F463871
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 561 | 404 | 1122 | 398 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0020693|Ga0501033_0020693_3171_4517 |
| Length | 448 |
| Sequence | MFCAGRVDFRTNWFSIAASDRARAGAPSAEPYRSVPVFHRGSAMTSRLFGTALVLGLLSAVGPFAIDMYLPALPGIQRGLHTGVDAAQMSLMAFFAAIAVGQLVYGPVSDMLGRKPPIYFGLCLFAVASIGCALAPDIHTLIAARFVQGLGACAGMVVPRAIVRDMHTGTEATRLMALLMLVFSVSPILAPLTGSLVVRLSSWRGIFWVVAGAAVLGLALATFVLKETRTAAQRVESSVRSALAAYRTLLRDPSFLGLVFIGAFGISSFFAYLANSSFVLIEHYGLTPTQYSLAFSVNAVSFIGAAQFTGRLGERFGLRRVVRTAVAGYAATMLLLLALTAAGLDRLDLLMALLFVGYGFLGLVIPTTAVLALDRHGPVAGTASALMGTLQFVTGAAVIAVVGRFLDGTALPMVGGIAGCAVIAFLLARVTLRRDDEPTMDDVVVEQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 65 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 111 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 112 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 113 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 120 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 121 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 129 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 130 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 133 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 134 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 135 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 137 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 140 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 141 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 145 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 146 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 204 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 205 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 206 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 207 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 208 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 210 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 211 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 212 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 213 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 214 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 215 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 216 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 217 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 218 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 219 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 220 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 221 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 222 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 223 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 224 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 225 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 226 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 227 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 228 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 229 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 230 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 231 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 232 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 233 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 234 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 235 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 236 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 237 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 238 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 239 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 240 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 241 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 242 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 243 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 244 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 245 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 246 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 247 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 248 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 249 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 250 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 251 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 252 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 253 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 254 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 255 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 256 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 257 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 258 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 259 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 260 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 261 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 262 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 263 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 264 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 265 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 266 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 267 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 268 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 269 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 270 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 271 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 272 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 273 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 274 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 275 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 276 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 277 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 278 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 279 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 280 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 281 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 282 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 283 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 284 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 285 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 286 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 287 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 288 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 289 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 290 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 291 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 292 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 293 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 294 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 295 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 296 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 297 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 298 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 299 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 300 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 301 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 302 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 303 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 304 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 305 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 306 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 307 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 308 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 309 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 310 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 311 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 312 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 313 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 314 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 315 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 316 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 317 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 318 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 319 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 320 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 321 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 322 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 323 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 324 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 325 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 326 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 327 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 328 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 329 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 330 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 331 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 332 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 333 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 334 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 335 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 336 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 337 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 338 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 339 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 340 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 341 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 342 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 343 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 344 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 345 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 346 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 347 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 348 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 349 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 350 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 351 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 352 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 353 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 354 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 355 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 356 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 357 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 358 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 359 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 360 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 361 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 362 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 363 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 364 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 365 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 366 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 367 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 368 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 369 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 370 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 371 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 372 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 373 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 374 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 375 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 376 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 377 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 378 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 379 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 380 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 381 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 382 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 383 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 384 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 385 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 386 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 387 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 388 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 389 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 390 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 391 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 392 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 393 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 394 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 395 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 396 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 397 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 398 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 399 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 400 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 401 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 402 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 403 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 404 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 66.84 |
| Metatranscriptomes | 0.36 |
| Isolates | 32.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.89 |
| Nodule | 28.52 |
| Rhizoplane | 1.6 |
| Rhizosphere | 34.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501033_0020693 | 3300049570 | Bacteria | 4971 |
| 2 | JGI24740J21852_10000890 | 3300001979 | Bacteria | 13222 |
| 3 | JGI24739J22299_10004216 | 3300001989 | Bacteria | 5504 |
| 4 | JGI24737J22298_10026654 | 3300001990 | Bacteria | 1825 |
| 5 | JGI25155J39150_1000098 | 3300002704 | Bacteria | 48725 |
| 6 | JGI25156J39149_1000163 | 3300002705 | Bacteria | 48762 |
| 7 | JGI25154J39366_1000183 | 3300002738 | Bacteria | 48762 |
| 8 | JGI25154J39366_1001790 | 3300002738 | Bacteria | 6757 |
| 9 | JGI25157J39369_1000135 | 3300002741 | Bacteria | 61510 |
| 10 | JGI25157J39369_1000209 | 3300002741 | Bacteria | 48762 |
| 11 | JGI25150J39212_1008450 | 3300002774 | Bacteria | 2012 |
| 12 | JGI25159J45721_1000271 | 3300002987 | Bacteria | 24276 |
| 13 | JGI25151J46595_10000274 | 3300003187 | Bacteria | 59318 |
| 14 | JGI25153J46596_10000480 | 3300003215 | Bacteria | 25618 |
| 15 | JGI25153J46596_10001740 | 3300003215 | Bacteria | 12923 |
| 16 | rootH1_10040789 | 3300003316 | Bacteria | 5184 |
| 17 | rootH2_10015358 | 3300003320 | Bacteria | 34751 |
| 18 | rootH2_10130503 | 3300003320 | Bacteria | 1686 |
| 19 | rootL2_10123658 | 3300003322 | Bacteria | 2720 |
| 20 | rootH1_10005734 | 3300003323 | Bacteria | 12384 |
| 21 | JGI25160J50197_1000212 | 3300003354 | Bacteria | 47984 |
| 22 | JGI25160J50197_1000494 | 3300003354 | Bacteria | 23565 |
| 23 | JGI25161J50226_1000151 | 3300003374 | Bacteria | 47984 |
| 24 | JGI25161J50226_1005788 | 3300003374 | Bacteria | 2332 |
| 25 | Ga0006562J51391_1027984 | 3300003578 | Bacteria | 4700 |
| 26 | Ga0006562J51391_1027986 | 3300003578 | Bacteria | 4140 |
| 27 | Ga0055533_1000172 | 3300003756 | Bacteria | 58634 |
| 28 | Ga0055525_1001042 | 3300003759 | Bacteria | 7195 |
| 29 | Ga0055535_1000641 | 3300003761 | Bacteria | 27812 |
| 30 | Ga0055529_1000602 | 3300003763 | Bacteria | 27804 |
| 31 | Ga0055526_1001782 | 3300003771 | Bacteria | 14943 |
| 32 | Ga0055526_1002394 | 3300003771 | Bacteria | 12702 |
| 33 | Ga0055526_1005662 | 3300003771 | Bacteria | 7095 |
| 34 | Ga0055537_1011344 | 3300003773 | Bacteria | 1813 |
| 35 | Ga0055524_1000082 | 3300003775 | Bacteria | 119749 |
| 36 | Ga0055524_1005911 | 3300003775 | Bacteria | 5389 |
| 37 | Ga0055524_1011941 | 3300003775 | Bacteria | 3362 |
| 38 | Ga0055534_1001660 | 3300003784 | Bacteria | 8566 |
| 39 | Ga0055528_1000511 | 3300003790 | Bacteria | 30498 |
| 40 | Ga0055528_1002493 | 3300003790 | Bacteria | 9828 |
| 41 | Ga0055528_1003441 | 3300003790 | Bacteria | 7938 |
| 42 | Ga0055528_1020245 | 3300003790 | Bacteria | 2166 |
| 43 | Ga0055540_1000010 | 3300003792 | Bacteria | 290865 |
| 44 | Ga0055540_1004378 | 3300003792 | Bacteria | 6401 |
| 45 | Ga0055531_10001298 | 3300003794 | Bacteria | 18832 |
| 46 | Ga0055543_1000394 | 3300004625 | Bacteria | 27958 |
| 47 | Ga0055543_1001641 | 3300004625 | Bacteria | 8524 |
| 48 | Ga0065165_1010503 | 3300005262 | Bacteria | 3987 |
| 49 | Ga0065165_1014130 | 3300005262 | Bacteria | 3117 |
| 50 | Ga0065704_10134648 | 3300005289 | Bacteria | 1586 |
| 51 | Ga0070667_100000183 | 3300005367 | Bacteria | 75488 |
| 52 | Ga0070663_100000125 | 3300005455 | Bacteria | 36566 |
| 53 | Ga0070663_100043673 | 3300005455 | Bacteria | 3155 |
| 54 | Ga0070663_100184805 | 3300005455 | Bacteria | 1619 |
| 55 | Ga0070685_10001154 | 3300005466 | Bacteria | 14130 |
| 56 | Ga0068853_100405412 | 3300005539 | Bacteria | 1277 |
| 57 | Ga0068855_100015586 | 3300005563 | Bacteria | 9146 |
| 58 | Ga0068855_100029391 | 3300005563 | Bacteria | 6572 |
| 59 | Ga0068857_100002648 | 3300005577 | Bacteria | 14705 |
| 60 | Ga0068857_100051962 | 3300005577 | Bacteria | 3637 |
| 61 | Ga0068854_100001124 | 3300005578 | Bacteria | 16073 |
| 62 | Ga0068854_100007140 | 3300005578 | Bacteria | 7132 |
| 63 | Ga0068856_100000116 | 3300005614 | Bacteria | 79220 |
| 64 | Ga0068856_100004917 | 3300005614 | Bacteria | 13226 |
| 65 | Ga0068863_100069231 | 3300005841 | Bacteria | 3337 |
| 66 | Ga0068858_100037754 | 3300005842 | Bacteria | 4480 |
| 67 | Ga0068862_100198035 | 3300005844 | Bacteria | 1810 |
| 68 | Ga0075365_10015292 | 3300006038 | Bacteria | 4638 |
| 69 | Ga0075362_10006704 | 3300006177 | Bacteria | 4303 |
| 70 | Ga0075362_10064246 | 3300006177 | Bacteria | 1665 |
| 71 | Ga0075367_10035768 | 3300006178 | Bacteria | 2877 |
| 72 | Ga0075366_10018038 | 3300006195 | Bacteria | 4074 |
| 73 | Ga0075366_10104946 | 3300006195 | Bacteria | 1698 |
| 74 | Ga0079104_1000011 | 3300006946 | Bacteria | 359962 |
| 75 | Ga0079104_1005385 | 3300006946 | Bacteria | 5129 |
| 76 | Ga0105250_10011200 | 3300009092 | Bacteria | 3722 |
| 77 | Ga0105240_10000254 | 3300009093 | Bacteria | 106067 |
| 78 | Ga0105240_10000385 | 3300009093 | Bacteria | 82999 |
| 79 | Ga0105240_10000668 | 3300009093 | Bacteria | 62941 |
| 80 | Ga0105240_10002661 | 3300009093 | Bacteria | 28417 |
| 81 | Ga0105240_10009760 | 3300009093 | Bacteria | 13555 |
| 82 | Ga0105240_10088882 | 3300009093 | Bacteria | 3780 |
| 83 | Ga0105243_10001827 | 3300009148 | Bacteria | 18207 |
| 84 | Ga0105243_10057611 | 3300009148 | Bacteria | 3094 |
| 85 | Ga0105241_10129443 | 3300009174 | Bacteria | 2042 |
| 86 | Ga0105248_10000209 | 3300009177 | Bacteria | 67624 |
| 87 | Ga0105237_10000105 | 3300009545 | Bacteria | 118218 |
| 88 | Ga0105237_10000876 | 3300009545 | Bacteria | 40779 |
| 89 | Ga0105237_10058676 | 3300009545 | Bacteria | 3851 |
| 90 | Ga0105237_10073419 | 3300009545 | Bacteria | 3413 |
| 91 | Ga0105238_10002261 | 3300009551 | Bacteria | 19395 |
| 92 | Ga0105238_10052076 | 3300009551 | Bacteria | 4116 |
| 93 | Ga0105238_10079574 | 3300009551 | Bacteria | 3267 |
| 94 | Ga0105249_10000601 | 3300009553 | Bacteria | 32834 |
| 95 | Ga0105239_10000030 | 3300010375 | Bacteria | 233669 |
| 96 | Ga0105239_10144458 | 3300010375 | Bacteria | 2652 |
| 97 | Ga0157370_10162439 | 3300013104 | Bacteria | 2078 |
| 98 | Ga0157378_10048640 | 3300013297 | Bacteria | 3771 |
| 99 | Ga0182008_10024609 | 3300014497 | Bacteria | 3063 |
| 100 | Ga0182006_1000246 | 3300015261 | Bacteria | 50594 |
| 101 | Ga0182005_1004217 | 3300015265 | Bacteria | 4693 |
| 102 | Ga0213872_10005058 | 3300021361 | Bacteria | 6838 |
| 103 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 104 | Ga0209674_100088 | 3300025226 | Bacteria | 181554 |
| 105 | Ga0209563_100160 | 3300025230 | Bacteria | 58893 |
| 106 | Ga0207427_100296 | 3300025231 | Bacteria | 34920 |
| 107 | Ga0209258_100630 | 3300025242 | Bacteria | 27864 |
| 108 | Ga0209258_101241 | 3300025242 | Bacteria | 9822 |
| 109 | Ga0207425_1001861 | 3300025245 | Bacteria | 8113 |
| 110 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 111 | Ga0209646_1000214 | 3300025246 | Bacteria | 64093 |
| 112 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 113 | Ga0209026_1000059 | 3300025250 | Bacteria | 226652 |
| 114 | Ga0209026_1000111 | 3300025250 | Bacteria | 140599 |
| 115 | Ga0209026_1011177 | 3300025250 | Bacteria | 1631 |
| 116 | Ga0209677_100162 | 3300025253 | Bacteria | 58923 |
| 117 | Ga0209677_100226 | 3300025253 | Bacteria | 40136 |
| 118 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 119 | Ga0209759_1000365 | 3300025256 | Bacteria | 56836 |
| 120 | Ga0209759_1001640 | 3300025256 | Bacteria | 11816 |
| 121 | Ga0209759_1009710 | 3300025256 | Bacteria | 2886 |
| 122 | Ga0209129_1000514 | 3300025258 | Bacteria | 27663 |
| 123 | Ga0209565_1000036 | 3300025263 | Bacteria | 293334 |
| 124 | Ga0209455_1000211 | 3300025272 | Bacteria | 82660 |
| 125 | Ga0209455_1000508 | 3300025272 | Bacteria | 27836 |
| 126 | Ga0209455_1002009 | 3300025272 | Bacteria | 8341 |
| 127 | Ga0209673_1000023 | 3300025273 | Bacteria | 411385 |
| 128 | Ga0209673_1000212 | 3300025273 | Bacteria | 116031 |
| 129 | Ga0209673_1000282 | 3300025273 | Bacteria | 95013 |
| 130 | Ga0209673_1001489 | 3300025273 | Bacteria | 21798 |
| 131 | Ga0209673_1017380 | 3300025273 | Bacteria | 2652 |
| 132 | Ga0209130_1000042 | 3300025284 | Bacteria | 257581 |
| 133 | Ga0209130_1000151 | 3300025284 | Bacteria | 107021 |
| 134 | Ga0209675_1000751 | 3300025291 | Bacteria | 21867 |
| 135 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 136 | Ga0209676_1003880 | 3300025292 | Bacteria | 8720 |
| 137 | Ga0209025_1000300 | 3300025294 | Bacteria | 110956 |
| 138 | Ga0209025_1005150 | 3300025294 | Bacteria | 10829 |
| 139 | Ga0209025_1007501 | 3300025294 | Bacteria | 8106 |
| 140 | Ga0209025_1010080 | 3300025294 | Bacteria | 6464 |
| 141 | Ga0209025_1017601 | 3300025294 | Bacteria | 4111 |
| 142 | Ga0209564_1000112 | 3300025295 | Bacteria | 211939 |
| 143 | Ga0209564_1000402 | 3300025295 | Bacteria | 76964 |
| 144 | Ga0209564_1000729 | 3300025295 | Bacteria | 46947 |
| 145 | Ga0209564_1000903 | 3300025295 | Bacteria | 38881 |
| 146 | Ga0209758_1000053 | 3300025297 | Bacteria | 337751 |
| 147 | Ga0209758_1000276 | 3300025297 | Bacteria | 102362 |
| 148 | Ga0209758_1002527 | 3300025297 | Bacteria | 18490 |
| 149 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 150 | Ga0209050_1003577 | 3300025298 | Bacteria | 11308 |
| 151 | Ga0209050_1019396 | 3300025298 | Bacteria | 2584 |
| 152 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 153 | Ga0209256_1000485 | 3300025299 | Bacteria | 58920 |
| 154 | Ga0209256_1000678 | 3300025299 | Bacteria | 46016 |
| 155 | Ga0207426_1000035 | 3300025302 | Bacteria | 448327 |
| 156 | Ga0207426_1000097 | 3300025302 | Bacteria | 265930 |
| 157 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 158 | Ga0209051_1000119 | 3300025303 | Bacteria | 148746 |
| 159 | Ga0209051_1003793 | 3300025303 | Bacteria | 9680 |
| 160 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 161 | Ga0207647_10018554 | 3300025904 | Bacteria | 4701 |
| 162 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 163 | Ga0207695_10000408 | 3300025913 | Bacteria | 95748 |
| 164 | Ga0207695_10000517 | 3300025913 | Bacteria | 81791 |
| 165 | Ga0207695_10001526 | 3300025913 | Bacteria | 38277 |
| 166 | Ga0207695_10001623 | 3300025913 | Bacteria | 36467 |
| 167 | Ga0207695_10027940 | 3300025913 | Bacteria | 6270 |
| 168 | Ga0207695_10132564 | 3300025913 | Bacteria | 2448 |
| 169 | Ga0207671_10000031 | 3300025914 | Bacteria | 247030 |
| 170 | Ga0207671_10002583 | 3300025914 | Bacteria | 19130 |
| 171 | Ga0207671_10004557 | 3300025914 | Bacteria | 13165 |
| 172 | Ga0207671_10054116 | 3300025914 | Bacteria | 2974 |
| 173 | Ga0207657_10158558 | 3300025919 | Bacteria | 1839 |
| 174 | Ga0207657_10162860 | 3300025919 | Bacteria | 1811 |
| 175 | Ga0207694_10001589 | 3300025924 | Bacteria | 19223 |
| 176 | Ga0207694_10053688 | 3300025924 | Bacteria | 3125 |
| 177 | Ga0207686_10042748 | 3300025934 | Bacteria | 2772 |
| 178 | Ga0207709_10000074 | 3300025935 | Bacteria | 174947 |
| 179 | Ga0207711_10000720 | 3300025941 | Bacteria | 32591 |
| 180 | Ga0207667_10000082 | 3300025949 | Bacteria | 157749 |
| 181 | Ga0207667_10000806 | 3300025949 | Bacteria | 40715 |
| 182 | Ga0207667_10002183 | 3300025949 | Bacteria | 24557 |
| 183 | Ga0207667_10019766 | 3300025949 | Bacteria | 7508 |
| 184 | Ga0207712_10001934 | 3300025961 | Bacteria | 13617 |
| 185 | Ga0207668_10045273 | 3300025972 | Bacteria | 3000 |
| 186 | Ga0207640_10000018 | 3300025981 | Bacteria | 193664 |
| 187 | Ga0207640_10000579 | 3300025981 | Bacteria | 21817 |
| 188 | Ga0207640_10006220 | 3300025981 | Bacteria | 6540 |
| 189 | Ga0207658_10000056 | 3300025986 | Bacteria | 124846 |
| 190 | Ga0207703_10032449 | 3300026035 | Bacteria | 4134 |
| 191 | Ga0207639_10271618 | 3300026041 | Bacteria | 1487 |
| 192 | Ga0207678_10000590 | 3300026067 | Bacteria | 33196 |
| 193 | Ga0207678_10006028 | 3300026067 | Bacteria | 10782 |
| 194 | Ga0207678_10053822 | 3300026067 | Bacteria | 3467 |
| 195 | Ga0207678_10158486 | 3300026067 | Bacteria | 1933 |
| 196 | Ga0207708_10083830 | 3300026075 | Bacteria | 2451 |
| 197 | Ga0207702_10000170 | 3300026078 | Bacteria | 77504 |
| 198 | Ga0207702_10009865 | 3300026078 | Bacteria | 8004 |
| 199 | Ga0207676_10030246 | 3300026095 | Bacteria | 4063 |
| 200 | Ga0207674_10001067 | 3300026116 | Bacteria | 35659 |
| 201 | Ga0207674_10005021 | 3300026116 | Bacteria | 15803 |
| 202 | Ga0207674_10187773 | 3300026116 | Bacteria | 2017 |
| 203 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 204 | Ga0307517_10000122 | 3300028786 | Bacteria | 116429 |
| 205 | Ga0307515_10000571 | 3300028794 | Bacteria | 86938 |
| 206 | Ga0307515_10045626 | 3300028794 | Bacteria | 6726 |
| 207 | Ga0265324_10001806 | 3300029957 | Bacteria | 11625 |
| 208 | Ga0265325_10054682 | 3300031241 | Bacteria | 2043 |
| 209 | Ga0265316_10027715 | 3300031344 | Bacteria | 4684 |
| 210 | Ga0265316_10159686 | 3300031344 | Bacteria | 1686 |
| 211 | Ga0307513_10000011 | 3300031456 | Bacteria | 354929 |
| 212 | Ga0307513_10008208 | 3300031456 | Bacteria | 13394 |
| 213 | Ga0307513_10064864 | 3300031456 | Bacteria | 3845 |
| 214 | Ga0307513_10085269 | 3300031456 | Bacteria | 3242 |
| 215 | Ga0307408_100080719 | 3300031548 | Bacteria | 2430 |
| 216 | Ga0265313_10004214 | 3300031595 | Bacteria | 11149 |
| 217 | Ga0265313_10004285 | 3300031595 | Bacteria | 11046 |
| 218 | Ga0265313_10038203 | 3300031595 | Bacteria | 2393 |
| 219 | Ga0307508_10006278 | 3300031616 | Bacteria | 11192 |
| 220 | Ga0307514_10001114 | 3300031649 | Bacteria | 37486 |
| 221 | Ga0265314_10065768 | 3300031711 | Bacteria | 2448 |
| 222 | Ga0265342_10005326 | 3300031712 | Bacteria | 9848 |
| 223 | Ga0307406_10078324 | 3300031901 | Bacteria | 2189 |
| 224 | Ga0307412_10000272 | 3300031911 | Bacteria | 33000 |
| 225 | Ga0307409_100014189 | 3300031995 | Bacteria | 5167 |
| 226 | Ga0307416_100030722 | 3300032002 | Bacteria | 4034 |
| 227 | Ga0307415_100058441 | 3300032126 | Bacteria | 2655 |
| 228 | Ga0395900_0149930 | 3300037418 | Bacteria | 2383 |
| 229 | Ga0395898_0036497 | 3300037466 | Bacteria | 4880 |
| 230 | Ga0395905_0029715 | 3300037471 | Bacteria | 5151 |
| 231 | Ga0395901_0010225 | 3300038443 | Bacteria | 9505 |
| 232 | Ga0436361_1143890 | 3300039447 | Bacteria | 13239 |
| 233 | Ga0439436_0000001 | 3300041404 | Bacteria | 299341 |
| 234 | Ga0439465_0000698 | 3300041413 | Bacteria | 10311 |
| 235 | Ga0451791_0110928 | 3300041451 | Bacteria | 1260 |
| 236 | Ga0451833_0091336 | 3300041491 | Bacteria | 2791 |
| 237 | Ga0451851_0374511 | 3300041507 | Bacteria | 2769 |
| 238 | Ga0451853_1630839 | 3300041512 | Bacteria | 1361 |
| 239 | Ga0439449_0020632 | 3300042007 | Bacteria | 2468 |
| 240 | Ga0466972_0030229 | 3300044658 | Bacteria | 2667 |
| 241 | Ga0466982_0000004 | 3300044672 | Bacteria | 386724 |
| 242 | Ga0466966_0059241 | 3300044684 | Bacteria | 2418 |
| 243 | Ga0466961_0057164 | 3300044693 | Bacteria | 2484 |
| 244 | Ga0466971_0001157 | 3300044719 | Bacteria | 10969 |
| 245 | Ga0466968_0010068 | 3300044735 | Bacteria | 3654 |
| 246 | Ga0466968_0024702 | 3300044735 | Bacteria | 2457 |
| 247 | Ga0466960_0031417 | 3300044901 | Bacteria | 2450 |
| 248 | Ga0495638_0000142 | 3300046460 | Bacteria | 113893 |
| 249 | Ga0495650_0005279 | 3300046471 | Bacteria | 8459 |
| 250 | Ga0495605_0005281 | 3300046474 | Bacteria | 7539 |
| 251 | Ga0495605_0099187 | 3300046474 | Bacteria | 1341 |
| 252 | Ga0495639_0073105 | 3300046475 | Bacteria | 1587 |
| 253 | Ga0495585_0093176 | 3300046492 | Bacteria | 1620 |
| 254 | Ga0495607_0030443 | 3300046501 | Bacteria | 3314 |
| 255 | Ga0495583_0021267 | 3300046506 | Bacteria | 3342 |
| 256 | Ga0495606_0003502 | 3300046507 | Bacteria | 16624 |
| 257 | Ga0495606_0022855 | 3300046507 | Bacteria | 4543 |
| 258 | Ga0495606_0050836 | 3300046507 | Bacteria | 2708 |
| 259 | Ga0495610_0000954 | 3300046512 | Bacteria | 26782 |
| 260 | Ga0495610_0041276 | 3300046512 | Bacteria | 2317 |
| 261 | Ga0495616_0024549 | 3300046513 | Bacteria | 3232 |
| 262 | Ga0495620_0032748 | 3300046515 | Bacteria | 2365 |
| 263 | Ga0495632_0087833 | 3300046519 | Bacteria | 1477 |
| 264 | Ga0495654_0000884 | 3300046530 | Bacteria | 22400 |
| 265 | Ga0495597_0016301 | 3300046542 | Bacteria | 3509 |
| 266 | Ga0495633_0002721 | 3300046558 | Bacteria | 12257 |
| 267 | Ga0495668_0006798 | 3300046616 | Bacteria | 7433 |
| 268 | Ga0495611_0012918 | 3300046648 | Bacteria | 3550 |
| 269 | Ga0495625_0002570 | 3300046660 | Bacteria | 19495 |
| 270 | Ga0495625_0080350 | 3300046660 | Bacteria | 2271 |
| 271 | Ga0495588_0085718 | 3300046674 | Bacteria | 1647 |
| 272 | Ga0495670_0000608 | 3300046691 | Bacteria | 17106 |
| 273 | Ga0495670_0024794 | 3300046691 | Bacteria | 2965 |
| 274 | Ga0495672_0018013 | 3300047320 | Bacteria | 4703 |
| 275 | Ga0495686_0000574 | 3300047472 | Bacteria | 52228 |
| 276 | Ga0495686_0009589 | 3300047472 | Bacteria | 6959 |
| 277 | Ga0495686_0018052 | 3300047472 | Bacteria | 4741 |
| 278 | Ga0496100_0032387 | 3300048903 | Bacteria | 3260 |
| 279 | Ga0496101_0123307 | 3300048904 | Bacteria | 1961 |
| 280 | Ga0496102_0002413 | 3300048905 | Bacteria | 15959 |
| 281 | Ga0496104_0315878 | 3300048907 | Bacteria | 1475 |
| 282 | Ga0496105_0013981 | 3300048908 | Bacteria | 6384 |
| 283 | Ga0496107_0177627 | 3300048910 | Bacteria | 1581 |
| 284 | Ga0496110_0224964 | 3300048913 | Bacteria | 1706 |
| 285 | Ga0496115_0027081 | 3300048918 | Bacteria | 4480 |
| 286 | Ga0496116_0144149 | 3300048919 | Bacteria | 1334 |
| 287 | Ga0496117_0002926 | 3300048920 | Bacteria | 20663 |
| 288 | Ga0496117_0052428 | 3300048920 | Bacteria | 2873 |
| 289 | Ga0496117_0068555 | 3300048920 | Bacteria | 2394 |
| 290 | Ga0496118_0000366 | 3300048921 | Bacteria | 76070 |
| 291 | Ga0496118_0000678 | 3300048921 | Bacteria | 55390 |
| 292 | Ga0496118_0001987 | 3300048921 | Bacteria | 29053 |
| 293 | Ga0496118_0009608 | 3300048921 | Bacteria | 9736 |
| 294 | Ga0496118_0059351 | 3300048921 | Bacteria | 2849 |
| 295 | Ga0496119_0000382 | 3300048922 | Bacteria | 60994 |
| 296 | Ga0496119_0009132 | 3300048922 | Bacteria | 8579 |
| 297 | Ga0496119_0011994 | 3300048922 | Bacteria | 7095 |
| 298 | Ga0496120_0000335 | 3300048923 | Bacteria | 78595 |
| 299 | Ga0496120_0000343 | 3300048923 | Bacteria | 76966 |
| 300 | Ga0496121_0000369 | 3300048924 | Bacteria | 92541 |
| 301 | Ga0496121_0005991 | 3300048924 | Bacteria | 15357 |
| 302 | Ga0496121_0083278 | 3300048924 | Bacteria | 2525 |
| 303 | Ga0496121_0129801 | 3300048924 | Bacteria | 1888 |
| 304 | Ga0496121_0156546 | 3300048924 | Bacteria | 1671 |
| 305 | Ga0496121_0179021 | 3300048924 | Bacteria | 1532 |
| 306 | Ga0496122_0000642 | 3300048925 | Bacteria | 70999 |
| 307 | Ga0496122_0025252 | 3300048925 | Bacteria | 5166 |
| 308 | Ga0496122_0027219 | 3300048925 | Bacteria | 4895 |
| 309 | Ga0496123_0000464 | 3300048926 | Bacteria | 70999 |
| 310 | Ga0496123_0050775 | 3300048926 | Bacteria | 2768 |
| 311 | Ga0496123_0128665 | 3300048926 | Bacteria | 1408 |
| 312 | Ga0496124_0000086 | 3300048927 | Bacteria | 202844 |
| 313 | Ga0496124_0013655 | 3300048927 | Bacteria | 7916 |
| 314 | Ga0496125_0000455 | 3300048928 | Bacteria | 73934 |
| 315 | Ga0496125_0000729 | 3300048928 | Bacteria | 54486 |
| 316 | Ga0496125_0014131 | 3300048928 | Bacteria | 7790 |
| 317 | Ga0496125_0018025 | 3300048928 | Bacteria | 6712 |
| 318 | Ga0496125_0165782 | 3300048928 | Bacteria | 1493 |
| 319 | Ga0496126_0000757 | 3300048929 | Bacteria | 58502 |
| 320 | Ga0496126_0013879 | 3300048929 | Bacteria | 8172 |
| 321 | Ga0496126_0032821 | 3300048929 | Bacteria | 4887 |
| 322 | Ga0496126_0088302 | 3300048929 | Bacteria | 2731 |
| 323 | Ga0496126_0169634 | 3300048929 | Bacteria | 1860 |
| 324 | Ga0501031_0009984 | 3300049568 | Bacteria | 6184 |
| 325 | Ga0501032_0064622 | 3300049569 | Bacteria | 2449 |
| 326 | Ga0501032_0113515 | 3300049569 | Bacteria | 1792 |
| 327 | Ga0501033_0071948 | 3300049570 | Bacteria | 2540 |
| 328 | Ga0501033_0078938 | 3300049570 | Bacteria | 2415 |
| 329 | Ga0501033_0140504 | 3300049570 | Bacteria | 1746 |
| 330 | Ga0501034_0145013 | 3300049571 | Bacteria | 2352 |
| 331 | Ga0501034_0174749 | 3300049571 | Bacteria | 2114 |
| 332 | Ga0501034_0185493 | 3300049571 | Bacteria | 2044 |
| 333 | Ga0501034_0227063 | 3300049571 | Bacteria | 1817 |
| 334 | Ga0501036_0106940 | 3300049572 | Bacteria | 2366 |
| 335 | Ga0501036_0143264 | 3300049572 | Bacteria | 2016 |
| 336 | Ga0501036_0306545 | 3300049572 | Bacteria | 1328 |
| 337 | Ga0501037_0148626 | 3300049573 | Bacteria | 1675 |
| 338 | Ga0501038_0027405 | 3300049574 | Bacteria | 5069 |
| 339 | Ga0501038_0044931 | 3300049574 | Bacteria | 3836 |
| 340 | Ga0501038_0199298 | 3300049574 | Bacteria | 1607 |
| 341 | Ga0501043_0173822 | 3300049579 | Bacteria | 1680 |
| 342 | Ga0501046_0108994 | 3300049580 | Bacteria | 2117 |
| 343 | Ga0501046_0122589 | 3300049580 | Bacteria | 1977 |
| 344 | Ga0501047_0070772 | 3300049581 | Bacteria | 3358 |
| 345 | Ga0501047_0116416 | 3300049581 | Bacteria | 2554 |
| 346 | Ga0501048_0107161 | 3300049582 | Bacteria | 1973 |
| 347 | Ga0501070_0092275 | 3300049586 | Bacteria | 2506 |
| 348 | Ga0501073_0061521 | 3300049589 | Bacteria | 2620 |
| 349 | Ga0501073_0199236 | 3300049589 | Bacteria | 1385 |
| 350 | Ga0501080_0059651 | 3300049742 | Bacteria | 3550 |
| 351 | Ga0501080_0301794 | 3300049742 | Bacteria | 1452 |
| 352 | Ga0501083_0087522 | 3300049744 | Bacteria | 2060 |
| 353 | Ga0501044_0031662 | 3300049823 | Bacteria | 5565 |
| 354 | Ga0501044_0052644 | 3300049823 | Bacteria | 4193 |
| 355 | Ga0501044_0135732 | 3300049823 | Bacteria | 2451 |
| 356 | Ga0501044_0209620 | 3300049823 | Bacteria | 1903 |
| 357 | nmdc:mga0k408_91003_c1 | 3300050493 | Bacteria | 1792 |
| 358 | nmdc:mga07m45_32622_c1 | 3300050496 | Bacteria | 2888 |
| 359 | Ga0500610_0018254 | 3300053079 | Bacteria | 3387 |
| 360 | Ga0500578_0167275 | 3300053086 | Bacteria | 1361 |
| 361 | Ga0500643_008875 | 3300053087 | Bacteria | 3900 |
| 362 | Ga0500644_0002764 | 3300053088 | Bacteria | 4374 |
| 363 | Ga0500650_0043679 | 3300053098 | Bacteria | 2074 |
| 364 | Ga0500557_000707 | 3300053105 | Bacteria | 4701 |
| 365 | Ga0500593_000131 | 3300053117 | Bacteria | 29789 |
| 366 | Ga0500594_0000642 | 3300053118 | Bacteria | 7452 |
| 367 | Ga0500597_000256 | 3300053120 | Bacteria | 10905 |
| 368 | Ga0500618_019307 | 3300053125 | Bacteria | 1678 |
| 369 | Ga0500658_0000491 | 3300053134 | Bacteria | 16931 |
| 370 | Ga0500559_0010847 | 3300053136 | Bacteria | 3906 |
| 371 | Ga0500568_0000291 | 3300053139 | Bacteria | 41336 |
| 372 | Ga0500573_0019696 | 3300053140 | Bacteria | 3861 |
| 373 | Ga0500616_0003188 | 3300053153 | Bacteria | 12767 |
| 374 | Ga0500619_000415 | 3300053154 | Bacteria | 7709 |
| 375 | Ga0500645_000397 | 3300053730 | Bacteria | 30509 |
| 376 | Ga0500645_000644 | 3300053730 | Bacteria | 22175 |
| 377 | Ga0500645_009597 | 3300053730 | Bacteria | 3243 |
| 378 | 2509077036 | 2508501114 | Bacteria | 7082538 |
| 379 | 2509385798 | 2509276021 | Bacteria | 7634384 |
| 380 | 2509448148 | 2509276033 | Bacteria | 7180565 |
| 381 | 2510899953 | 2510461076 | Bacteria | 8618824 |
| 382 | 2510900549 | 2510461076 | Bacteria | 8618824 |
| 383 | 2511247211 | 2511231002 | Bacteria | 5042903 |
| 384 | 2513569806 | 2513237084 | Bacteria | 7231967 |
| 385 | 2513576661 | 2513237085 | Bacteria | 7695351 |
| 386 | 2513631657 | 2513237093 | Bacteria | 7545552 |
| 387 | 2513710073 | 2513237103 | Bacteria | 7647401 |
| 388 | 2513910044 | 2513237144 | Bacteria | 7530820 |
| 389 | 2513928778 | 2513237146 | Bacteria | 7166346 |
| 390 | 2514021412 | 2513237162 | Bacteria | 7468464 |
| 391 | 2515115357 | 2515075009 | Bacteria | 7288508 |
| 392 | 2515636086 | 2515154113 | Bacteria | 7807172 |
| 393 | 2515644758 | 2515154114 | Bacteria | 7848616 |
| 394 | 2515658057 | 2515154116 | Bacteria | 7552979 |
| 395 | 2515742220 | 2515154134 | Bacteria | 7220242 |
| 396 | 2517041647 | 2516653077 | Bacteria | 7555578 |
| 397 | 2517080772 | 2516653085 | Bacteria | 7346596 |
| 398 | 2517099100 | 2517093000 | Bacteria | 7412387 |
| 399 | 2517410673 | 2517287029 | Bacteria | 6905599 |
| 400 | 2520377354 | 2519899620 | Bacteria | 6499161 |
| 401 | 2530644865 | 2529292951 | Bacteria | 6916614 |
| 402 | 2585228094 | 2582581299 | Bacteria | 6518058 |
| 403 | 2585524454 | 2585427526 | Bacteria | 7258840 |
| 404 | 2585539055 | 2585427528 | Bacteria | 6842387 |
| 405 | 2585837005 | 2585427593 | Bacteria | 7141551 |
| 406 | 2599415012 | 2599185170 | Bacteria | 7295545 |
| 407 | 2616295049 | 2615840624 | Bacteria | 6557588 |
| 408 | 2644191702 | 2643221634 | Bacteria | 6705461 |
| 409 | 2644287738 | 2643221651 | Bacteria | 4798932 |
| 410 | 2719183520 | 2718217882 | Bacteria | 6556348 |
| 411 | 2719388264 | 2718217927 | Bacteria | 6972593 |
| 412 | 2719667884 | 2718217997 | Bacteria | 6740740 |
| 413 | 2719727961 | 2718218009 | Bacteria | 6478651 |
| 414 | 2720494647 | 2718218199 | Bacteria | 6740745 |
| 415 | 2720610982 | 2718218232 | Bacteria | 6720332 |
| 416 | 2720616150 | 2718218233 | Bacteria | 6662049 |
| 417 | 2720629231 | 2718218235 | Bacteria | 6630699 |
| 418 | 2720771803 | 2718218269 | Bacteria | 6906114 |
| 419 | 2721144822 | 2718218363 | Bacteria | 6524337 |
| 420 | 2721155561 | 2718218365 | Bacteria | 6274507 |
| 421 | 2721166909 | 2718218366 | Bacteria | 6425255 |
| 422 | 2721402887 | 2718218423 | Bacteria | 6438183 |
| 423 | 2722837887 | 2721755514 | Bacteria | 6424414 |
| 424 | 2722884051 | 2721755523 | Bacteria | 6430384 |
| 425 | 2723562840 | 2721755684 | Bacteria | 6859907 |
| 426 | 2723570830 | 2721755685 | Bacteria | 6704835 |
| 427 | 2724035244 | 2721755809 | Bacteria | 6438790 |
| 428 | 2724042155 | 2721755810 | Bacteria | 6479005 |
| 429 | 2724086623 | 2721755819 | Bacteria | 6906405 |
| 430 | 2724106781 | 2721755822 | Bacteria | 6726041 |
| 431 | 2725945633 | 2724679232 | Bacteria | 7646494 |
| 432 | 2730161660 | 2728369365 | Bacteria | 6555560 |
| 433 | 2730300668 | 2728369397 | Bacteria | 6274511 |
| 434 | 2739033513 | 2738541333 | Bacteria | 7106503 |
| 435 | 2766068650 | 2765235942 | Bacteria | 7445910 |
| 436 | 2774868402 | 2773857925 | Bacteria | 6472445 |
| 437 | 2776262598 | 2775506901 | Bacteria | 9631051 |
| 438 | 2793314859 | 2791355259 | Bacteria | 7254731 |
| 439 | 2793321516 | 2791355260 | Bacteria | 6598818 |
| 440 | 2793325887 | 2791355261 | Bacteria | 6661293 |
| 441 | 2793340313 | 2791355263 | Bacteria | 6872478 |
| 442 | 2793345994 | 2791355264 | Bacteria | 6429314 |
| 443 | 2793355214 | 2791355265 | Bacteria | 6539969 |
| 444 | 2793357964 | 2791355266 | Bacteria | 7116587 |
| 445 | 2793366725 | 2791355267 | Bacteria | 7222458 |
| 446 | 2805927895 | 2802429605 | Bacteria | 6875453 |
| 447 | 2805933742 | 2802429606 | Bacteria | 6346811 |
| 448 | 2806044992 | 2802429633 | Bacteria | 7341974 |
| 449 | 2806053851 | 2802429634 | Bacteria | 7083200 |
| 450 | 2806060057 | 2802429635 | Bacteria | 7650140 |
| 451 | 2806065889 | 2802429636 | Bacteria | 7597525 |
| 452 | 2806075417 | 2802429637 | Bacteria | 7067217 |
| 453 | 2835313064 | 2835312727 | Bacteria | 7413381 |
| 454 | 2838019300 | 2838016132 | Bacteria | 6577831 |
| 455 | 2838026635 | 2838022645 | Bacteria | 6494267 |
| 456 | 2838039262 | 2838035591 | Bacteria | 7166484 |
| 457 | 2838050365 | 2838048938 | Bacteria | 6044578 |
| 458 | 2838063069 | 2838061910 | Bacteria | 6794874 |
| 459 | 2838071634 | 2838068647 | Bacteria | 6208656 |
| 460 | 2838667628 | 2838661181 | Bacteria | 7385261 |
| 461 | 2838673700 | 2838668709 | Bacteria | 6671819 |
| 462 | 2838684222 | 2838680041 | Bacteria | 6545511 |
| 463 | 2838692259 | 2838686498 | Bacteria | 7807632 |
| 464 | 2838699712 | 2838694306 | Bacteria | 6853137 |
| 465 | 2838705267 | 2838701080 | Bacteria | 6669771 |
| 466 | 2838712002 | 2838707686 | Bacteria | 6619912 |
| 467 | 2838734322 | 2838729681 | Bacteria | 7400765 |
| 468 | 2838746774 | 2838742623 | Bacteria | 7396178 |
| 469 | 2841853465 | 2841851746 | Bacteria | 7532261 |
| 470 | 2841869154 | 2841864319 | Bacteria | 6742987 |
| 471 | 2842081688 | 2842077413 | Bacteria | 6508645 |
| 472 | 2842114616 | 2842110456 | Bacteria | 7656360 |
| 473 | 2842122264 | 2842118031 | Bacteria | 7033875 |
| 474 | 2842150243 | 2842146304 | Bacteria | 5957337 |
| 475 | 2842161450 | 2842156927 | Bacteria | 6894975 |
| 476 | 2842167346 | 2842163707 | Bacteria | 6916235 |
| 477 | 2842185749 | 2842180545 | Bacteria | 6888678 |
| 478 | 2842195486 | 2842192696 | Bacteria | 6147454 |
| 479 | 2842202238 | 2842198810 | Bacteria | 6608673 |
| 480 | 2842210523 | 2842205361 | Bacteria | 6340321 |
| 481 | 2842223103 | 2842217011 | Bacteria | 7497767 |
| 482 | 2842234080 | 2842229732 | Bacteria | 7475766 |
| 483 | 2842241414 | 2842237096 | Bacteria | 6620661 |
| 484 | 2842246381 | 2842243621 | Bacteria | 7421798 |
| 485 | 2842254929 | 2842250916 | Bacteria | 6579627 |
| 486 | 2842260759 | 2842257432 | Bacteria | 7401195 |
| 487 | 2842269344 | 2842264693 | Bacteria | 6472963 |
| 488 | 2842276048 | 2842271015 | Bacteria | 7807131 |
| 489 | 2842283977 | 2842278818 | Bacteria | 6340002 |
| 490 | 2842289857 | 2842285085 | Bacteria | 6011953 |
| 491 | 2842295344 | 2842291075 | Bacteria | 7076806 |
| 492 | 2842308633 | 2842304105 | Bacteria | 7023636 |
| 493 | 2842311964 | 2842311132 | Bacteria | 6616990 |
| 494 | 2842319248 | 2842317721 | Bacteria | 6793725 |
| 495 | 2842344304 | 2842341865 | Bacteria | 7003929 |
| 496 | 2842368210 | 2842363717 | Bacteria | 6844742 |
| 497 | 2842375887 | 2842370503 | Bacteria | 7038661 |
| 498 | 2842381881 | 2842377471 | Bacteria | 7140707 |
| 499 | 2842388813 | 2842384541 | Bacteria | 7057858 |
| 500 | 2842396698 | 2842395702 | Bacteria | 6780583 |
| 501 | 2842407003 | 2842402390 | Bacteria | 6681310 |
| 502 | 2842413895 | 2842409023 | Bacteria | 6687331 |
| 503 | 2842420537 | 2842415677 | Bacteria | 6596907 |
| 504 | 2842425267 | 2842422224 | Bacteria | 6239196 |
| 505 | 2842432699 | 2842428310 | Bacteria | 6767288 |
| 506 | 2842438853 | 2842434925 | Bacteria | 6502746 |
| 507 | 2842445483 | 2842441272 | Bacteria | 6769273 |
| 508 | 2842449937 | 2842447887 | Bacteria | 6754142 |
| 509 | 2842467728 | 2842462802 | Bacteria | 6588055 |
| 510 | 2842473468 | 2842469257 | Bacteria | 6752936 |
| 511 | 2842491694 | 2842489311 | Bacteria | 6620893 |
| 512 | 2842502086 | 2842495871 | Bacteria | 6820686 |
| 513 | 2842919290 | 2842918807 | Bacteria | 4289178 |
| 514 | 2844460812 | 2844454524 | Bacteria | 7952546 |
| 515 | 2857519487 | 2857516855 | Bacteria | 7787325 |
| 516 | 2882459194 | 2882456835 | Bacteria | 6863978 |
| 517 | 2884298741 | 2884298095 | Bacteria | 3823049 |
| 518 | 2894024592 | 2894023352 | Bacteria | 5167372 |
| 519 | 2894234866 | 2894232714 | Bacteria | 8834183 |
| 520 | 2932422603 | 2932422444 | Bacteria | 4678430 |
| 521 | 2933017121 | 2933016740 | Bacteria | 6355406 |
| 522 | 2933575236 | 2933570622 | Bacteria | 7023390 |
| 523 | 2933590528 | 2933586486 | Bacteria | 7667493 |
| 524 | 2933602433 | 2933599457 | Bacteria | 5858799 |
| 525 | 2935898437 | 2935894831 | Bacteria | 6620579 |
| 526 | 2935906870 | 2935901341 | Bacteria | 7341747 |
| 527 | 2936370462 | 2936367885 | Bacteria | 7324495 |
| 528 | 2936378127 | 2936375103 | Bacteria | 6652732 |
| 529 | 2936385455 | 2936381700 | Bacteria | 7006523 |
| 530 | 2939633451 | 2939631187 | Bacteria | 6118131 |
| 531 | 2953998262 | 2953994433 | Bacteria | 4303959 |
| 532 | 2996896730 | 2996893221 | Bacteria | 5823108 |
| 533 | 3005413649 | 3005409236 | Bacteria | 7188837 |
| 534 | 639651366 | 639633055 | Bacteria | 7751309 |
| 535 | 8005276979 | 8005275841 | Bacteria | 6929066 |
| 536 | 8005288006 | 8005282627 | Bacteria | 6675747 |
| 537 | 8005289444 | 8005289223 | Bacteria | 6634003 |
| 538 | 8005305225 | 8005301065 | Bacteria | 6614431 |
| 539 | 8005313327 | 8005307578 | Bacteria | 7395396 |
| 540 | 8005382136 | 8005376324 | Bacteria | 6590079 |
| 541 | 8005388616 | 8005382845 | Bacteria | 6732062 |
| 542 | 8005398022 | 8005395548 | Bacteria | 6806915 |
| 543 | 8005431297 | 8005430974 | Bacteria | 6689030 |
| 544 | 8005466582 | 8005460587 | Bacteria | 7157962 |
| 545 | 8005503294 | 8005497431 | Bacteria | 6477605 |
| 546 | 8005561960 | 8005556819 | Bacteria | 6908598 |
| 547 | 8005567300 | 8005563573 | Bacteria | 7153261 |
| 548 | 8005625435 | 8005619151 | Bacteria | 7030230 |
| 549 | 8005630417 | 8005626139 | Bacteria | 6534237 |
| 550 | 8005674812 | 8005668836 | Bacteria | 6953162 |
| 551 | 8005689247 | 8005688590 | Bacteria | 6610080 |
| 552 | 8005696885 | 8005695170 | Bacteria | 6912330 |
| 553 | 8018127758 | 8018127388 | Bacteria | 7351159 |
| 554 | 8018166188 | 8018163183 | Bacteria | 7277977 |
| 555 | 8018182916 | 8018176218 | Bacteria | 6896178 |
| 556 | 8023688353 | 8023680758 | Bacteria | 7729763 |
| 557 | 8024483988 | 8024479707 | Bacteria | 6954785 |
| 558 | 8024503978 | 8024501048 | Bacteria | 6427847 |
| 559 | 8056375347 | 8056375014 | Bacteria | 7006639 |
| 560 | 8056383124 | 8056382006 | Bacteria | 6408074 |
| 561 | 8057880807 | 8057874678 | Bacteria | 7494653 |
| 562 | Ga0501033_0020693 | |||
| 563 | JGI24740J21852_10000890 | |||
| 564 | JGI24739J22299_10004216 | |||
| 565 | JGI24737J22298_10026654 | |||
| 566 | JGI25155J39150_1000098 | |||
| 567 | JGI25156J39149_1000163 | |||
| 568 | JGI25154J39366_1000183 | |||
| 569 | JGI25154J39366_1001790 | |||
| 570 | JGI25157J39369_1000135 | |||
| 571 | JGI25157J39369_1000209 | |||
| 572 | JGI25150J39212_1008450 | |||
| 573 | JGI25159J45721_1000271 | |||
| 574 | JGI25151J46595_10000274 | |||
| 575 | JGI25153J46596_10000480 | |||
| 576 | JGI25153J46596_10001740 | |||
| 577 | rootH1_10040789 | |||
| 578 | rootH2_10015358 | |||
| 579 | rootH2_10130503 | |||
| 580 | rootL2_10123658 | |||
| 581 | rootH1_10005734 | |||
| 582 | JGI25160J50197_1000212 | |||
| 583 | JGI25160J50197_1000494 | |||
| 584 | JGI25161J50226_1000151 | |||
| 585 | JGI25161J50226_1005788 | |||
| 586 | Ga0006562J51391_1027984 | |||
| 587 | Ga0006562J51391_1027986 | |||
| 588 | Ga0055533_1000172 | |||
| 589 | Ga0055525_1001042 | |||
| 590 | Ga0055535_1000641 | |||
| 591 | Ga0055529_1000602 | |||
| 592 | Ga0055526_1001782 | |||
| 593 | Ga0055526_1002394 | |||
| 594 | Ga0055526_1005662 | |||
| 595 | Ga0055537_1011344 | |||
| 596 | Ga0055524_1000082 | |||
| 597 | Ga0055524_1005911 | |||
| 598 | Ga0055524_1011941 | |||
| 599 | Ga0055534_1001660 | |||
| 600 | Ga0055528_1000511 | |||
| 601 | Ga0055528_1002493 | |||
| 602 | Ga0055528_1003441 | |||
| 603 | Ga0055528_1020245 | |||
| 604 | Ga0055540_1000010 | |||
| 605 | Ga0055540_1004378 | |||
| 606 | Ga0055531_10001298 | |||
| 607 | Ga0055543_1000394 | |||
| 608 | Ga0055543_1001641 | |||
| 609 | Ga0065165_1010503 | |||
| 610 | Ga0065165_1014130 | |||
| 611 | Ga0065704_10134648 | |||
| 612 | Ga0070667_100000183 | |||
| 613 | Ga0070663_100000125 | |||
| 614 | Ga0070663_100043673 | |||
| 615 | Ga0070663_100184805 | |||
| 616 | Ga0070685_10001154 | |||
| 617 | Ga0068853_100405412 | |||
| 618 | Ga0068855_100015586 | |||
| 619 | Ga0068855_100029391 | |||
| 620 | Ga0068857_100002648 | |||
| 621 | Ga0068857_100051962 | |||
| 622 | Ga0068854_100001124 | |||
| 623 | Ga0068854_100007140 | |||
| 624 | Ga0068856_100000116 | |||
| 625 | Ga0068856_100004917 | |||
| 626 | Ga0068863_100069231 | |||
| 627 | Ga0068858_100037754 | |||
| 628 | Ga0068862_100198035 | |||
| 629 | Ga0075365_10015292 | |||
| 630 | Ga0075362_10006704 | |||
| 631 | Ga0075362_10064246 | |||
| 632 | Ga0075367_10035768 | |||
| 633 | Ga0075366_10018038 | |||
| 634 | Ga0075366_10104946 | |||
| 635 | Ga0079104_1000011 | |||
| 636 | Ga0079104_1005385 | |||
| 637 | Ga0105250_10011200 | |||
| 638 | Ga0105240_10000254 | |||
| 639 | Ga0105240_10000385 | |||
| 640 | Ga0105240_10000668 | |||
| 641 | Ga0105240_10002661 | |||
| 642 | Ga0105240_10009760 | |||
| 643 | Ga0105240_10088882 | |||
| 644 | Ga0105243_10001827 | |||
| 645 | Ga0105243_10057611 | |||
| 646 | Ga0105241_10129443 | |||
| 647 | Ga0105248_10000209 | |||
| 648 | Ga0105237_10000105 | |||
| 649 | Ga0105237_10000876 | |||
| 650 | Ga0105237_10058676 | |||
| 651 | Ga0105237_10073419 | |||
| 652 | Ga0105238_10002261 | |||
| 653 | Ga0105238_10052076 | |||
| 654 | Ga0105238_10079574 | |||
| 655 | Ga0105249_10000601 | |||
| 656 | Ga0105239_10000030 | |||
| 657 | Ga0105239_10144458 | |||
| 658 | Ga0157370_10162439 | |||
| 659 | Ga0157378_10048640 | |||
| 660 | Ga0182008_10024609 | |||
| 661 | Ga0182006_1000246 | |||
| 662 | Ga0182005_1004217 | |||
| 663 | Ga0213872_10005058 | |||
| 664 | Ga0209435_100010 | |||
| 665 | Ga0209674_100088 | |||
| 666 | Ga0209563_100160 | |||
| 667 | Ga0207427_100296 | |||
| 668 | Ga0209258_100630 | |||
| 669 | Ga0209258_101241 | |||
| 670 | Ga0207425_1001861 | |||
| 671 | Ga0209646_1000001 | |||
| 672 | Ga0209646_1000214 | |||
| 673 | Ga0209026_1000001 | |||
| 674 | Ga0209026_1000059 | |||
| 675 | Ga0209026_1000111 | |||
| 676 | Ga0209026_1011177 | |||
| 677 | Ga0209677_100162 | |||
| 678 | Ga0209677_100226 | |||
| 679 | Ga0209759_1000001 | |||
| 680 | Ga0209759_1000365 | |||
| 681 | Ga0209759_1001640 | |||
| 682 | Ga0209759_1009710 | |||
| 683 | Ga0209129_1000514 | |||
| 684 | Ga0209565_1000036 | |||
| 685 | Ga0209455_1000211 | |||
| 686 | Ga0209455_1000508 | |||
| 687 | Ga0209455_1002009 | |||
| 688 | Ga0209673_1000023 | |||
| 689 | Ga0209673_1000212 | |||
| 690 | Ga0209673_1000282 | |||
| 691 | Ga0209673_1001489 | |||
| 692 | Ga0209673_1017380 | |||
| 693 | Ga0209130_1000042 | |||
| 694 | Ga0209130_1000151 | |||
| 695 | Ga0209675_1000751 | |||
| 696 | Ga0209676_1000007 | |||
| 697 | Ga0209676_1003880 | |||
| 698 | Ga0209025_1000300 | |||
| 699 | Ga0209025_1005150 | |||
| 700 | Ga0209025_1007501 | |||
| 701 | Ga0209025_1010080 | |||
| 702 | Ga0209025_1017601 | |||
| 703 | Ga0209564_1000112 | |||
| 704 | Ga0209564_1000402 | |||
| 705 | Ga0209564_1000729 | |||
| 706 | Ga0209564_1000903 | |||
| 707 | Ga0209758_1000053 | |||
| 708 | Ga0209758_1000276 | |||
| 709 | Ga0209758_1002527 | |||
| 710 | Ga0209050_1000003 | |||
| 711 | Ga0209050_1003577 | |||
| 712 | Ga0209050_1019396 | |||
| 713 | Ga0209256_1000001 | |||
| 714 | Ga0209256_1000485 | |||
| 715 | Ga0209256_1000678 | |||
| 716 | Ga0207426_1000035 | |||
| 717 | Ga0207426_1000097 | |||
| 718 | Ga0209051_1000003 | |||
| 719 | Ga0209051_1000119 | |||
| 720 | Ga0209051_1003793 | |||
| 721 | Ga0209257_1000020 | |||
| 722 | Ga0207647_10018554 | |||
| 723 | Ga0207695_10000007 | |||
| 724 | Ga0207695_10000408 | |||
| 725 | Ga0207695_10000517 | |||
| 726 | Ga0207695_10001526 | |||
| 727 | Ga0207695_10001623 | |||
| 728 | Ga0207695_10027940 | |||
| 729 | Ga0207695_10132564 | |||
| 730 | Ga0207671_10000031 | |||
| 731 | Ga0207671_10002583 | |||
| 732 | Ga0207671_10004557 | |||
| 733 | Ga0207671_10054116 | |||
| 734 | Ga0207657_10158558 | |||
| 735 | Ga0207657_10162860 | |||
| 736 | Ga0207694_10001589 | |||
| 737 | Ga0207694_10053688 | |||
| 738 | Ga0207686_10042748 | |||
| 739 | Ga0207709_10000074 | |||
| 740 | Ga0207711_10000720 | |||
| 741 | Ga0207667_10000082 | |||
| 742 | Ga0207667_10000806 | |||
| 743 | Ga0207667_10002183 | |||
| 744 | Ga0207667_10019766 | |||
| 745 | Ga0207712_10001934 | |||
| 746 | Ga0207668_10045273 | |||
| 747 | Ga0207640_10000018 | |||
| 748 | Ga0207640_10000579 | |||
| 749 | Ga0207640_10006220 | |||
| 750 | Ga0207658_10000056 | |||
| 751 | Ga0207703_10032449 | |||
| 752 | Ga0207639_10271618 | |||
| 753 | Ga0207678_10000590 | |||
| 754 | Ga0207678_10006028 | |||
| 755 | Ga0207678_10053822 | |||
| 756 | Ga0207678_10158486 | |||
| 757 | Ga0207708_10083830 | |||
| 758 | Ga0207702_10000170 | |||
| 759 | Ga0207702_10009865 | |||
| 760 | Ga0207676_10030246 | |||
| 761 | Ga0207674_10001067 | |||
| 762 | Ga0207674_10005021 | |||
| 763 | Ga0207674_10187773 | |||
| 764 | Ga0209281_1000005 | |||
| 765 | Ga0307517_10000122 | |||
| 766 | Ga0307515_10000571 | |||
| 767 | Ga0307515_10045626 | |||
| 768 | Ga0265324_10001806 | |||
| 769 | Ga0265325_10054682 | |||
| 770 | Ga0265316_10027715 | |||
| 771 | Ga0265316_10159686 | |||
| 772 | Ga0307513_10000011 | |||
| 773 | Ga0307513_10008208 | |||
| 774 | Ga0307513_10064864 | |||
| 775 | Ga0307513_10085269 | |||
| 776 | Ga0307408_100080719 | |||
| 777 | Ga0265313_10004214 | |||
| 778 | Ga0265313_10004285 | |||
| 779 | Ga0265313_10038203 | |||
| 780 | Ga0307508_10006278 | |||
| 781 | Ga0307514_10001114 | |||
| 782 | Ga0265314_10065768 | |||
| 783 | Ga0265342_10005326 | |||
| 784 | Ga0307406_10078324 | |||
| 785 | Ga0307412_10000272 | |||
| 786 | Ga0307409_100014189 | |||
| 787 | Ga0307416_100030722 | |||
| 788 | Ga0307415_100058441 | |||
| 789 | Ga0395900_0149930 | |||
| 790 | Ga0395898_0036497 | |||
| 791 | Ga0395905_0029715 | |||
| 792 | Ga0395901_0010225 | |||
| 793 | Ga0436361_1143890 | |||
| 794 | Ga0439436_0000001 | |||
| 795 | Ga0439465_0000698 | |||
| 796 | Ga0451791_0110928 | |||
| 797 | Ga0451833_0091336 | |||
| 798 | Ga0451851_0374511 | |||
| 799 | Ga0451853_1630839 | |||
| 800 | Ga0439449_0020632 | |||
| 801 | Ga0466972_0030229 | |||
| 802 | Ga0466982_0000004 | |||
| 803 | Ga0466966_0059241 | |||
| 804 | Ga0466961_0057164 | |||
| 805 | Ga0466971_0001157 | |||
| 806 | Ga0466968_0010068 | |||
| 807 | Ga0466968_0024702 | |||
| 808 | Ga0466960_0031417 | |||
| 809 | Ga0495638_0000142 | |||
| 810 | Ga0495650_0005279 | |||
| 811 | Ga0495605_0005281 | |||
| 812 | Ga0495605_0099187 | |||
| 813 | Ga0495639_0073105 | |||
| 814 | Ga0495585_0093176 | |||
| 815 | Ga0495607_0030443 | |||
| 816 | Ga0495583_0021267 | |||
| 817 | Ga0495606_0003502 | |||
| 818 | Ga0495606_0022855 | |||
| 819 | Ga0495606_0050836 | |||
| 820 | Ga0495610_0000954 | |||
| 821 | Ga0495610_0041276 | |||
| 822 | Ga0495616_0024549 | |||
| 823 | Ga0495620_0032748 | |||
| 824 | Ga0495632_0087833 | |||
| 825 | Ga0495654_0000884 | |||
| 826 | Ga0495597_0016301 | |||
| 827 | Ga0495633_0002721 | |||
| 828 | Ga0495668_0006798 | |||
| 829 | Ga0495611_0012918 | |||
| 830 | Ga0495625_0002570 | |||
| 831 | Ga0495625_0080350 | |||
| 832 | Ga0495588_0085718 | |||
| 833 | Ga0495670_0000608 | |||
| 834 | Ga0495670_0024794 | |||
| 835 | Ga0495672_0018013 | |||
| 836 | Ga0495686_0000574 | |||
| 837 | Ga0495686_0009589 | |||
| 838 | Ga0495686_0018052 | |||
| 839 | Ga0496100_0032387 | |||
| 840 | Ga0496101_0123307 | |||
| 841 | Ga0496102_0002413 | |||
| 842 | Ga0496104_0315878 | |||
| 843 | Ga0496105_0013981 | |||
| 844 | Ga0496107_0177627 | |||
| 845 | Ga0496110_0224964 | |||
| 846 | Ga0496115_0027081 | |||
| 847 | Ga0496116_0144149 | |||
| 848 | Ga0496117_0002926 | |||
| 849 | Ga0496117_0052428 | |||
| 850 | Ga0496117_0068555 | |||
| 851 | Ga0496118_0000366 | |||
| 852 | Ga0496118_0000678 | |||
| 853 | Ga0496118_0001987 | |||
| 854 | Ga0496118_0009608 | |||
| 855 | Ga0496118_0059351 | |||
| 856 | Ga0496119_0000382 | |||
| 857 | Ga0496119_0009132 | |||
| 858 | Ga0496119_0011994 | |||
| 859 | Ga0496120_0000335 | |||
| 860 | Ga0496120_0000343 | |||
| 861 | Ga0496121_0000369 | |||
| 862 | Ga0496121_0005991 | |||
| 863 | Ga0496121_0083278 | |||
| 864 | Ga0496121_0129801 | |||
| 865 | Ga0496121_0156546 | |||
| 866 | Ga0496121_0179021 | |||
| 867 | Ga0496122_0000642 | |||
| 868 | Ga0496122_0025252 | |||
| 869 | Ga0496122_0027219 | |||
| 870 | Ga0496123_0000464 | |||
| 871 | Ga0496123_0050775 | |||
| 872 | Ga0496123_0128665 | |||
| 873 | Ga0496124_0000086 | |||
| 874 | Ga0496124_0013655 | |||
| 875 | Ga0496125_0000455 | |||
| 876 | Ga0496125_0000729 | |||
| 877 | Ga0496125_0014131 | |||
| 878 | Ga0496125_0018025 | |||
| 879 | Ga0496125_0165782 | |||
| 880 | Ga0496126_0000757 | |||
| 881 | Ga0496126_0013879 | |||
| 882 | Ga0496126_0032821 | |||
| 883 | Ga0496126_0088302 | |||
| 884 | Ga0496126_0169634 | |||
| 885 | Ga0501031_0009984 | |||
| 886 | Ga0501032_0064622 | |||
| 887 | Ga0501032_0113515 | |||
| 888 | Ga0501033_0071948 | |||
| 889 | Ga0501033_0078938 | |||
| 890 | Ga0501033_0140504 | |||
| 891 | Ga0501034_0145013 | |||
| 892 | Ga0501034_0174749 | |||
| 893 | Ga0501034_0185493 | |||
| 894 | Ga0501034_0227063 | |||
| 895 | Ga0501036_0106940 | |||
| 896 | Ga0501036_0143264 | |||
| 897 | Ga0501036_0306545 | |||
| 898 | Ga0501037_0148626 | |||
| 899 | Ga0501038_0027405 | |||
| 900 | Ga0501038_0044931 | |||
| 901 | Ga0501038_0199298 | |||
| 902 | Ga0501043_0173822 | |||
| 903 | Ga0501046_0108994 | |||
| 904 | Ga0501046_0122589 | |||
| 905 | Ga0501047_0070772 | |||
| 906 | Ga0501047_0116416 | |||
| 907 | Ga0501048_0107161 | |||
| 908 | Ga0501070_0092275 | |||
| 909 | Ga0501073_0061521 | |||
| 910 | Ga0501073_0199236 | |||
| 911 | Ga0501080_0059651 | |||
| 912 | Ga0501080_0301794 | |||
| 913 | Ga0501083_0087522 | |||
| 914 | Ga0501044_0031662 | |||
| 915 | Ga0501044_0052644 | |||
| 916 | Ga0501044_0135732 | |||
| 917 | Ga0501044_0209620 | |||
| 918 | nmdc:mga0k408_91003_c1 | |||
| 919 | nmdc:mga07m45_32622_c1 | |||
| 920 | Ga0500610_0018254 | |||
| 921 | Ga0500578_0167275 | |||
| 922 | Ga0500643_008875 | |||
| 923 | Ga0500644_0002764 | |||
| 924 | Ga0500650_0043679 | |||
| 925 | Ga0500557_000707 | |||
| 926 | Ga0500593_000131 | |||
| 927 | Ga0500594_0000642 | |||
| 928 | Ga0500597_000256 | |||
| 929 | Ga0500618_019307 | |||
| 930 | Ga0500658_0000491 | |||
| 931 | Ga0500559_0010847 | |||
| 932 | Ga0500568_0000291 | |||
| 933 | Ga0500573_0019696 | |||
| 934 | Ga0500616_0003188 | |||
| 935 | Ga0500619_000415 | |||
| 936 | Ga0500645_000397 | |||
| 937 | Ga0500645_000644 | |||
| 938 | Ga0500645_009597 | |||
| 939 | 2509077036 | |||
| 940 | 2509385798 | |||
| 941 | 2509448148 | |||
| 942 | 2510899953 | |||
| 943 | 2510900549 | |||
| 944 | 2511247211 | |||
| 945 | 2513569806 | |||
| 946 | 2513576661 | |||
| 947 | 2513631657 | |||
| 948 | 2513710073 | |||
| 949 | 2513910044 | |||
| 950 | 2513928778 | |||
| 951 | 2514021412 | |||
| 952 | 2515115357 | |||
| 953 | 2515636086 | |||
| 954 | 2515644758 | |||
| 955 | 2515658057 | |||
| 956 | 2515742220 | |||
| 957 | 2517041647 | |||
| 958 | 2517080772 | |||
| 959 | 2517099100 | |||
| 960 | 2517410673 | |||
| 961 | 2520377354 | |||
| 962 | 2530644865 | |||
| 963 | 2585228094 | |||
| 964 | 2585524454 | |||
| 965 | 2585539055 | |||
| 966 | 2585837005 | |||
| 967 | 2599415012 | |||
| 968 | 2616295049 | |||
| 969 | 2644191702 | |||
| 970 | 2644287738 | |||
| 971 | 2719183520 | |||
| 972 | 2719388264 | |||
| 973 | 2719667884 | |||
| 974 | 2719727961 | |||
| 975 | 2720494647 | |||
| 976 | 2720610982 | |||
| 977 | 2720616150 | |||
| 978 | 2720629231 | |||
| 979 | 2720771803 | |||
| 980 | 2721144822 | |||
| 981 | 2721155561 | |||
| 982 | 2721166909 | |||
| 983 | 2721402887 | |||
| 984 | 2722837887 | |||
| 985 | 2722884051 | |||
| 986 | 2723562840 | |||
| 987 | 2723570830 | |||
| 988 | 2724035244 | |||
| 989 | 2724042155 | |||
| 990 | 2724086623 | |||
| 991 | 2724106781 | |||
| 992 | 2725945633 | |||
| 993 | 2730161660 | |||
| 994 | 2730300668 | |||
| 995 | 2739033513 | |||
| 996 | 2766068650 | |||
| 997 | 2774868402 | |||
| 998 | 2776262598 | |||
| 999 | 2793314859 | |||
| 1000 | 2793321516 | |||
| 1001 | 2793325887 | |||
| 1002 | 2793340313 | |||
| 1003 | 2793345994 | |||
| 1004 | 2793355214 | |||
| 1005 | 2793357964 | |||
| 1006 | 2793366725 | |||
| 1007 | 2805927895 | |||
| 1008 | 2805933742 | |||
| 1009 | 2806044992 | |||
| 1010 | 2806053851 | |||
| 1011 | 2806060057 | |||
| 1012 | 2806065889 | |||
| 1013 | 2806075417 | |||
| 1014 | 2835313064 | |||
| 1015 | 2838019300 | |||
| 1016 | 2838026635 | |||
| 1017 | 2838039262 | |||
| 1018 | 2838050365 | |||
| 1019 | 2838063069 | |||
| 1020 | 2838071634 | |||
| 1021 | 2838667628 | |||
| 1022 | 2838673700 | |||
| 1023 | 2838684222 | |||
| 1024 | 2838692259 | |||
| 1025 | 2838699712 | |||
| 1026 | 2838705267 | |||
| 1027 | 2838712002 | |||
| 1028 | 2838734322 | |||
| 1029 | 2838746774 | |||
| 1030 | 2841853465 | |||
| 1031 | 2841869154 | |||
| 1032 | 2842081688 | |||
| 1033 | 2842114616 | |||
| 1034 | 2842122264 | |||
| 1035 | 2842150243 | |||
| 1036 | 2842161450 | |||
| 1037 | 2842167346 | |||
| 1038 | 2842185749 | |||
| 1039 | 2842195486 | |||
| 1040 | 2842202238 | |||
| 1041 | 2842210523 | |||
| 1042 | 2842223103 | |||
| 1043 | 2842234080 | |||
| 1044 | 2842241414 | |||
| 1045 | 2842246381 | |||
| 1046 | 2842254929 | |||
| 1047 | 2842260759 | |||
| 1048 | 2842269344 | |||
| 1049 | 2842276048 | |||
| 1050 | 2842283977 | |||
| 1051 | 2842289857 | |||
| 1052 | 2842295344 | |||
| 1053 | 2842308633 | |||
| 1054 | 2842311964 | |||
| 1055 | 2842319248 | |||
| 1056 | 2842344304 | |||
| 1057 | 2842368210 | |||
| 1058 | 2842375887 | |||
| 1059 | 2842381881 | |||
| 1060 | 2842388813 | |||
| 1061 | 2842396698 | |||
| 1062 | 2842407003 | |||
| 1063 | 2842413895 | |||
| 1064 | 2842420537 | |||
| 1065 | 2842425267 | |||
| 1066 | 2842432699 | |||
| 1067 | 2842438853 | |||
| 1068 | 2842445483 | |||
| 1069 | 2842449937 | |||
| 1070 | 2842467728 | |||
| 1071 | 2842473468 | |||
| 1072 | 2842491694 | |||
| 1073 | 2842502086 | |||
| 1074 | 2842919290 | |||
| 1075 | 2844460812 | |||
| 1076 | 2857519487 | |||
| 1077 | 2882459194 | |||
| 1078 | 2884298741 | |||
| 1079 | 2894024592 | |||
| 1080 | 2894234866 | |||
| 1081 | 2932422603 | |||
| 1082 | 2933017121 | |||
| 1083 | 2933575236 | |||
| 1084 | 2933590528 | |||
| 1085 | 2933602433 | |||
| 1086 | 2935898437 | |||
| 1087 | 2935906870 | |||
| 1088 | 2936370462 | |||
| 1089 | 2936378127 | |||
| 1090 | 2936385455 | |||
| 1091 | 2939633451 | |||
| 1092 | 2953998262 | |||
| 1093 | 2996896730 | |||
| 1094 | 3005413649 | |||
| 1095 | 639651366 | |||
| 1096 | 8005276979 | |||
| 1097 | 8005288006 | |||
| 1098 | 8005289444 | |||
| 1099 | 8005305225 | |||
| 1100 | 8005313327 | |||
| 1101 | 8005382136 | |||
| 1102 | 8005388616 | |||
| 1103 | 8005398022 | |||
| 1104 | 8005431297 | |||
| 1105 | 8005466582 | |||
| 1106 | 8005503294 | |||
| 1107 | 8005561960 | |||
| 1108 | 8005567300 | |||
| 1109 | 8005625435 | |||
| 1110 | 8005630417 | |||
| 1111 | 8005674812 | |||
| 1112 | 8005689247 | |||
| 1113 | 8005696885 | |||
| 1114 | 8018127758 | |||
| 1115 | 8018166188 | |||
| 1116 | 8018182916 | |||
| 1117 | 8023688353 | |||
| 1118 | 8024483988 | |||
| 1119 | 8024503978 | |||
| 1120 | 8056375347 | |||
| 1121 | 8056383124 | |||
| 1122 | 8057880807 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6euq-assembly1.cif.gz_A | mdfa(q131r/l339e) | 0.9295 | 7 | 389 |
| 4zow-assembly1.cif.gz_A | crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol | 0.9277 | 1 | 389 |
| 6vs2-assembly1.cif.gz_A | protein d | 0.9261 | 5 | 389 |
| 4zow-assembly1.cif.gz_A | crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol | 0.9209 | 1 | 389 |
| 6euq-assembly1.cif.gz_A | mdfa(q131r/l339e) | 0.9203 | 7 | 389 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P28246_11_389_1.20.1720.10 | Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D | 0.9682 | 9 | 385 | 1.20.1720.10 |
| af_P28246_11_389_1.20.1720.10 | Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D | 0.9582 | 9 | 385 | 1.20.1720.10 |
| af_Q2G2I3_14_312_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9475 | 9 | 297 | 1.20.1250.20 |
| af_P36554_12_217_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9457 | 11 | 185 | 1.20.1250.20 |
| af_Q2FVI5_15_392_1.20.1720.10 | Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D | 0.9423 | 9 | 385 | 1.20.1720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C4WF17-F1-model_v4 | Bcr/CflA family efflux transporter | 0.9922 | 1 | 390 |
GO:0005886
GO:0042910 GO:1990961 |
| AF-M5JWB5-F1-model_v4 | Bcr/CflA family efflux transporter | 0.992 | 1 | 390 |
GO:0005886
GO:0042910 GO:1990961 |
| AF-A0A0R0MFL3-F1-model_v4 | Bcr/CflA family efflux transporter | 0.9916 | 1 | 391 |
GO:0005886
GO:0015385 GO:0042910 GO:1990961 |
| AF-A0A0R0MFL3-F1-model_v4 | Bcr/CflA family efflux transporter | 0.9891 | 1 | 391 |
GO:0005886
GO:0015385 GO:0042910 GO:1990961 |
| AF-A0A2U0TDC5-F1-model_v4 | deleted | 0.9887 | 1 | 390 |
|