bacteria | 4457 |
| 523 | Ga0501075_0154222 | 3300049591 | Bacteria | 1751 |
| 524 | Ga0501238_002629 | 3300049671 | Bacteria | 2160 |
| 525 | Ga0501079_0140598 | 3300049741 | Bacteria | 1881 |
| 526 | Ga0501083_0000809 | 3300049744 | Bacteria | 20519 |
| 527 | nmdc:mga0k408_53786_c1 | 3300050493 | Bacteria | 2333 |
| 528 | nmdc:mga07m45_32541_c1 | 3300050496 | Bacteria | 2892 |
| 529 | nmdc:mga05p37_47878_c1 | 3300050507 | Bacteria | 5257 |
| 530 | nmdc:mga09592_292920_c1 | 3300050508 | Bacteria | 1411 |
| 531 | nmdc:mga0qj67_17874_c1 | 3300050509 | Bacteria | 5397 |
| 532 | nmdc:mga0qj67_94559_c1 | 3300050509 | Bacteria | 2404 |
| 533 | nmdc:mga08y16_218354_c1 | 3300050511 | Bacteria | 1974 |
| 534 | nmdc:mga0n895_144000_c1 | 3300050512 | Bacteria | 2412 |
| 535 | nmdc:mga0n895_687993_c1 | 3300050512 | Bacteria | 1019 |
| 536 | nmdc:mga0sz30_22420_c1 | 3300050516 | Bacteria | 2563 |
| 537 | Ga0495619_0168060 | 3300053085 | Bacteria | 1516 |
| 538 | Ga0500556_0000401 | 3300053104 | Bacteria | 31673 |
| 539 | Ga0500616_0014124 | 3300053153 | Bacteria | 4601 |
| 540 | Ga0500616_0017070 | 3300053153 | Bacteria | 4121 |
| 541 | Ga0500636_0028996 | 3300053177 | Bacteria | 3268 |
| 542 | Ga0500645_001858 | 3300053730 | Bacteria | 10118 |
| 543 | Ga0501084_0247846 | 3300054114 | Bacteria | 1504 |
| 544 | Ga0501082_0012135 | 3300060353 | Bacteria | 7402 |
| 545 | Ga0501082_0086135 | 3300060353 | Bacteria | 2710 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048088 | Ga0495602_0118215 | Ga0495602_0118215_530_1417 | 257 |
| 2 | 3300005614 | Ga0068856_100760583 | Ga0068856_1007605831 | 282 |
| 3 | 3300013105 | Ga0157369_10345880 | Ga0157369_103458802 | 282 |
| 4 | 3300013307 | Ga0157372_10016907 | Ga0157372_100169077 | 282 |
| 5 | 3300025924 | Ga0207694_10026802 | Ga0207694_100268023 | 282 |
| 6 | 3300025933 | Ga0207706_10044032 | Ga0207706_100440324 | 282 |
| 7 | 3300026078 | Ga0207702_10674195 | Ga0207702_106741951 | 282 |
| 8 | iso_pu_bacteria | 2849573788 | 2849577329 | 283 |
| 9 | iso_pu_bacteria | 2865014394 | 2865017424 | 283 |
| 10 | iso_pu_bacteria | 2602042067 | 2603705184 | 284 |
| 11 | iso_pu_bacteria | 2855195626 | 2855199392 | 285 |
| 12 | iso_pu_bacteria | 2858466076 | 2858470185 | 285 |
| 13 | iso_pu_bacteria | 2871272651 | 2871275362 | 285 |
| 14 | iso_pu_bacteria | 2919108558 | 2919111260 | 285 |
| 15 | 3300005290 | Ga0065712_10165267 | Ga0065712_101652672 | 287 |
| 16 | 3300005330 | Ga0070690_100008468 | Ga0070690_1000084682 | 287 |
| 17 | 3300005331 | Ga0070670_100207587 | Ga0070670_1002075873 | 287 |
| 18 | 3300005335 | Ga0070666_10041563 | Ga0070666_100415632 | 287 |
| 19 | 3300005353 | Ga0070669_100267835 | Ga0070669_1002678351 | 287 |
| 20 | 3300005354 | Ga0070675_100166375 | Ga0070675_1001663752 | 287 |
| 21 | 3300005365 | Ga0070688_100026284 | Ga0070688_1000262844 | 287 |
| 22 | 3300005367 | Ga0070667_100016211 | Ga0070667_1000162113 | 287 |
| 23 | 3300005577 | Ga0068857_100113316 | Ga0068857_1001133163 | 287 |
| 24 | 3300005617 | Ga0068859_100073429 | Ga0068859_1000734294 | 287 |
| 25 | 3300005618 | Ga0068864_100216627 | Ga0068864_1002166272 | 287 |
| 26 | 3300005844 | Ga0068862_100032747 | Ga0068862_1000327474 | 287 |
| 27 | 3300006195 | Ga0075366_10081240 | Ga0075366_100812401 | 287 |
| 28 | 3300006881 | Ga0068865_100434524 | Ga0068865_1004345242 | 287 |
| 29 | 3300006931 | Ga0097620_100073421 | Ga0097620_1000734214 | 287 |
| 30 | 3300025294 | Ga0209025_1045647 | Ga0209025_10456472 | 287 |
| 31 | 3300025903 | Ga0207680_10024830 | Ga0207680_100248304 | 287 |
| 32 | 3300025913 | Ga0207695_10314254 | Ga0207695_103142541 | 287 |
| 33 | 3300025923 | Ga0207681_10317158 | Ga0207681_103171582 | 287 |
| 34 | 3300025926 | Ga0207659_10029557 | Ga0207659_100295572 | 287 |
| 35 | 3300025942 | Ga0207689_10020796 | Ga0207689_100207962 | 287 |
| 36 | 3300025944 | Ga0207661_10052037 | Ga0207661_100520372 | 287 |
| 37 | 3300025949 | Ga0207667_10207986 | Ga0207667_102079862 | 287 |
| 38 | 3300025961 | Ga0207712_10020610 | Ga0207712_100206103 | 287 |
| 39 | 3300025972 | Ga0207668_10002310 | Ga0207668_1000231010 | 287 |
| 40 | 3300025972 | Ga0207668_10212808 | Ga0207668_102128082 | 287 |
| 41 | 3300025986 | Ga0207658_10314687 | Ga0207658_103146871 | 287 |
| 42 | 3300026088 | Ga0207641_10154558 | Ga0207641_101545582 | 287 |
| 43 | 3300027312 | Ga0209371_1000120 | Ga0209371_100012054 | 287 |
| 44 | 3300030500 | Ga0268256_1001088 | Ga0268256_10010883 | 287 |
| 45 | 3300039062 | Ga0400483_209481 | Ga0400483_209481_704_1573 | 287 |
| 46 | 3300041411 | Ga0439466_0000450 | Ga0439466_0000450_1575_2438 | 287 |
| 47 | 3300046520 | Ga0495637_0002909 | Ga0495637_0002909_4390_5253 | 287 |
| 48 | 3300048919 | Ga0496116_0004238 | Ga0496116_0004238_1408_2271 | 287 |
| 49 | 3300048920 | Ga0496117_0000154 | Ga0496117_0000154_67535_68398 | 287 |
| 50 | 3300048921 | Ga0496118_0000150 | Ga0496118_0000150_67535_68398 | 287 |
| 51 | 3300048922 | Ga0496119_0012367 | Ga0496119_0012367_4646_5509 | 287 |
| 52 | 3300048923 | Ga0496120_0020471 | Ga0496120_0020471_1454_2317 | 287 |
| 53 | 3300048924 | Ga0496121_0000389 | Ga0496121_0000389_87476_88339 | 287 |
| 54 | 3300048927 | Ga0496124_0005736 | Ga0496124_0005736_1430_2293 | 287 |
| 55 | 3300048927 | Ga0496124_0006334 | Ga0496124_0006334_9844_10707 | 287 |
| 56 | 3300048929 | Ga0496126_0008533 | Ga0496126_0008533_1430_2293 | 287 |
| 57 | 3300049671 | Ga0501238_002629 | Ga0501238_002629_765_1628 | 287 |
| 58 | 3300050493 | nmdc:mga0k408_53786_c1 | nmdc:mga0k408_53786_c1_697_1560 | 287 |
| 59 | 3300053104 | Ga0500556_0000401 | Ga0500556_0000401_8336_9199 | 287 |
| 60 | 3300053730 | Ga0500645_001858 | Ga0500645_001858_1731_2594 | 287 |
| 61 | iso_pu_bacteria | 2600255256 | 2601534817 | 287 |
| 62 | iso_pu_bacteria | 2600255257 | 2601539554 | 287 |
| 63 | iso_pu_bacteria | 2600255310 | 2601757904 | 287 |
| 64 | iso_pu_bacteria | 2600255311 | 2601764262 | 287 |
| 65 | iso_pu_bacteria | 2847797336 | 2847799125 | 287 |
| 66 | 3300003775 | Ga0055524_1004355 | Ga0055524_10043552 | 288 |
| 67 | 3300003790 | Ga0055528_1018983 | Ga0055528_10189832 | 288 |
| 68 | 3300005335 | Ga0070666_10013029 | Ga0070666_100130295 | 288 |
| 69 | 3300005367 | Ga0070667_100099591 | Ga0070667_1000995912 | 288 |
| 70 | 3300005617 | Ga0068859_100022742 | Ga0068859_1000227422 | 288 |
| 71 | 3300005841 | Ga0068863_100004607 | Ga0068863_10000460711 | 288 |
| 72 | 3300005841 | Ga0068863_100040645 | Ga0068863_1000406453 | 288 |
| 73 | 3300005843 | Ga0068860_100000054 | Ga0068860_100000054159 | 288 |
| 74 | 3300005843 | Ga0068860_100001647 | Ga0068860_1000016477 | 288 |
| 75 | 3300005844 | Ga0068862_100000032 | Ga0068862_10000003212 | 288 |
| 76 | 3300006931 | Ga0097620_100022742 | Ga0097620_1000227422 | 288 |
| 77 | 3300009101 | Ga0105247_10002408 | Ga0105247_100024089 | 288 |
| 78 | 3300009545 | Ga0105237_10091841 | Ga0105237_100918414 | 288 |
| 79 | 3300009553 | Ga0105249_10000017 | Ga0105249_10000017260 | 288 |
| 80 | 3300009553 | Ga0105249_10214874 | Ga0105249_102148742 | 288 |
| 81 | 3300014968 | Ga0157379_10071870 | Ga0157379_100718704 | 288 |
| 82 | 3300025263 | Ga0209565_1000090 | Ga0209565_100009062 | 288 |
| 83 | 3300025273 | Ga0209673_1001000 | Ga0209673_100100025 | 288 |
| 84 | 3300025295 | Ga0209564_1030784 | Ga0209564_10307841 | 288 |
| 85 | 3300025297 | Ga0209758_1000999 | Ga0209758_100099925 | 288 |
| 86 | 3300025299 | Ga0209256_1002391 | Ga0209256_100239111 | 288 |
| 87 | 3300025299 | Ga0209256_1006740 | Ga0209256_10067403 | 288 |
| 88 | 3300025900 | Ga0207710_10002630 | Ga0207710_100026307 | 288 |
| 89 | 3300025961 | Ga0207712_10000012 | Ga0207712_1000001291 | 288 |
| 90 | 3300025961 | Ga0207712_10097476 | Ga0207712_100974763 | 288 |
| 91 | 3300025972 | Ga0207668_10181897 | Ga0207668_101818972 | 288 |
| 92 | 3300026088 | Ga0207641_10002117 | Ga0207641_1000211711 | 288 |
| 93 | 3300026088 | Ga0207641_10003207 | Ga0207641_100032072 | 288 |
| 94 | 3300028379 | Ga0268266_10001523 | Ga0268266_100015239 | 288 |
| 95 | 3300028380 | Ga0268265_10000081 | Ga0268265_1000008197 | 288 |
| 96 | 3300028381 | Ga0268264_10000097 | Ga0268264_1000009768 | 288 |
| 97 | 3300028381 | Ga0268264_10003030 | Ga0268264_100030302 | 288 |
| 98 | 3300046460 | Ga0495638_0000996 | Ga0495638_0000996_9470_10336 | 288 |
| 99 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_611597_612463 | 288 |
| 100 | 3300046512 | Ga0495610_0032003 | Ga0495610_0032003_1768_2634 | 288 |
| 101 | 3300046519 | Ga0495632_0014505 | Ga0495632_0014505_3466_4332 | 288 |
| 102 | 3300046524 | Ga0495648_0043134 | Ga0495648_0043134_1359_2225 | 288 |
| 103 | 3300046530 | Ga0495654_0000016 | Ga0495654_0000016_34700_35566 | 288 |
| 104 | 3300046660 | Ga0495625_0000795 | Ga0495625_0000795_1490_2356 | 288 |
| 105 | 3300046660 | Ga0495625_0046381 | Ga0495625_0046381_92_958 | 288 |
| 106 | 3300046660 | Ga0495625_0355080 | Ga0495625_0355080_12_878 | 288 |
| 107 | 3300046691 | Ga0495670_0013523 | Ga0495670_0013523_601_1467 | 288 |
| 108 | 3300048904 | Ga0496101_0056454 | Ga0496101_0056454_553_1419 | 288 |
| 109 | 3300048909 | Ga0496106_0047605 | Ga0496106_0047605_2113_2979 | 288 |
| 110 | 3300048910 | Ga0496107_0000034 | Ga0496107_0000034_79641_80507 | 288 |
| 111 | 3300048918 | Ga0496115_0000617 | Ga0496115_0000617_89_955 | 288 |
| 112 | 3300053153 | Ga0500616_0014124 | Ga0500616_0014124_22_888 | 288 |
| 113 | iso_pu_bacteria | 2608642108 | 2608671392 | 288 |
| 114 | iso_pu_bacteria | 2870782633 | 2870788478 | 288 |
| 115 | 3300005343 | Ga0070687_100107145 | Ga0070687_1001071452 | 289 |
| 116 | 3300005444 | Ga0070694_100052656 | Ga0070694_1000526563 | 289 |
| 117 | 3300005549 | Ga0070704_100003369 | Ga0070704_1000033699 | 289 |
| 118 | 3300005617 | Ga0068859_100025462 | Ga0068859_1000254626 | 289 |
| 119 | 3300005719 | Ga0068861_100015487 | Ga0068861_1000154874 | 289 |
| 120 | 3300005842 | Ga0068858_100005691 | Ga0068858_1000056917 | 289 |
| 121 | 3300005844 | Ga0068862_100034166 | Ga0068862_1000341663 | 289 |
| 122 | 3300006931 | Ga0097620_100025463 | Ga0097620_1000254632 | 289 |
| 123 | 3300009098 | Ga0105245_10032489 | Ga0105245_100324892 | 289 |
| 124 | 3300009174 | Ga0105241_10318812 | Ga0105241_103188122 | 289 |
| 125 | 3300021384 | Ga0213876_10000454 | Ga0213876_100004543 | 289 |
| 126 | 3300025918 | Ga0207662_10124499 | Ga0207662_101244992 | 289 |
| 127 | 3300025927 | Ga0207687_10052406 | Ga0207687_100524062 | 289 |
| 128 | 3300025942 | Ga0207689_10092977 | Ga0207689_100929772 | 289 |
| 129 | 3300026035 | Ga0207703_10003928 | Ga0207703_100039287 | 289 |
| 130 | 3300026075 | Ga0207708_10015924 | Ga0207708_100159246 | 289 |
| 131 | 3300026118 | Ga0207675_100013270 | Ga0207675_1000132706 | 289 |
| 132 | 3300031852 | Ga0307410_10013663 | Ga0307410_100136633 | 289 |
| 133 | 3300031903 | Ga0307407_10004284 | Ga0307407_100042844 | 289 |
| 134 | 3300032002 | Ga0307416_100036400 | Ga0307416_1000364003 | 289 |
| 135 | 3300032004 | Ga0307414_10010035 | Ga0307414_100100352 | 289 |
| 136 | 3300032005 | Ga0307411_10006780 | Ga0307411_100067802 | 289 |
| 137 | 3300032126 | Ga0307415_100008640 | Ga0307415_1000086402 | 289 |
| 138 | 3300039437 | Ga0436365_0499375 | Ga0436365_0499375_27239_28108 | 289 |
| 139 | 3300039450 | Ga0436363_0359992 | Ga0436363_0359992_1640_2515 | 289 |
| 140 | 3300046471 | Ga0495650_0056345 | Ga0495650_0056345_53_925 | 289 |
| 141 | 3300047315 | Ga0495581_0031555 | Ga0495581_0031555_1795_2688 | 289 |
| 142 | 3300049571 | Ga0501034_0382247 | Ga0501034_0382247_154_1023 | 289 |
| 143 | 3300050507 | nmdc:mga05p37_47878_c1 | nmdc:mga05p37_47878_c1_888_1760 | 289 |
| 144 | iso_pu_bacteria | 2600255067 | 2600812697 | 289 |
| 145 | iso_pu_bacteria | 2883291878 | 2883295138 | 289 |
| 146 | 3300005293 | Ga0065715_10149355 | Ga0065715_101493552 | 290 |
| 147 | 3300005328 | Ga0070676_10143023 | Ga0070676_101430231 | 290 |
| 148 | 3300005331 | Ga0070670_100179730 | Ga0070670_1001797302 | 290 |
| 149 | 3300005334 | Ga0068869_100015212 | Ga0068869_1000152124 | 290 |
| 150 | 3300005334 | Ga0068869_100077559 | Ga0068869_1000775592 | 290 |
| 151 | 3300005335 | Ga0070666_10259252 | Ga0070666_102592521 | 290 |
| 152 | 3300005338 | Ga0068868_100015359 | Ga0068868_1000153596 | 290 |
| 153 | 3300005340 | Ga0070689_100088246 | Ga0070689_1000882462 | 290 |
| 154 | 3300005343 | Ga0070687_100047568 | Ga0070687_1000475682 | 290 |
| 155 | 3300005343 | Ga0070687_100095761 | Ga0070687_1000957612 | 290 |
| 156 | 3300005344 | Ga0070661_100061651 | Ga0070661_1000616513 | 290 |
| 157 | 3300005347 | Ga0070668_100058865 | Ga0070668_1000588652 | 290 |
| 158 | 3300005347 | Ga0070668_100139401 | Ga0070668_1001394012 | 290 |
| 159 | 3300005353 | Ga0070669_100395958 | Ga0070669_1003959581 | 290 |
| 160 | 3300005354 | Ga0070675_100067343 | Ga0070675_1000673432 | 290 |
| 161 | 3300005355 | Ga0070671_100332789 | Ga0070671_1003327892 | 290 |
| 162 | 3300005356 | Ga0070674_100028242 | Ga0070674_1000282422 | 290 |
| 163 | 3300005365 | Ga0070688_100156858 | Ga0070688_1001568581 | 290 |
| 164 | 3300005366 | Ga0070659_100024267 | Ga0070659_1000242674 | 290 |
| 165 | 3300005367 | Ga0070667_100027798 | Ga0070667_1000277984 | 290 |
| 166 | 3300005438 | Ga0070701_10082453 | Ga0070701_100824532 | 290 |
| 167 | 3300005441 | Ga0070700_100076299 | Ga0070700_1000762992 | 290 |
| 168 | 3300005444 | Ga0070694_100086379 | Ga0070694_1000863792 | 290 |
| 169 | 3300005455 | Ga0070663_100061814 | Ga0070663_1000618143 | 290 |
| 170 | 3300005455 | Ga0070663_100201876 | Ga0070663_1002018762 | 290 |
| 171 | 3300005456 | Ga0070678_100111757 | Ga0070678_1001117573 | 290 |
| 172 | 3300005457 | Ga0070662_100087815 | Ga0070662_1000878152 | 290 |
| 173 | 3300005530 | Ga0070679_100502802 | Ga0070679_1005028021 | 290 |
| 174 | 3300005539 | Ga0068853_100066343 | Ga0068853_1000663432 | 290 |
| 175 | 3300005539 | Ga0068853_100150960 | Ga0068853_1001509601 | 290 |
| 176 | 3300005543 | Ga0070672_100169887 | Ga0070672_1001698872 | 290 |
| 177 | 3300005546 | Ga0070696_100194126 | Ga0070696_1001941261 | 290 |
| 178 | 3300005548 | Ga0070665_100002252 | Ga0070665_1000022524 | 290 |
| 179 | 3300005548 | Ga0070665_100080245 | Ga0070665_1000802452 | 290 |
| 180 | 3300005563 | Ga0068855_100001082 | Ga0068855_10000108228 | 290 |
| 181 | 3300005563 | Ga0068855_100033389 | Ga0068855_1000333896 | 290 |
| 182 | 3300005577 | Ga0068857_100150154 | Ga0068857_1001501542 | 290 |
| 183 | 3300005614 | Ga0068856_100079629 | Ga0068856_1000796292 | 290 |
| 184 | 3300005614 | Ga0068856_100112652 | Ga0068856_1001126521 | 290 |
| 185 | 3300005614 | Ga0068856_100338603 | Ga0068856_1003386032 | 290 |
| 186 | 3300005615 | Ga0070702_100097195 | Ga0070702_1000971951 | 290 |
| 187 | 3300005616 | Ga0068852_100035429 | Ga0068852_1000354291 | 290 |
| 188 | 3300005618 | Ga0068864_100018905 | Ga0068864_1000189052 | 290 |
| 189 | 3300005718 | Ga0068866_10149004 | Ga0068866_101490041 | 290 |
| 190 | 3300005842 | Ga0068858_100026305 | Ga0068858_1000263056 | 290 |
| 191 | 3300005843 | Ga0068860_100052234 | Ga0068860_1000522342 | 290 |
| 192 | 3300005844 | Ga0068862_100032971 | Ga0068862_1000329713 | 290 |
| 193 | 3300006042 | Ga0075368_10001089 | Ga0075368_100010896 | 290 |
| 194 | 3300006051 | Ga0075364_10002698 | Ga0075364_100026982 | 290 |
| 195 | 3300006186 | Ga0075369_10005211 | Ga0075369_100052112 | 290 |
| 196 | 3300006195 | Ga0075366_10129868 | Ga0075366_101298681 | 290 |
| 197 | 3300006237 | Ga0097621_100071450 | Ga0097621_1000714503 | 290 |
| 198 | 3300006358 | Ga0068871_100180083 | Ga0068871_1001800832 | 290 |
| 199 | 3300006358 | Ga0068871_100183070 | Ga0068871_1001830701 | 290 |
| 200 | 3300006871 | Ga0075434_100059153 | Ga0075434_1000591532 | 290 |
| 201 | 3300009093 | Ga0105240_10011621 | Ga0105240_100116218 | 290 |
| 202 | 3300009094 | Ga0111539_10770196 | Ga0111539_107701961 | 290 |
| 203 | 3300009098 | Ga0105245_10004384 | Ga0105245_100043842 | 290 |
| 204 | 3300009101 | Ga0105247_10004527 | Ga0105247_100045276 | 290 |
| 205 | 3300009174 | Ga0105241_10001690 | Ga0105241_100016907 | 290 |
| 206 | 3300009174 | Ga0105241_10065064 | Ga0105241_100650642 | 290 |
| 207 | 3300009545 | Ga0105237_10151322 | Ga0105237_101513223 | 290 |
| 208 | 3300009551 | Ga0105238_10079410 | Ga0105238_100794103 | 290 |
| 209 | 3300009551 | Ga0105238_10136382 | Ga0105238_101363822 | 290 |
| 210 | 3300009551 | Ga0105238_10203551 | Ga0105238_102035512 | 290 |
| 211 | 3300009553 | Ga0105249_10076120 | Ga0105249_100761202 | 290 |
| 212 | 3300011119 | Ga0105246_10002722 | Ga0105246_100027226 | 290 |
| 213 | 3300013105 | Ga0157369_10178479 | Ga0157369_101784792 | 290 |
| 214 | 3300013297 | Ga0157378_10007882 | Ga0157378_100078822 | 290 |
| 215 | 3300013306 | Ga0163162_10010090 | Ga0163162_100100903 | 290 |
| 216 | 3300013308 | Ga0157375_10259566 | Ga0157375_102595662 | 290 |
| 217 | 3300014325 | Ga0163163_10013909 | Ga0163163_100139092 | 290 |
| 218 | 3300014326 | Ga0157380_10002196 | Ga0157380_100021964 | 290 |
| 219 | 3300014969 | Ga0157376_10062637 | Ga0157376_100626372 | 290 |
| 220 | 3300014969 | Ga0157376_10094339 | Ga0157376_100943392 | 290 |
| 221 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017161 | 290 |
| 222 | 3300025900 | Ga0207710_10031808 | Ga0207710_100318082 | 290 |
| 223 | 3300025904 | Ga0207647_10019815 | Ga0207647_100198152 | 290 |
| 224 | 3300025911 | Ga0207654_10016786 | Ga0207654_100167862 | 290 |
| 225 | 3300025911 | Ga0207654_10046447 | Ga0207654_100464472 | 290 |
| 226 | 3300025913 | Ga0207695_10013078 | Ga0207695_100130785 | 290 |
| 227 | 3300025914 | Ga0207671_10017691 | Ga0207671_100176916 | 290 |
| 228 | 3300025918 | Ga0207662_10051259 | Ga0207662_100512593 | 290 |
| 229 | 3300025919 | Ga0207657_10072407 | Ga0207657_100724072 | 290 |
| 230 | 3300025921 | Ga0207652_10061252 | Ga0207652_100612522 | 290 |
| 231 | 3300025923 | Ga0207681_10063334 | Ga0207681_100633342 | 290 |
| 232 | 3300025924 | Ga0207694_10064528 | Ga0207694_100645282 | 290 |
| 233 | 3300025924 | Ga0207694_10158058 | Ga0207694_101580582 | 290 |
| 234 | 3300025927 | Ga0207687_10007391 | Ga0207687_100073912 | 290 |
| 235 | 3300025931 | Ga0207644_10242621 | Ga0207644_102426212 | 290 |
| 236 | 3300025932 | Ga0207690_10089660 | Ga0207690_100896603 | 290 |
| 237 | 3300025933 | Ga0207706_10007452 | Ga0207706_100074526 | 290 |
| 238 | 3300025935 | Ga0207709_10038488 | Ga0207709_100384883 | 290 |
| 239 | 3300025942 | Ga0207689_10019002 | Ga0207689_100190026 | 290 |
| 240 | 3300025942 | Ga0207689_10078384 | Ga0207689_100783843 | 290 |
| 241 | 3300025942 | Ga0207689_10086274 | Ga0207689_100862743 | 290 |
| 242 | 3300025949 | Ga0207667_10005618 | Ga0207667_100056187 | 290 |
| 243 | 3300025972 | Ga0207668_10044684 | Ga0207668_100446842 | 290 |
| 244 | 3300025972 | Ga0207668_10099946 | Ga0207668_100999462 | 290 |
| 245 | 3300026023 | Ga0207677_10056521 | Ga0207677_100565212 | 290 |
| 246 | 3300026035 | Ga0207703_10026524 | Ga0207703_100265246 | 290 |
| 247 | 3300026041 | Ga0207639_10028432 | Ga0207639_100284324 | 290 |
| 248 | 3300026041 | Ga0207639_10051215 | Ga0207639_100512153 | 290 |
| 249 | 3300026067 | Ga0207678_10002473 | Ga0207678_100024738 | 290 |
| 250 | 3300026078 | Ga0207702_10022661 | Ga0207702_100226614 | 290 |
| 251 | 3300026078 | Ga0207702_10168389 | Ga0207702_101683892 | 290 |
| 252 | 3300026095 | Ga0207676_10110394 | Ga0207676_101103942 | 290 |
| 253 | 3300026116 | Ga0207674_10441158 | Ga0207674_104411581 | 290 |
| 254 | 3300026118 | Ga0207675_100001878 | Ga0207675_1000018787 | 290 |
| 255 | 3300026121 | Ga0207683_10003236 | Ga0207683_100032367 | 290 |
| 256 | 3300026142 | Ga0207698_10104911 | Ga0207698_101049113 | 290 |
| 257 | 3300026142 | Ga0207698_10205429 | Ga0207698_102054292 | 290 |
| 258 | 3300028379 | Ga0268266_10105073 | Ga0268266_101050732 | 290 |
| 259 | 3300028380 | Ga0268265_10018071 | Ga0268265_100180713 | 290 |
| 260 | 3300028380 | Ga0268265_10028396 | Ga0268265_100283962 | 290 |
| 261 | 3300028381 | Ga0268264_10295882 | Ga0268264_102958822 | 290 |
| 262 | 3300031456 | Ga0307513_10057264 | Ga0307513_100572643 | 290 |
| 263 | 3300035115 | Ga0373941_0011048 | Ga0373941_0011048_1296_2168 | 290 |
| 264 | 3300035241 | Ga0373961_0000150 | Ga0373961_0000150_13567_14439 | 290 |
| 265 | 3300037466 | Ga0395898_0058786 | Ga0395898_0058786_2667_3563 | 290 |
| 266 | 3300037471 | Ga0395905_0017780 | Ga0395905_0017780_3770_4666 | 290 |
| 267 | 3300038443 | Ga0395901_0109455 | Ga0395901_0109455_1412_2308 | 290 |
| 268 | 3300039437 | Ga0436365_0866656 | Ga0436365_0866656_580_1470 | 290 |
| 269 | 3300045976 | Ga0466967_0032202 | Ga0466967_0032202_388_1260 | 290 |
| 270 | 3300046513 | Ga0495616_0044405 | Ga0495616_0044405_770_1642 | 290 |
| 271 | 3300046522 | Ga0495643_0000824 | Ga0495643_0000824_30550_31422 | 290 |
| 272 | 3300046522 | Ga0495643_0009015 | Ga0495643_0009015_2477_3349 | 290 |
| 273 | 3300046528 | Ga0495642_0004720 | Ga0495642_0004720_1661_2533 | 290 |
| 274 | 3300046616 | Ga0495668_0000013 | Ga0495668_0000013_345302_346174 | 290 |
| 275 | 3300047443 | Ga0495687_000080 | Ga0495687_000080_96918_97790 | 290 |
| 276 | 3300047445 | Ga0495677_0000148 | Ga0495677_0000148_8850_9722 | 290 |
| 277 | 3300048906 | Ga0496103_0196676 | Ga0496103_0196676_367_1245 | 290 |
| 278 | 3300048907 | Ga0496104_0142596 | Ga0496104_0142596_867_1745 | 290 |
| 279 | 3300048912 | Ga0496109_0077664 | Ga0496109_0077664_188_1066 | 290 |
| 280 | 3300048913 | Ga0496110_0377879 | Ga0496110_0377879_87_965 | 290 |
| 281 | 3300048924 | Ga0496121_0032620 | Ga0496121_0032620_2296_3174 | 290 |
| 282 | 3300048928 | Ga0496125_0167293 | Ga0496125_0167293_157_1035 | 290 |
| 283 | 3300049572 | Ga0501036_0407289 | Ga0501036_0407289_136_1008 | 290 |
| 284 | 3300049576 | Ga0501040_0102244 | Ga0501040_0102244_493_1365 | 290 |
| 285 | 3300049581 | Ga0501047_0000742 | Ga0501047_0000742_4367_5263 | 290 |
| 286 | 3300049591 | Ga0501075_0154222 | Ga0501075_0154222_526_1398 | 290 |
| 287 | 3300049741 | Ga0501079_0140598 | Ga0501079_0140598_628_1506 | 290 |
| 288 | 3300050496 | nmdc:mga07m45_32541_c1 | nmdc:mga07m45_32541_c1_1413_2291 | 290 |
| 289 | 3300050512 | nmdc:mga0n895_144000_c1 | nmdc:mga0n895_144000_c1_202_1080 | 290 |
| 290 | 3300050512 | nmdc:mga0n895_687993_c1 | nmdc:mga0n895_687993_c1_80_952 | 290 |
| 291 | 3300050516 | nmdc:mga0sz30_22420_c1 | nmdc:mga0sz30_22420_c1_675_1553 | 290 |
| 292 | 3300053153 | Ga0500616_0017070 | Ga0500616_0017070_1806_2678 | 290 |
| 293 | 3300053177 | Ga0500636_0028996 | Ga0500636_0028996_1880_2752 | 290 |
| 294 | 3300060353 | Ga0501082_0086135 | Ga0501082_0086135_383_1255 | 290 |
| 295 | 3300003856 | Ga0058692_1000468 | Ga0058692_100046815 | 291 |
| 296 | 3300005367 | Ga0070667_100030430 | Ga0070667_1000304308 | 291 |
| 297 | 3300005548 | Ga0070665_100000048 | Ga0070665_10000004896 | 291 |
| 298 | 3300005841 | Ga0068863_100010794 | Ga0068863_1000107943 | 291 |
| 299 | 3300006846 | Ga0075430_100001250 | Ga0075430_1000012505 | 291 |
| 300 | 3300009093 | Ga0105240_10009952 | Ga0105240_100099525 | 291 |
| 301 | 3300009093 | Ga0105240_10152023 | Ga0105240_101520232 | 291 |
| 302 | 3300021361 | Ga0213872_10041516 | Ga0213872_100415162 | 291 |
| 303 | 3300021384 | Ga0213876_10002349 | Ga0213876_100023497 | 291 |
| 304 | 3300025294 | Ga0209025_1000794 | Ga0209025_100079445 | 291 |
| 305 | 3300025912 | Ga0207707_10350682 | Ga0207707_103506821 | 291 |
| 306 | 3300025913 | Ga0207695_10009190 | Ga0207695_100091902 | 291 |
| 307 | 3300025986 | Ga0207658_10020845 | Ga0207658_100208452 | 291 |
| 308 | 3300026088 | Ga0207641_10007852 | Ga0207641_100078523 | 291 |
| 309 | 3300027312 | Ga0209371_1000002 | Ga0209371_10000021313 | 291 |
| 310 | 3300027682 | Ga0209971_1013186 | Ga0209971_10131861 | 291 |
| 311 | 3300027876 | Ga0209974_10021074 | Ga0209974_100210742 | 291 |
| 312 | 3300028379 | Ga0268266_10000358 | Ga0268266_1000035863 | 291 |
| 313 | 3300030500 | Ga0268256_1000002 | Ga0268256_1000002149 | 291 |
| 314 | 3300031239 | Ga0265328_10011567 | Ga0265328_100115672 | 291 |
| 315 | 3300031250 | Ga0265331_10000390 | Ga0265331_1000039020 | 291 |
| 316 | 3300031251 | Ga0265327_10000859 | Ga0265327_1000085920 | 291 |
| 317 | 3300035724 | Ga0373933_0201885 | Ga0373933_0201885_127_1002 | 291 |
| 318 | 3300038726 | Ga0400490_01037 | Ga0400490_01037_1380_2255 | 291 |
| 319 | 3300039437 | Ga0436365_1326821 | Ga0436365_1326821_5281_6159 | 291 |
| 320 | 3300045976 | Ga0466967_0497249 | Ga0466967_0497249_55_930 | 291 |
| 321 | 3300048928 | Ga0496125_0000006 | Ga0496125_0000006_365951_366826 | 291 |
| 322 | 3300050509 | nmdc:mga0qj67_17874_c1 | nmdc:mga0qj67_17874_c1_333_1217 | 291 |
| 323 | 3300005329 | Ga0070683_100006765 | Ga0070683_1000067658 | 292 |
| 324 | 3300005335 | Ga0070666_10267784 | Ga0070666_102677842 | 292 |
| 325 | 3300005340 | Ga0070689_100111848 | Ga0070689_1001118483 | 292 |
| 326 | 3300005535 | Ga0070684_100210353 | Ga0070684_1002103532 | 292 |
| 327 | 3300005564 | Ga0070664_100005461 | Ga0070664_1000054612 | 292 |
| 328 | 3300005843 | Ga0068860_100155355 | Ga0068860_1001553553 | 292 |
| 329 | 3300006237 | Ga0097621_100313027 | Ga0097621_1003130272 | 292 |
| 330 | 3300009093 | Ga0105240_10366227 | Ga0105240_103662271 | 292 |
| 331 | 3300009174 | Ga0105241_10067774 | Ga0105241_100677743 | 292 |
| 332 | 3300009174 | Ga0105241_10426017 | Ga0105241_104260172 | 292 |
| 333 | 3300009551 | Ga0105238_10114493 | Ga0105238_101144932 | 292 |
| 334 | 3300009551 | Ga0105238_10712086 | Ga0105238_107120861 | 292 |
| 335 | 3300010375 | Ga0105239_10029865 | Ga0105239_100298652 | 292 |
| 336 | 3300010375 | Ga0105239_10321852 | Ga0105239_103218522 | 292 |
| 337 | 3300011119 | Ga0105246_10036248 | Ga0105246_100362483 | 292 |
| 338 | 3300013102 | Ga0157371_10044401 | Ga0157371_100444013 | 292 |
| 339 | 3300013105 | Ga0157369_10053723 | Ga0157369_100537233 | 292 |
| 340 | 3300013307 | Ga0157372_10035924 | Ga0157372_100359243 | 292 |
| 341 | 3300013307 | Ga0157372_10109400 | Ga0157372_101094003 | 292 |
| 342 | 3300014326 | Ga0157380_10080040 | Ga0157380_100800402 | 292 |
| 343 | 3300014497 | Ga0182008_10081109 | Ga0182008_100811092 | 292 |
| 344 | 3300014745 | Ga0157377_10052642 | Ga0157377_100526421 | 292 |
| 345 | 3300014968 | Ga0157379_10090155 | Ga0157379_100901552 | 292 |
| 346 | 3300025304 | Ga0209257_1003672 | Ga0209257_10036727 | 292 |
| 347 | 3300025728 | Ga0207655_1000111 | Ga0207655_100011158 | 292 |
| 348 | 3300025728 | Ga0207655_1033430 | Ga0207655_10334301 | 292 |
| 349 | 3300025903 | Ga0207680_10013288 | Ga0207680_100132884 | 292 |
| 350 | 3300025903 | Ga0207680_10241738 | Ga0207680_102417382 | 292 |
| 351 | 3300025911 | Ga0207654_10015066 | Ga0207654_100150663 | 292 |
| 352 | 3300025914 | Ga0207671_10041276 | Ga0207671_100412761 | 292 |
| 353 | 3300025924 | Ga0207694_10088439 | Ga0207694_100884393 | 292 |
| 354 | 3300025933 | Ga0207706_10398998 | Ga0207706_103989981 | 292 |
| 355 | 3300025944 | Ga0207661_10018071 | Ga0207661_100180713 | 292 |
| 356 | 3300025944 | Ga0207661_10167775 | Ga0207661_101677752 | 292 |
| 357 | 3300025986 | Ga0207658_10008834 | Ga0207658_100088347 | 292 |
| 358 | 3300026078 | Ga0207702_10015199 | Ga0207702_100151994 | 292 |
| 359 | 3300026088 | Ga0207641_10444384 | Ga0207641_104443842 | 292 |
| 360 | 3300026089 | Ga0207648_10104132 | Ga0207648_101041322 | 292 |
| 361 | 3300028381 | Ga0268264_10449350 | Ga0268264_104493502 | 292 |
| 362 | 3300031344 | Ga0265316_10009108 | Ga0265316_100091085 | 292 |
| 363 | 3300031665 | Ga0316575_10071080 | Ga0316575_100710802 | 292 |
| 364 | 3300031711 | Ga0265314_10027930 | Ga0265314_100279304 | 292 |
| 365 | 3300033180 | Ga0307510_10017468 | Ga0307510_100174685 | 292 |
| 366 | 3300039450 | Ga0436363_1626008 | Ga0436363_1626008_2705_3586 | 292 |
| 367 | 3300041407 | Ga0439447_003273 | Ga0439447_003273_2858_3739 | 292 |
| 368 | 3300042010 | Ga0439452_003762 | Ga0439452_003762_2675_3556 | 292 |
| 369 | 3300048905 | Ga0496102_0007448 | Ga0496102_0007448_7773_8654 | 292 |
| 370 | 3300048912 | Ga0496109_0099064 | Ga0496109_0099064_720_1610 | 292 |
| 371 | 3300048914 | Ga0496111_0392170 | Ga0496111_0392170_14_904 | 292 |
| 372 | 3300048919 | Ga0496116_0003497 | Ga0496116_0003497_6205_7089 | 292 |
| 373 | 3300048920 | Ga0496117_0075034 | Ga0496117_0075034_46_927 | 292 |
| 374 | 3300048922 | Ga0496119_0010270 | Ga0496119_0010270_6112_6996 | 292 |
| 375 | 3300048923 | Ga0496120_0000476 | Ga0496120_0000476_55771_56655 | 292 |
| 376 | 3300048924 | Ga0496121_0036886 | Ga0496121_0036886_319_1200 | 292 |
| 377 | 3300048927 | Ga0496124_0002597 | Ga0496124_0002597_8478_9362 | 292 |
| 378 | 3300048927 | Ga0496124_0025013 | Ga0496124_0025013_2103_2984 | 292 |
| 379 | 3300048927 | Ga0496124_0121588 | Ga0496124_0121588_47_928 | 292 |
| 380 | 3300049573 | Ga0501037_0044318 | Ga0501037_0044318_2330_3208 | 292 |
| 381 | 3300049588 | Ga0501072_0082089 | Ga0501072_0082089_1364_2266 | 292 |
| 382 | 3300049589 | Ga0501073_0023217 | Ga0501073_0023217_1657_2550 | 292 |
| 383 | 3300049744 | Ga0501083_0000809 | Ga0501083_0000809_2828_3721 | 292 |
| 384 | 3300054114 | Ga0501084_0247846 | Ga0501084_0247846_132_1034 | 292 |
| 385 | 3300060353 | Ga0501082_0012135 | Ga0501082_0012135_4467_5360 | 292 |
| 386 | 3300005458 | Ga0070681_10166655 | Ga0070681_101666553 | 293 |
| 387 | 3300006028 | Ga0070717_10213807 | Ga0070717_102138072 | 293 |
| 388 | 3300006844 | Ga0075428_100021700 | Ga0075428_1000217006 | 293 |
| 389 | 3300006846 | Ga0075430_100302949 | Ga0075430_1003029492 | 293 |
| 390 | 3300009094 | Ga0111539_10108770 | Ga0111539_101087702 | 293 |
| 391 | 3300009098 | Ga0105245_10167461 | Ga0105245_101674613 | 293 |
| 392 | 3300009176 | Ga0105242_10028835 | Ga0105242_100288355 | 293 |
| 393 | 3300009177 | Ga0105248_10166848 | Ga0105248_101668483 | 293 |
| 394 | 3300013307 | Ga0157372_10012098 | Ga0157372_100120982 | 293 |
| 395 | 3300013308 | Ga0157375_10092857 | Ga0157375_100928572 | 293 |
| 396 | 3300014325 | Ga0163163_10400809 | Ga0163163_104008092 | 293 |
| 397 | 3300037471 | Ga0395905_0285999 | Ga0395905_0285999_209_1090 | 293 |
| 398 | 3300042876 | Ga0451577_0000041 | Ga0451577_0000041_139845_140732 | 293 |
| 399 | 3300044673 | Ga0453683_0007367 | Ga0453683_0007367_131_1018 | 293 |
| 400 | 3300044712 | Ga0453684_0000066 | Ga0453684_0000066_301232_302119 | 293 |
| 401 | 3300045051 | Ga0451576_0017861 | Ga0451576_0017861_5091_5978 | 293 |
| 402 | 3300050508 | nmdc:mga09592_292920_c1 | nmdc:mga09592_292920_c1_408_1289 | 293 |
| 403 | 3300050509 | nmdc:mga0qj67_94559_c1 | nmdc:mga0qj67_94559_c1_1448_2329 | 293 |
| 404 | 3300050511 | nmdc:mga08y16_218354_c1 | nmdc:mga08y16_218354_c1_223_1104 | 293 |
| 405 | 3300005329 | Ga0070683_100017146 | Ga0070683_1000171464 | 294 |
| 406 | 3300005330 | Ga0070690_100002713 | Ga0070690_1000027132 | 294 |
| 407 | 3300005331 | Ga0070670_100020242 | Ga0070670_1000202424 | 294 |
| 408 | 3300005334 | Ga0068869_100001264 | Ga0068869_1000012648 | 294 |
| 409 | 3300005337 | Ga0070682_100004413 | Ga0070682_1000044135 | 294 |
| 410 | 3300005338 | Ga0068868_100007794 | Ga0068868_1000077944 | 294 |
| 411 | 3300005339 | Ga0070660_100015976 | Ga0070660_1000159762 | 294 |
| 412 | 3300005340 | Ga0070689_100033652 | Ga0070689_1000336524 | 294 |
| 413 | 3300005344 | Ga0070661_100007601 | Ga0070661_1000076015 | 294 |
| 414 | 3300005345 | Ga0070692_10014398 | Ga0070692_100143984 | 294 |
| 415 | 3300005353 | Ga0070669_100018690 | Ga0070669_1000186902 | 294 |
| 416 | 3300005354 | Ga0070675_100002517 | Ga0070675_1000025178 | 294 |
| 417 | 3300005364 | Ga0070673_100023513 | Ga0070673_1000235132 | 294 |
| 418 | 3300005366 | Ga0070659_100002538 | Ga0070659_1000025389 | 294 |
| 419 | 3300005455 | Ga0070663_100052839 | Ga0070663_1000528393 | 294 |
| 420 | 3300005457 | Ga0070662_100001389 | Ga0070662_1000013896 | 294 |
| 421 | 3300005457 | Ga0070662_100022123 | Ga0070662_1000221234 | 294 |
| 422 | 3300005458 | Ga0070681_10015591 | Ga0070681_100155915 | 294 |
| 423 | 3300005468 | Ga0070707_100513745 | Ga0070707_1005137451 | 294 |
| 424 | 3300005530 | Ga0070679_100001134 | Ga0070679_1000011345 | 294 |
| 425 | 3300005535 | Ga0070684_100005964 | Ga0070684_1000059648 | 294 |
| 426 | 3300005535 | Ga0070684_100021138 | Ga0070684_1000211384 | 294 |
| 427 | 3300005539 | Ga0068853_100025150 | Ga0068853_1000251502 | 294 |
| 428 | 3300005544 | Ga0070686_100093397 | Ga0070686_1000933972 | 294 |
| 429 | 3300005545 | Ga0070695_100036812 | Ga0070695_1000368122 | 294 |
| 430 | 3300005547 | Ga0070693_100003115 | Ga0070693_1000031154 | 294 |
| 431 | 3300005548 | Ga0070665_100157623 | Ga0070665_1001576232 | 294 |
| 432 | 3300005564 | Ga0070664_100020780 | Ga0070664_1000207803 | 294 |
| 433 | 3300005577 | Ga0068857_100004179 | Ga0068857_1000041798 | 294 |
| 434 | 3300005614 | Ga0068856_100004319 | Ga0068856_1000043199 | 294 |
| 435 | 3300005614 | Ga0068856_100157855 | Ga0068856_1001578552 | 294 |
| 436 | 3300005615 | Ga0070702_100000739 | Ga0070702_1000007393 | 294 |
| 437 | 3300005616 | Ga0068852_100022978 | Ga0068852_1000229785 | 294 |
| 438 | 3300005617 | Ga0068859_100011259 | Ga0068859_1000112595 | 294 |
| 439 | 3300005618 | Ga0068864_100007311 | Ga0068864_1000073117 | 294 |
| 440 | 3300005841 | Ga0068863_100002080 | Ga0068863_10000208021 | 294 |
| 441 | 3300005841 | Ga0068863_100278577 | Ga0068863_1002785772 | 294 |
| 442 | 3300005842 | Ga0068858_100007120 | Ga0068858_1000071209 | 294 |
| 443 | 3300005843 | Ga0068860_100010975 | Ga0068860_1000109754 | 294 |
| 444 | 3300006237 | Ga0097621_100023497 | Ga0097621_1000234974 | 294 |
| 445 | 3300006931 | Ga0097620_100011259 | Ga0097620_1000112595 | 294 |
| 446 | 3300009098 | Ga0105245_10001793 | Ga0105245_100017936 | 294 |
| 447 | 3300009098 | Ga0105245_10187615 | Ga0105245_101876152 | 294 |
| 448 | 3300009174 | Ga0105241_10008910 | Ga0105241_100089104 | 294 |
| 449 | 3300009176 | Ga0105242_10114501 | Ga0105242_101145013 | 294 |
| 450 | 3300009176 | Ga0105242_10299583 | Ga0105242_102995832 | 294 |
| 451 | 3300009177 | Ga0105248_10001949 | Ga0105248_1000194919 | 294 |
| 452 | 3300009551 | Ga0105238_10038984 | Ga0105238_100389844 | 294 |
| 453 | 3300009553 | Ga0105249_10083760 | Ga0105249_100837603 | 294 |
| 454 | 3300010375 | Ga0105239_10012089 | Ga0105239_100120896 | 294 |
| 455 | 3300013100 | Ga0157373_10003590 | Ga0157373_100035904 | 294 |
| 456 | 3300013102 | Ga0157371_10005635 | Ga0157371_100056354 | 294 |
| 457 | 3300013105 | Ga0157369_10202439 | Ga0157369_102024391 | 294 |
| 458 | 3300013296 | Ga0157374_10001347 | Ga0157374_1000134722 | 294 |
| 459 | 3300013296 | Ga0157374_10229849 | Ga0157374_102298492 | 294 |
| 460 | 3300013297 | Ga0157378_10033156 | Ga0157378_100331564 | 294 |
| 461 | 3300013307 | Ga0157372_10000973 | Ga0157372_1000097328 | 294 |
| 462 | 3300013308 | Ga0157375_10021465 | Ga0157375_100214656 | 294 |
| 463 | 3300014325 | Ga0163163_10036462 | Ga0163163_100364624 | 294 |
| 464 | 3300014325 | Ga0163163_10150925 | Ga0163163_101509253 | 294 |
| 465 | 3300025298 | Ga0209050_1045173 | Ga0209050_10451731 | 294 |
| 466 | 3300025315 | Ga0207697_10059972 | Ga0207697_100599722 | 294 |
| 467 | 3300025901 | Ga0207688_10089979 | Ga0207688_100899791 | 294 |
| 468 | 3300025906 | Ga0207699_10012681 | Ga0207699_100126813 | 294 |
| 469 | 3300025907 | Ga0207645_10054274 | Ga0207645_100542743 | 294 |
| 470 | 3300025911 | Ga0207654_10011431 | Ga0207654_100114313 | 294 |
| 471 | 3300025912 | Ga0207707_10003020 | Ga0207707_100030209 | 294 |
| 472 | 3300025919 | Ga0207657_10008501 | Ga0207657_100085015 | 294 |
| 473 | 3300025920 | Ga0207649_10002582 | Ga0207649_100025824 | 294 |
| 474 | 3300025921 | Ga0207652_10050525 | Ga0207652_100505253 | 294 |
| 475 | 3300025923 | Ga0207681_10048289 | Ga0207681_100482892 | 294 |
| 476 | 3300025925 | Ga0207650_10015501 | Ga0207650_100155014 | 294 |
| 477 | 3300025926 | Ga0207659_10003260 | Ga0207659_100032603 | 294 |
| 478 | 3300025927 | Ga0207687_10008601 | Ga0207687_100086013 | 294 |
| 479 | 3300025928 | Ga0207700_10053211 | Ga0207700_100532114 | 294 |
| 480 | 3300025932 | Ga0207690_10003637 | Ga0207690_100036377 | 294 |
| 481 | 3300025933 | Ga0207706_10006981 | Ga0207706_100069815 | 294 |
| 482 | 3300025936 | Ga0207670_10015909 | Ga0207670_100159094 | 294 |
| 483 | 3300025936 | Ga0207670_10110963 | Ga0207670_101109632 | 294 |
| 484 | 3300025941 | Ga0207711_10198250 | Ga0207711_101982503 | 294 |
| 485 | 3300025942 | Ga0207689_10006749 | Ga0207689_100067495 | 294 |
| 486 | 3300025944 | Ga0207661_10001091 | Ga0207661_1000109112 | 294 |
| 487 | 3300025945 | Ga0207679_10009547 | Ga0207679_100095475 | 294 |
| 488 | 3300025960 | Ga0207651_10016551 | Ga0207651_100165512 | 294 |
| 489 | 3300026023 | Ga0207677_10005731 | Ga0207677_100057315 | 294 |
| 490 | 3300026035 | Ga0207703_10028305 | Ga0207703_100283054 | 294 |
| 491 | 3300026035 | Ga0207703_10210794 | Ga0207703_102107942 | 294 |
| 492 | 3300026041 | Ga0207639_10026452 | Ga0207639_100264522 | 294 |
| 493 | 3300026067 | Ga0207678_10074025 | Ga0207678_100740253 | 294 |
| 494 | 3300026078 | Ga0207702_10009589 | Ga0207702_100095895 | 294 |
| 495 | 3300026078 | Ga0207702_10096694 | Ga0207702_100966942 | 294 |
| 496 | 3300026088 | Ga0207641_10003750 | Ga0207641_100037507 | 294 |
| 497 | 3300026095 | Ga0207676_10003252 | Ga0207676_100032527 | 294 |
| 498 | 3300026116 | Ga0207674_10001148 | Ga0207674_1000114834 | 294 |
| 499 | 3300028381 | Ga0268264_10024197 | Ga0268264_100241973 | 294 |
| 500 | 3300035086 | Ga0373934_0053581 | Ga0373934_0053581_290_1174 | 294 |
| 501 | 3300035111 | Ga0373923_0101566 | Ga0373923_0101566_237_1121 | 294 |
| 502 | 3300035172 | Ga0373955_0014369 | Ga0373955_0014369_235_1119 | 294 |
| 503 | 3300035172 | Ga0373955_0057627 | Ga0373955_0057627_68_952 | 294 |
| 504 | 3300035242 | Ga0373962_0043098 | Ga0373962_0043098_321_1205 | 294 |
| 505 | 3300035692 | Ga0373935_0108097 | Ga0373935_0108097_576_1460 | 294 |
| 506 | 3300035724 | Ga0373933_0315460 | Ga0373933_0315460_78_962 | 294 |
| 507 | 3300036401 | Ga0373937_0111000 | Ga0373937_0111000_412_1296 | 294 |
| 508 | 3300045051 | Ga0451576_0083175 | Ga0451576_0083175_320_1204 | 294 |
| 509 | 3300045976 | Ga0466967_0412241 | Ga0466967_0412241_324_1208 | 294 |
| 510 | 3300046459 | Ga0495629_0060216 | Ga0495629_0060216_744_1628 | 294 |
| 511 | 3300046459 | Ga0495629_0068291 | Ga0495629_0068291_404_1288 | 294 |
| 512 | 3300046472 | Ga0495580_0145717 | Ga0495580_0145717_480_1364 | 294 |
| 513 | 3300046499 | Ga0495594_0242043 | Ga0495594_0242043_103_987 | 294 |
| 514 | 3300046516 | Ga0495628_0019871 | Ga0495628_0019871_4605_5489 | 294 |
| 515 | 3300046517 | Ga0495630_0076272 | Ga0495630_0076272_782_1666 | 294 |
| 516 | 3300046531 | Ga0495665_0059580 | Ga0495665_0059580_484_1368 | 294 |
| 517 | 3300046536 | Ga0495587_0006235 | Ga0495587_0006235_325_1209 | 294 |
| 518 | 3300046536 | Ga0495587_0059100 | Ga0495587_0059100_911_1795 | 294 |
| 519 | 3300046543 | Ga0495645_0003877 | Ga0495645_0003877_6464_7348 | 294 |
| 520 | 3300046559 | Ga0495667_0165949 | Ga0495667_0165949_166_1050 | 294 |
| 521 | 3300046663 | Ga0495635_0039386 | Ga0495635_0039386_183_1067 | 294 |
| 522 | 3300046675 | Ga0495657_0251021 | Ga0495657_0251021_40_924 | 294 |
| 523 | 3300046678 | Ga0495599_0000961 | Ga0495599_0000961_5207_6091 | 294 |
| 524 | 3300046678 | Ga0495599_0021874 | Ga0495599_0021874_2753_3637 | 294 |
| 525 | 3300046679 | Ga0495623_0013898 | Ga0495623_0013898_287_1171 | 294 |
| 526 | 3300046809 | Ga0495600_0141369 | Ga0495600_0141369_70_954 | 294 |
| 527 | 3300047317 | Ga0495604_0045665 | Ga0495604_0045665_1794_2678 | 294 |
| 528 | 3300047319 | Ga0495674_0133679 | Ga0495674_0133679_123_1007 | 294 |
| 529 | 3300047322 | Ga0495680_0217098 | Ga0495680_0217098_314_1198 | 294 |
| 530 | 3300047471 | Ga0495684_0004932 | Ga0495684_0004932_381_1265 | 294 |
| 531 | 3300048908 | Ga0496105_0094154 | Ga0496105_0094154_1537_2421 | 294 |
| 532 | 3300048911 | Ga0496108_0041945 | Ga0496108_0041945_2504_3388 | 294 |
| 533 | 3300048915 | Ga0496112_0005603 | Ga0496112_0005603_9834_10718 | 294 |
| 534 | 3300048916 | Ga0496113_0033623 | Ga0496113_0033623_2159_3043 | 294 |
| 535 | 3300053085 | Ga0495619_0168060 | Ga0495619_0168060_46_930 | 294 |
| 536 | 3300006042 | Ga0075368_10000663 | Ga0075368_100006638 | 295 |
| 537 | 3300006048 | Ga0075363_100000245 | Ga0075363_10000024513 | 295 |
| 538 | 3300006051 | Ga0075364_10006458 | Ga0075364_100064581 | 295 |
| 539 | 3300006177 | Ga0075362_10007400 | Ga0075362_100074003 | 295 |
| 540 | 3300006195 | Ga0075366_10013774 | Ga0075366_100137743 | 295 |
| 541 | 3300013104 | Ga0157370_10105347 | Ga0157370_101053473 | 295 |
| 542 | 3300042876 | Ga0451577_0001488 | Ga0451577_0001488_10206_11147 | 295 |
| 543 | 3300025945 | Ga0207679_10394644 | Ga0207679_103946442 | 297 |
| 544 | 2162886012 | MBSR1b_contig_4539084 | MBSR1b_0395.00003400 | 299 |
| 545 | 3300005293 | Ga0065715_10121597 | Ga0065715_101215973 | 299 |
| 546 | 3300005328 | Ga0070676_10038217 | Ga0070676_100382171 | 299 |
| 547 | 3300005338 | Ga0068868_100226695 | Ga0068868_1002266951 | 299 |
| 548 | 3300005347 | Ga0070668_100137492 | Ga0070668_1001374922 | 299 |
| 549 | 3300005356 | Ga0070674_100067345 | Ga0070674_1000673452 | 299 |
| 550 | 3300005367 | Ga0070667_100153384 | Ga0070667_1001533842 | 299 |
| 551 | 3300005444 | Ga0070694_100088071 | Ga0070694_1000880712 | 299 |
| 552 | 3300005518 | Ga0070699_100011473 | Ga0070699_1000114734 | 299 |
| 553 | 3300005536 | Ga0070697_100001922 | Ga0070697_10000192213 | 299 |
| 554 | 3300005543 | Ga0070672_100106872 | Ga0070672_1001068722 | 299 |
| 555 | 3300005546 | Ga0070696_100001123 | Ga0070696_1000011233 | 299 |
| 556 | 3300006881 | Ga0068865_100101280 | Ga0068865_1001012802 | 299 |
| 557 | 3300009176 | Ga0105242_10003032 | Ga0105242_100030329 | 299 |
| 558 | 3300013308 | Ga0157375_10121711 | Ga0157375_101217112 | 299 |
| 559 | 3300025934 | Ga0207686_10023986 | Ga0207686_100239863 | 299 |
| 560 | 3300025940 | Ga0207691_10171941 | Ga0207691_101719412 | 299 |
| 561 | 3300026023 | Ga0207677_10244218 | Ga0207677_102442182 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6t38-assembly1.cif.gz_A | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9922 | 8 | 298 |
| 6tqg-assembly1.cif.gz_A | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9914 | 8 | 298 |
| 4b4b-assembly1.cif.gz_B-2 | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9908 | 7 | 298 |
| 5ftv-assembly2.cif.gz_C | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9908 | 7 | 298 |
| 1mp4-assembly1.cif.gz_A | w224h variant of s. enterica rmla | 0.9908 | 7 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b2xA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.989 | 7 | 298 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.958 | 7 | 244 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9126 | 7 | 244 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9022 | 9 | 230 | 3.90.550.10 |
| 5z0aE01 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8891 | 9 | 230 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3TEG1-F1-model_v4 | deleted | 1.003 | 21 | 133 |
|
| AF-A0A2V8EYQ2-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 1.002 | 9 | 153 |
GO:0008879
GO:0045226 |
| AF-A0A351VA12-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 1.002 | 9 | 119 |
GO:0008879
GO:0045226 |
| AF-A0A561DDF8-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 1.001 | 9 | 145 |
GO:0008879
GO:0045226 |
| AF-A0A434W677-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 1.001 | 9 | 151 |
GO:0008879
GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar