F463871

General Info

Members Datasets Scaffolds Average Seq Length
561 404 1122 398

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0020693|Ga0501033_0020693_3171_4517
Length 448
Sequence MFCAGRVDFRTNWFSIAASDRARAGAPSAEPYRSVPVFHRGSAMTSRLFGTALVLGLLSAVGPFAIDMYLPALPGIQRGLHTGVDAAQMSLMAFFAAIAVGQLVYGPVSDMLGRKPPIYFGLCLFAVASIGCALAPDIHTLIAARFVQGLGACAGMVVPRAIVRDMHTGTEATRLMALLMLVFSVSPILAPLTGSLVVRLSSWRGIFWVVAGAAVLGLALATFVLKETRTAAQRVESSVRSALAAYRTLLRDPSFLGLVFIGAFGISSFFAYLANSSFVLIEHYGLTPTQYSLAFSVNAVSFIGAAQFTGRLGERFGLRRVVRTAVAGYAATMLLLLALTAAGLDRLDLLMALLFVGYGFLGLVIPTTAVLALDRHGPVAGTASALMGTLQFVTGAAVIAVVGRFLDGTALPMVGGIAGCAVIAFLLARVTLRRDDEPTMDDVVVEQA

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
66 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
137 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
210 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
211 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
223 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
224 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
225 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
226 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
227 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
228 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
229 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
230 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
231 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
232 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
233 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
234 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
235 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
236 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
237 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
238 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
239 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
240 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
241 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
242 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
243 2519899620 Rhizobium sp. Pop5 Isolate Nodule
244 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
245 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
246 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
247 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
248 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
249 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
250 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
251 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
252 2643221651 Afipia sp. Root123D2 Isolate Unclassified
253 2718217882 Rhizobium sp. N741 Isolate Nodule
254 2718217927 Rhizobium sp. N324 Isolate Nodule
255 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
256 2718218009 Rhizobium sp. N561 Isolate Nodule
257 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
258 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
259 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
260 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
261 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
262 2718218363 Rhizobium sp. N113 Isolate Nodule
263 2718218365 Rhizobium sp. N731 Isolate Nodule
264 2718218366 Rhizobium sp. N621 Isolate Nodule
265 2718218423 Rhizobium sp. N941 Isolate Nodule
266 2721755514 Rhizobium sp. N6212 Isolate Nodule
267 2721755523 Delftia sp. HK171 Isolate Unclassified
268 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
269 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
270 2721755809 Rhizobium sp. N541 Isolate Nodule
271 2721755810 Rhizobium sp. N871 Isolate Nodule
272 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
273 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
274 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
275 2728369365 Rhizobium sp. N1341 Isolate Nodule
276 2728369397 Rhizobium sp. N1314 Isolate Nodule
277 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
278 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
279 2773857925 Microvirga vignae BR3299 Isolate Unclassified
280 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
281 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
282 2791355260 Rhizobium sp. L9 Isolate Nodule
283 2791355261 Rhizobium sp. J15 Isolate Nodule
284 2791355263 Rhizobium chutanense C5 Isolate Nodule
285 2791355264 Rhizobium sp. S9 Isolate Nodule
286 2791355265 Rhizobium sp. H4 Isolate Nodule
287 2791355266 Rhizobium sp. L43 Isolate Nodule
288 2791355267 Rhizobium sp. L18 Isolate Nodule
289 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
290 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
291 2802429633 Rhizobium anhuiense J3 Isolate Nodule
292 2802429634 Rhizobium anhuiense S10 Isolate Nodule
293 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
294 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
295 2802429637 Rhizobium anhuiense C15 Isolate Nodule
296 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
297 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
298 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
299 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
300 2838048938 Rhizobium pisi 27/80 Isolate Nodule
301 2838061910 Rhizobium phaseoli L15 Isolate Nodule
302 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
303 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
304 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
305 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
306 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
307 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
308 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
309 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
310 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
311 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
312 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
313 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
314 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
315 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
316 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
317 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
318 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
319 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
320 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
321 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
322 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
323 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
324 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
325 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
326 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
327 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
328 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
329 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
330 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
331 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
332 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
333 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
334 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
335 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
336 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
337 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
338 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
339 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
340 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
341 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
342 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
343 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
344 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
345 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
346 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
347 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
348 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
349 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
350 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
351 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
352 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
353 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
354 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
355 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
356 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
357 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
358 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
359 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
360 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
361 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
362 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
363 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
364 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
365 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
366 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
367 2933599457 Rhizobium phaseoli M3 Isolate Nodule
368 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
369 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
370 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
371 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
372 2936381700 Rhizobium chutanense C16 Isolate Unclassified
373 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
374 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
375 2996893221 Rhizobium sp. R635 Isolate Nodule
376 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
377 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
378 8005275841 Rhizobium sp. N4311 Isolate Nodule
379 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
380 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
381 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
382 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
383 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
384 8005382845 Rhizobium sp. R634 Isolate Nodule
385 8005395548 Rhizobium sp. R339 Isolate Nodule
386 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
387 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
388 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
389 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
390 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
391 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
392 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
393 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
394 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
395 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
396 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
397 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
398 8018176218 Rhizobium sp. N122 Isolate Nodule
399 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
400 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
401 8024501048 Rhizobium sp. H4 Isolate Nodule
402 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
403 8056382006 Rhizobium croatiense 13T Isolate Nodule
404 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.84
Metatranscriptomes 0.36
Isolates 32.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.89
Nodule 28.52
Rhizoplane 1.6
Rhizosphere 34.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0020693 3300049570 Bacteria 4971
2 JGI24740J21852_10000890 3300001979 Bacteria 13222
3 JGI24739J22299_10004216 3300001989 Bacteria 5504
4 JGI24737J22298_10026654 3300001990 Bacteria 1825
5 JGI25155J39150_1000098 3300002704 Bacteria 48725
6 JGI25156J39149_1000163 3300002705 Bacteria 48762
7 JGI25154J39366_1000183 3300002738 Bacteria 48762
8 JGI25154J39366_1001790 3300002738 Bacteria 6757
9 JGI25157J39369_1000135 3300002741 Bacteria 61510
10 JGI25157J39369_1000209 3300002741 Bacteria 48762
11 JGI25150J39212_1008450 3300002774 Bacteria 2012
12 JGI25159J45721_1000271 3300002987 Bacteria 24276
13 JGI25151J46595_10000274 3300003187 Bacteria 59318
14 JGI25153J46596_10000480 3300003215 Bacteria 25618
15 JGI25153J46596_10001740 3300003215 Bacteria 12923
16 rootH1_10040789 3300003316 Bacteria 5184
17 rootH2_10015358 3300003320 Bacteria 34751
18 rootH2_10130503 3300003320 Bacteria 1686
19 rootL2_10123658 3300003322 Bacteria 2720
20 rootH1_10005734 3300003323 Bacteria 12384
21 JGI25160J50197_1000212 3300003354 Bacteria 47984
22 JGI25160J50197_1000494 3300003354 Bacteria 23565
23 JGI25161J50226_1000151 3300003374 Bacteria 47984
24 JGI25161J50226_1005788 3300003374 Bacteria 2332
25 Ga0006562J51391_1027984 3300003578 Bacteria 4700
26 Ga0006562J51391_1027986 3300003578 Bacteria 4140
27 Ga0055533_1000172 3300003756 Bacteria 58634
28 Ga0055525_1001042 3300003759 Bacteria 7195
29 Ga0055535_1000641 3300003761 Bacteria 27812
30 Ga0055529_1000602 3300003763 Bacteria 27804
31 Ga0055526_1001782 3300003771 Bacteria 14943
32 Ga0055526_1002394 3300003771 Bacteria 12702
33 Ga0055526_1005662 3300003771 Bacteria 7095
34 Ga0055537_1011344 3300003773 Bacteria 1813
35 Ga0055524_1000082 3300003775 Bacteria 119749
36 Ga0055524_1005911 3300003775 Bacteria 5389
37 Ga0055524_1011941 3300003775 Bacteria 3362
38 Ga0055534_1001660 3300003784 Bacteria 8566
39 Ga0055528_1000511 3300003790 Bacteria 30498
40 Ga0055528_1002493 3300003790 Bacteria 9828
41 Ga0055528_1003441 3300003790 Bacteria 7938
42 Ga0055528_1020245 3300003790 Bacteria 2166
43 Ga0055540_1000010 3300003792 Bacteria 290865
44 Ga0055540_1004378 3300003792 Bacteria 6401
45 Ga0055531_10001298 3300003794 Bacteria 18832
46 Ga0055543_1000394 3300004625 Bacteria 27958
47 Ga0055543_1001641 3300004625 Bacteria 8524
48 Ga0065165_1010503 3300005262 Bacteria 3987
49 Ga0065165_1014130 3300005262 Bacteria 3117
50 Ga0065704_10134648 3300005289 Bacteria 1586
51 Ga0070667_100000183 3300005367 Bacteria 75488
52 Ga0070663_100000125 3300005455 Bacteria 36566
53 Ga0070663_100043673 3300005455 Bacteria 3155
54 Ga0070663_100184805 3300005455 Bacteria 1619
55 Ga0070685_10001154 3300005466 Bacteria 14130
56 Ga0068853_100405412 3300005539 Bacteria 1277
57 Ga0068855_100015586 3300005563 Bacteria 9146
58 Ga0068855_100029391 3300005563 Bacteria 6572
59 Ga0068857_100002648 3300005577 Bacteria 14705
60 Ga0068857_100051962 3300005577 Bacteria 3637
61 Ga0068854_100001124 3300005578 Bacteria 16073
62 Ga0068854_100007140 3300005578 Bacteria 7132
63 Ga0068856_100000116 3300005614 Bacteria 79220
64 Ga0068856_100004917 3300005614 Bacteria 13226
65 Ga0068863_100069231 3300005841 Bacteria 3337
66 Ga0068858_100037754 3300005842 Bacteria 4480
67 Ga0068862_100198035 3300005844 Bacteria 1810
68 Ga0075365_10015292 3300006038 Bacteria 4638
69 Ga0075362_10006704 3300006177 Bacteria 4303
70 Ga0075362_10064246 3300006177 Bacteria 1665
71 Ga0075367_10035768 3300006178 Bacteria 2877
72 Ga0075366_10018038 3300006195 Bacteria 4074
73 Ga0075366_10104946 3300006195 Bacteria 1698
74 Ga0079104_1000011 3300006946 Bacteria 359962
75 Ga0079104_1005385 3300006946 Bacteria 5129
76 Ga0105250_10011200 3300009092 Bacteria 3722
77 Ga0105240_10000254 3300009093 Bacteria 106067
78 Ga0105240_10000385 3300009093 Bacteria 82999
79 Ga0105240_10000668 3300009093 Bacteria 62941
80 Ga0105240_10002661 3300009093 Bacteria 28417
81 Ga0105240_10009760 3300009093 Bacteria 13555
82 Ga0105240_10088882 3300009093 Bacteria 3780
83 Ga0105243_10001827 3300009148 Bacteria 18207
84 Ga0105243_10057611 3300009148 Bacteria 3094
85 Ga0105241_10129443 3300009174 Bacteria 2042
86 Ga0105248_10000209 3300009177 Bacteria 67624
87 Ga0105237_10000105 3300009545 Bacteria 118218
88 Ga0105237_10000876 3300009545 Bacteria 40779
89 Ga0105237_10058676 3300009545 Bacteria 3851
90 Ga0105237_10073419 3300009545 Bacteria 3413
91 Ga0105238_10002261 3300009551 Bacteria 19395
92 Ga0105238_10052076 3300009551 Bacteria 4116
93 Ga0105238_10079574 3300009551 Bacteria 3267
94 Ga0105249_10000601 3300009553 Bacteria 32834
95 Ga0105239_10000030 3300010375 Bacteria 233669
96 Ga0105239_10144458 3300010375 Bacteria 2652
97 Ga0157370_10162439 3300013104 Bacteria 2078
98 Ga0157378_10048640 3300013297 Bacteria 3771
99 Ga0182008_10024609 3300014497 Bacteria 3063
100 Ga0182006_1000246 3300015261 Bacteria 50594
101 Ga0182005_1004217 3300015265 Bacteria 4693
102 Ga0213872_10005058 3300021361 Bacteria 6838
103 Ga0209435_100010 3300025206 Bacteria 475373
104 Ga0209674_100088 3300025226 Bacteria 181554
105 Ga0209563_100160 3300025230 Bacteria 58893
106 Ga0207427_100296 3300025231 Bacteria 34920
107 Ga0209258_100630 3300025242 Bacteria 27864
108 Ga0209258_101241 3300025242 Bacteria 9822
109 Ga0207425_1001861 3300025245 Bacteria 8113
110 Ga0209646_1000001 3300025246 Bacteria 3092932
111 Ga0209646_1000214 3300025246 Bacteria 64093
112 Ga0209026_1000001 3300025250 Bacteria 1228671
113 Ga0209026_1000059 3300025250 Bacteria 226652
114 Ga0209026_1000111 3300025250 Bacteria 140599
115 Ga0209026_1011177 3300025250 Bacteria 1631
116 Ga0209677_100162 3300025253 Bacteria 58923
117 Ga0209677_100226 3300025253 Bacteria 40136
118 Ga0209759_1000001 3300025256 Bacteria 2799452
119 Ga0209759_1000365 3300025256 Bacteria 56836
120 Ga0209759_1001640 3300025256 Bacteria 11816
121 Ga0209759_1009710 3300025256 Bacteria 2886
122 Ga0209129_1000514 3300025258 Bacteria 27663
123 Ga0209565_1000036 3300025263 Bacteria 293334
124 Ga0209455_1000211 3300025272 Bacteria 82660
125 Ga0209455_1000508 3300025272 Bacteria 27836
126 Ga0209455_1002009 3300025272 Bacteria 8341
127 Ga0209673_1000023 3300025273 Bacteria 411385
128 Ga0209673_1000212 3300025273 Bacteria 116031
129 Ga0209673_1000282 3300025273 Bacteria 95013
130 Ga0209673_1001489 3300025273 Bacteria 21798
131 Ga0209673_1017380 3300025273 Bacteria 2652
132 Ga0209130_1000042 3300025284 Bacteria 257581
133 Ga0209130_1000151 3300025284 Bacteria 107021
134 Ga0209675_1000751 3300025291 Bacteria 21867
135 Ga0209676_1000007 3300025292 Bacteria 1029371
136 Ga0209676_1003880 3300025292 Bacteria 8720
137 Ga0209025_1000300 3300025294 Bacteria 110956
138 Ga0209025_1005150 3300025294 Bacteria 10829
139 Ga0209025_1007501 3300025294 Bacteria 8106
140 Ga0209025_1010080 3300025294 Bacteria 6464
141 Ga0209025_1017601 3300025294 Bacteria 4111
142 Ga0209564_1000112 3300025295 Bacteria 211939
143 Ga0209564_1000402 3300025295 Bacteria 76964
144 Ga0209564_1000729 3300025295 Bacteria 46947
145 Ga0209564_1000903 3300025295 Bacteria 38881
146 Ga0209758_1000053 3300025297 Bacteria 337751
147 Ga0209758_1000276 3300025297 Bacteria 102362
148 Ga0209758_1002527 3300025297 Bacteria 18490
149 Ga0209050_1000003 3300025298 Bacteria 1609245
150 Ga0209050_1003577 3300025298 Bacteria 11308
151 Ga0209050_1019396 3300025298 Bacteria 2584
152 Ga0209256_1000001 3300025299 Bacteria 2166974
153 Ga0209256_1000485 3300025299 Bacteria 58920
154 Ga0209256_1000678 3300025299 Bacteria 46016
155 Ga0207426_1000035 3300025302 Bacteria 448327
156 Ga0207426_1000097 3300025302 Bacteria 265930
157 Ga0209051_1000003 3300025303 Bacteria 1609245
158 Ga0209051_1000119 3300025303 Bacteria 148746
159 Ga0209051_1003793 3300025303 Bacteria 9680
160 Ga0209257_1000020 3300025304 Bacteria 773356
161 Ga0207647_10018554 3300025904 Bacteria 4701
162 Ga0207695_10000007 3300025913 Bacteria 1092551
163 Ga0207695_10000408 3300025913 Bacteria 95748
164 Ga0207695_10000517 3300025913 Bacteria 81791
165 Ga0207695_10001526 3300025913 Bacteria 38277
166 Ga0207695_10001623 3300025913 Bacteria 36467
167 Ga0207695_10027940 3300025913 Bacteria 6270
168 Ga0207695_10132564 3300025913 Bacteria 2448
169 Ga0207671_10000031 3300025914 Bacteria 247030
170 Ga0207671_10002583 3300025914 Bacteria 19130
171 Ga0207671_10004557 3300025914 Bacteria 13165
172 Ga0207671_10054116 3300025914 Bacteria 2974
173 Ga0207657_10158558 3300025919 Bacteria 1839
174 Ga0207657_10162860 3300025919 Bacteria 1811
175 Ga0207694_10001589 3300025924 Bacteria 19223
176 Ga0207694_10053688 3300025924 Bacteria 3125
177 Ga0207686_10042748 3300025934 Bacteria 2772
178 Ga0207709_10000074 3300025935 Bacteria 174947
179 Ga0207711_10000720 3300025941 Bacteria 32591
180 Ga0207667_10000082 3300025949 Bacteria 157749
181 Ga0207667_10000806 3300025949 Bacteria 40715
182 Ga0207667_10002183 3300025949 Bacteria 24557
183 Ga0207667_10019766 3300025949 Bacteria 7508
184 Ga0207712_10001934 3300025961 Bacteria 13617
185 Ga0207668_10045273 3300025972 Bacteria 3000
186 Ga0207640_10000018 3300025981 Bacteria 193664
187 Ga0207640_10000579 3300025981 Bacteria 21817
188 Ga0207640_10006220 3300025981 Bacteria 6540
189 Ga0207658_10000056 3300025986 Bacteria 124846
190 Ga0207703_10032449 3300026035 Bacteria 4134
191 Ga0207639_10271618 3300026041 Bacteria 1487
192 Ga0207678_10000590 3300026067 Bacteria 33196
193 Ga0207678_10006028 3300026067 Bacteria 10782
194 Ga0207678_10053822 3300026067 Bacteria 3467
195 Ga0207678_10158486 3300026067 Bacteria 1933
196 Ga0207708_10083830 3300026075 Bacteria 2451
197 Ga0207702_10000170 3300026078 Bacteria 77504
198 Ga0207702_10009865 3300026078 Bacteria 8004
199 Ga0207676_10030246 3300026095 Bacteria 4063
200 Ga0207674_10001067 3300026116 Bacteria 35659
201 Ga0207674_10005021 3300026116 Bacteria 15803
202 Ga0207674_10187773 3300026116 Bacteria 2017
203 Ga0209281_1000005 3300027111 Bacteria 1242284
204 Ga0307517_10000122 3300028786 Bacteria 116429
205 Ga0307515_10000571 3300028794 Bacteria 86938
206 Ga0307515_10045626 3300028794 Bacteria 6726
207 Ga0265324_10001806 3300029957 Bacteria 11625
208 Ga0265325_10054682 3300031241 Bacteria 2043
209 Ga0265316_10027715 3300031344 Bacteria 4684
210 Ga0265316_10159686 3300031344 Bacteria 1686
211 Ga0307513_10000011 3300031456 Bacteria 354929
212 Ga0307513_10008208 3300031456 Bacteria 13394
213 Ga0307513_10064864 3300031456 Bacteria 3845
214 Ga0307513_10085269 3300031456 Bacteria 3242
215 Ga0307408_100080719 3300031548 Bacteria 2430
216 Ga0265313_10004214 3300031595 Bacteria 11149
217 Ga0265313_10004285 3300031595 Bacteria 11046
218 Ga0265313_10038203 3300031595 Bacteria 2393
219 Ga0307508_10006278 3300031616 Bacteria 11192
220 Ga0307514_10001114 3300031649 Bacteria 37486
221 Ga0265314_10065768 3300031711 Bacteria 2448
222 Ga0265342_10005326 3300031712 Bacteria 9848
223 Ga0307406_10078324 3300031901 Bacteria 2189
224 Ga0307412_10000272 3300031911 Bacteria 33000
225 Ga0307409_100014189 3300031995 Bacteria 5167
226 Ga0307416_100030722 3300032002 Bacteria 4034
227 Ga0307415_100058441 3300032126 Bacteria 2655
228 Ga0395900_0149930 3300037418 Bacteria 2383
229 Ga0395898_0036497 3300037466 Bacteria 4880
230 Ga0395905_0029715 3300037471 Bacteria 5151
231 Ga0395901_0010225 3300038443 Bacteria 9505
232 Ga0436361_1143890 3300039447 Bacteria 13239
233 Ga0439436_0000001 3300041404 Bacteria 299341
234 Ga0439465_0000698 3300041413 Bacteria 10311
235 Ga0451791_0110928 3300041451 Bacteria 1260
236 Ga0451833_0091336 3300041491 Bacteria 2791
237 Ga0451851_0374511 3300041507 Bacteria 2769
238 Ga0451853_1630839 3300041512 Bacteria 1361
239 Ga0439449_0020632 3300042007 Bacteria 2468
240 Ga0466972_0030229 3300044658 Bacteria 2667
241 Ga0466982_0000004 3300044672 Bacteria 386724
242 Ga0466966_0059241 3300044684 Bacteria 2418
243 Ga0466961_0057164 3300044693 Bacteria 2484
244 Ga0466971_0001157 3300044719 Bacteria 10969
245 Ga0466968_0010068 3300044735 Bacteria 3654
246 Ga0466968_0024702 3300044735 Bacteria 2457
247 Ga0466960_0031417 3300044901 Bacteria 2450
248 Ga0495638_0000142 3300046460 Bacteria 113893
249 Ga0495650_0005279 3300046471 Bacteria 8459
250 Ga0495605_0005281 3300046474 Bacteria 7539
251 Ga0495605_0099187 3300046474 Bacteria 1341
252 Ga0495639_0073105 3300046475 Bacteria 1587
253 Ga0495585_0093176 3300046492 Bacteria 1620
254 Ga0495607_0030443 3300046501 Bacteria 3314
255 Ga0495583_0021267 3300046506 Bacteria 3342
256 Ga0495606_0003502 3300046507 Bacteria 16624
257 Ga0495606_0022855 3300046507 Bacteria 4543
258 Ga0495606_0050836 3300046507 Bacteria 2708
259 Ga0495610_0000954 3300046512 Bacteria 26782
260 Ga0495610_0041276 3300046512 Bacteria 2317
261 Ga0495616_0024549 3300046513 Bacteria 3232
262 Ga0495620_0032748 3300046515 Bacteria 2365
263 Ga0495632_0087833 3300046519 Bacteria 1477
264 Ga0495654_0000884 3300046530 Bacteria 22400
265 Ga0495597_0016301 3300046542 Bacteria 3509
266 Ga0495633_0002721 3300046558 Bacteria 12257
267 Ga0495668_0006798 3300046616 Bacteria 7433
268 Ga0495611_0012918 3300046648 Bacteria 3550
269 Ga0495625_0002570 3300046660 Bacteria 19495
270 Ga0495625_0080350 3300046660 Bacteria 2271
271 Ga0495588_0085718 3300046674 Bacteria 1647
272 Ga0495670_0000608 3300046691 Bacteria 17106
273 Ga0495670_0024794 3300046691 Bacteria 2965
274 Ga0495672_0018013 3300047320 Bacteria 4703
275 Ga0495686_0000574 3300047472 Bacteria 52228
276 Ga0495686_0009589 3300047472 Bacteria 6959
277 Ga0495686_0018052 3300047472 Bacteria 4741
278 Ga0496100_0032387 3300048903 Bacteria 3260
279 Ga0496101_0123307 3300048904 Bacteria 1961
280 Ga0496102_0002413 3300048905 Bacteria 15959
281 Ga0496104_0315878 3300048907 Bacteria 1475
282 Ga0496105_0013981 3300048908 Bacteria 6384
283 Ga0496107_0177627 3300048910 Bacteria 1581
284 Ga0496110_0224964 3300048913 Bacteria 1706
285 Ga0496115_0027081 3300048918 Bacteria 4480
286 Ga0496116_0144149 3300048919 Bacteria 1334
287 Ga0496117_0002926 3300048920 Bacteria 20663
288 Ga0496117_0052428 3300048920 Bacteria 2873
289 Ga0496117_0068555 3300048920 Bacteria 2394
290 Ga0496118_0000366 3300048921 Bacteria 76070
291 Ga0496118_0000678 3300048921 Bacteria 55390
292 Ga0496118_0001987 3300048921 Bacteria 29053
293 Ga0496118_0009608 3300048921 Bacteria 9736
294 Ga0496118_0059351 3300048921 Bacteria 2849
295 Ga0496119_0000382 3300048922 Bacteria 60994
296 Ga0496119_0009132 3300048922 Bacteria 8579
297 Ga0496119_0011994 3300048922 Bacteria 7095
298 Ga0496120_0000335 3300048923 Bacteria 78595
299 Ga0496120_0000343 3300048923 Bacteria 76966
300 Ga0496121_0000369 3300048924 Bacteria 92541
301 Ga0496121_0005991 3300048924 Bacteria 15357
302 Ga0496121_0083278 3300048924 Bacteria 2525
303 Ga0496121_0129801 3300048924 Bacteria 1888
304 Ga0496121_0156546 3300048924 Bacteria 1671
305 Ga0496121_0179021 3300048924 Bacteria 1532
306 Ga0496122_0000642 3300048925 Bacteria 70999
307 Ga0496122_0025252 3300048925 Bacteria 5166
308 Ga0496122_0027219 3300048925 Bacteria 4895
309 Ga0496123_0000464 3300048926 Bacteria 70999
310 Ga0496123_0050775 3300048926 Bacteria 2768
311 Ga0496123_0128665 3300048926 Bacteria 1408
312 Ga0496124_0000086 3300048927 Bacteria 202844
313 Ga0496124_0013655 3300048927 Bacteria 7916
314 Ga0496125_0000455 3300048928 Bacteria 73934
315 Ga0496125_0000729 3300048928 Bacteria 54486
316 Ga0496125_0014131 3300048928 Bacteria 7790
317 Ga0496125_0018025 3300048928 Bacteria 6712
318 Ga0496125_0165782 3300048928 Bacteria 1493
319 Ga0496126_0000757 3300048929 Bacteria 58502
320 Ga0496126_0013879 3300048929 Bacteria 8172
321 Ga0496126_0032821 3300048929 Bacteria 4887
322 Ga0496126_0088302 3300048929 Bacteria 2731
323 Ga0496126_0169634 3300048929 Bacteria 1860
324 Ga0501031_0009984 3300049568 Bacteria 6184
325 Ga0501032_0064622 3300049569 Bacteria 2449
326 Ga0501032_0113515 3300049569 Bacteria 1792
327 Ga0501033_0071948 3300049570 Bacteria 2540
328 Ga0501033_0078938 3300049570 Bacteria 2415
329 Ga0501033_0140504 3300049570 Bacteria 1746
330 Ga0501034_0145013 3300049571 Bacteria 2352
331 Ga0501034_0174749 3300049571 Bacteria 2114
332 Ga0501034_0185493 3300049571 Bacteria 2044
333 Ga0501034_0227063 3300049571 Bacteria 1817
334 Ga0501036_0106940 3300049572 Bacteria 2366
335 Ga0501036_0143264 3300049572 Bacteria 2016
336 Ga0501036_0306545 3300049572 Bacteria 1328
337 Ga0501037_0148626 3300049573 Bacteria 1675
338 Ga0501038_0027405 3300049574 Bacteria 5069
339 Ga0501038_0044931 3300049574 Bacteria 3836
340 Ga0501038_0199298 3300049574 Bacteria 1607
341 Ga0501043_0173822 3300049579 Bacteria 1680
342 Ga0501046_0108994 3300049580 Bacteria 2117
343 Ga0501046_0122589 3300049580 Bacteria 1977
344 Ga0501047_0070772 3300049581 Bacteria 3358
345 Ga0501047_0116416 3300049581 Bacteria 2554
346 Ga0501048_0107161 3300049582 Bacteria 1973
347 Ga0501070_0092275 3300049586 Bacteria 2506
348 Ga0501073_0061521 3300049589 Bacteria 2620
349 Ga0501073_0199236 3300049589 Bacteria 1385
350 Ga0501080_0059651 3300049742 Bacteria 3550
351 Ga0501080_0301794 3300049742 Bacteria 1452
352 Ga0501083_0087522 3300049744 Bacteria 2060
353 Ga0501044_0031662 3300049823 Bacteria 5565
354 Ga0501044_0052644 3300049823 Bacteria 4193
355 Ga0501044_0135732 3300049823 Bacteria 2451
356 Ga0501044_0209620 3300049823 Bacteria 1903
357 nmdc:mga0k408_91003_c1 3300050493 Bacteria 1792
358 nmdc:mga07m45_32622_c1 3300050496 Bacteria 2888
359 Ga0500610_0018254 3300053079 Bacteria 3387
360 Ga0500578_0167275 3300053086 Bacteria 1361
361 Ga0500643_008875 3300053087 Bacteria 3900
362 Ga0500644_0002764 3300053088 Bacteria 4374
363 Ga0500650_0043679 3300053098 Bacteria 2074
364 Ga0500557_000707 3300053105 Bacteria 4701
365 Ga0500593_000131 3300053117 Bacteria 29789
366 Ga0500594_0000642 3300053118 Bacteria 7452
367 Ga0500597_000256 3300053120 Bacteria 10905
368 Ga0500618_019307 3300053125 Bacteria 1678
369 Ga0500658_0000491 3300053134 Bacteria 16931
370 Ga0500559_0010847 3300053136 Bacteria 3906
371 Ga0500568_0000291 3300053139 Bacteria 41336
372 Ga0500573_0019696 3300053140 Bacteria 3861
373 Ga0500616_0003188 3300053153 Bacteria 12767
374 Ga0500619_000415 3300053154 Bacteria 7709
375 Ga0500645_000397 3300053730 Bacteria 30509
376 Ga0500645_000644 3300053730 Bacteria 22175
377 Ga0500645_009597 3300053730 Bacteria 3243
378 2509077036 2508501114 Bacteria 7082538
379 2509385798 2509276021 Bacteria 7634384
380 2509448148 2509276033 Bacteria 7180565
381 2510899953 2510461076 Bacteria 8618824
382 2510900549 2510461076 Bacteria 8618824
383 2511247211 2511231002 Bacteria 5042903
384 2513569806 2513237084 Bacteria 7231967
385 2513576661 2513237085 Bacteria 7695351
386 2513631657 2513237093 Bacteria 7545552
387 2513710073 2513237103 Bacteria 7647401
388 2513910044 2513237144 Bacteria 7530820
389 2513928778 2513237146 Bacteria 7166346
390 2514021412 2513237162 Bacteria 7468464
391 2515115357 2515075009 Bacteria 7288508
392 2515636086 2515154113 Bacteria 7807172
393 2515644758 2515154114 Bacteria 7848616
394 2515658057 2515154116 Bacteria 7552979
395 2515742220 2515154134 Bacteria 7220242
396 2517041647 2516653077 Bacteria 7555578
397 2517080772 2516653085 Bacteria 7346596
398 2517099100 2517093000 Bacteria 7412387
399 2517410673 2517287029 Bacteria 6905599
400 2520377354 2519899620 Bacteria 6499161
401 2530644865 2529292951 Bacteria 6916614
402 2585228094 2582581299 Bacteria 6518058
403 2585524454 2585427526 Bacteria 7258840
404 2585539055 2585427528 Bacteria 6842387
405 2585837005 2585427593 Bacteria 7141551
406 2599415012 2599185170 Bacteria 7295545
407 2616295049 2615840624 Bacteria 6557588
408 2644191702 2643221634 Bacteria 6705461
409 2644287738 2643221651 Bacteria 4798932
410 2719183520 2718217882 Bacteria 6556348
411 2719388264 2718217927 Bacteria 6972593
412 2719667884 2718217997 Bacteria 6740740
413 2719727961 2718218009 Bacteria 6478651
414 2720494647 2718218199 Bacteria 6740745
415 2720610982 2718218232 Bacteria 6720332
416 2720616150 2718218233 Bacteria 6662049
417 2720629231 2718218235 Bacteria 6630699
418 2720771803 2718218269 Bacteria 6906114
419 2721144822 2718218363 Bacteria 6524337
420 2721155561 2718218365 Bacteria 6274507
421 2721166909 2718218366 Bacteria 6425255
422 2721402887 2718218423 Bacteria 6438183
423 2722837887 2721755514 Bacteria 6424414
424 2722884051 2721755523 Bacteria 6430384
425 2723562840 2721755684 Bacteria 6859907
426 2723570830 2721755685 Bacteria 6704835
427 2724035244 2721755809 Bacteria 6438790
428 2724042155 2721755810 Bacteria 6479005
429 2724086623 2721755819 Bacteria 6906405
430 2724106781 2721755822 Bacteria 6726041
431 2725945633 2724679232 Bacteria 7646494
432 2730161660 2728369365 Bacteria 6555560
433 2730300668 2728369397 Bacteria 6274511
434 2739033513 2738541333 Bacteria 7106503
435 2766068650 2765235942 Bacteria 7445910
436 2774868402 2773857925 Bacteria 6472445
437 2776262598 2775506901 Bacteria 9631051
438 2793314859 2791355259 Bacteria 7254731
439 2793321516 2791355260 Bacteria 6598818
440 2793325887 2791355261 Bacteria 6661293
441 2793340313 2791355263 Bacteria 6872478
442 2793345994 2791355264 Bacteria 6429314
443 2793355214 2791355265 Bacteria 6539969
444 2793357964 2791355266 Bacteria 7116587
445 2793366725 2791355267 Bacteria 7222458
446 2805927895 2802429605 Bacteria 6875453
447 2805933742 2802429606 Bacteria 6346811
448 2806044992 2802429633 Bacteria 7341974
449 2806053851 2802429634 Bacteria 7083200
450 2806060057 2802429635 Bacteria 7650140
451 2806065889 2802429636 Bacteria 7597525
452 2806075417 2802429637 Bacteria 7067217
453 2835313064 2835312727 Bacteria 7413381
454 2838019300 2838016132 Bacteria 6577831
455 2838026635 2838022645 Bacteria 6494267
456 2838039262 2838035591 Bacteria 7166484
457 2838050365 2838048938 Bacteria 6044578
458 2838063069 2838061910 Bacteria 6794874
459 2838071634 2838068647 Bacteria 6208656
460 2838667628 2838661181 Bacteria 7385261
461 2838673700 2838668709 Bacteria 6671819
462 2838684222 2838680041 Bacteria 6545511
463 2838692259 2838686498 Bacteria 7807632
464 2838699712 2838694306 Bacteria 6853137
465 2838705267 2838701080 Bacteria 6669771
466 2838712002 2838707686 Bacteria 6619912
467 2838734322 2838729681 Bacteria 7400765
468 2838746774 2838742623 Bacteria 7396178
469 2841853465 2841851746 Bacteria 7532261
470 2841869154 2841864319 Bacteria 6742987
471 2842081688 2842077413 Bacteria 6508645
472 2842114616 2842110456 Bacteria 7656360
473 2842122264 2842118031 Bacteria 7033875
474 2842150243 2842146304 Bacteria 5957337
475 2842161450 2842156927 Bacteria 6894975
476 2842167346 2842163707 Bacteria 6916235
477 2842185749 2842180545 Bacteria 6888678
478 2842195486 2842192696 Bacteria 6147454
479 2842202238 2842198810 Bacteria 6608673
480 2842210523 2842205361 Bacteria 6340321
481 2842223103 2842217011 Bacteria 7497767
482 2842234080 2842229732 Bacteria 7475766
483 2842241414 2842237096 Bacteria 6620661
484 2842246381 2842243621 Bacteria 7421798
485 2842254929 2842250916 Bacteria 6579627
486 2842260759 2842257432 Bacteria 7401195
487 2842269344 2842264693 Bacteria 6472963
488 2842276048 2842271015 Bacteria 7807131
489 2842283977 2842278818 Bacteria 6340002
490 2842289857 2842285085 Bacteria 6011953
491 2842295344 2842291075 Bacteria 7076806
492 2842308633 2842304105 Bacteria 7023636
493 2842311964 2842311132 Bacteria 6616990
494 2842319248 2842317721 Bacteria 6793725
495 2842344304 2842341865 Bacteria 7003929
496 2842368210 2842363717 Bacteria 6844742
497 2842375887 2842370503 Bacteria 7038661
498 2842381881 2842377471 Bacteria 7140707
499 2842388813 2842384541 Bacteria 7057858
500 2842396698 2842395702 Bacteria 6780583
501 2842407003 2842402390 Bacteria 6681310
502 2842413895 2842409023 Bacteria 6687331
503 2842420537 2842415677 Bacteria 6596907
504 2842425267 2842422224 Bacteria 6239196
505 2842432699 2842428310 Bacteria 6767288
506 2842438853 2842434925 Bacteria 6502746
507 2842445483 2842441272 Bacteria 6769273
508 2842449937 2842447887 Bacteria 6754142
509 2842467728 2842462802 Bacteria 6588055
510 2842473468 2842469257 Bacteria 6752936
511 2842491694 2842489311 Bacteria 6620893
512 2842502086 2842495871 Bacteria 6820686
513 2842919290 2842918807 Bacteria 4289178
514 2844460812 2844454524 Bacteria 7952546
515 2857519487 2857516855 Bacteria 7787325
516 2882459194 2882456835 Bacteria 6863978
517 2884298741 2884298095 Bacteria 3823049
518 2894024592 2894023352 Bacteria 5167372
519 2894234866 2894232714 Bacteria 8834183
520 2932422603 2932422444 Bacteria 4678430
521 2933017121 2933016740 Bacteria 6355406
522 2933575236 2933570622 Bacteria 7023390
523 2933590528 2933586486 Bacteria 7667493
524 2933602433 2933599457 Bacteria 5858799
525 2935898437 2935894831 Bacteria 6620579
526 2935906870 2935901341 Bacteria 7341747
527 2936370462 2936367885 Bacteria 7324495
528 2936378127 2936375103 Bacteria 6652732
529 2936385455 2936381700 Bacteria 7006523
530 2939633451 2939631187 Bacteria 6118131
531 2953998262 2953994433 Bacteria 4303959
532 2996896730 2996893221 Bacteria 5823108
533 3005413649 3005409236 Bacteria 7188837
534 639651366 639633055 Bacteria 7751309
535 8005276979 8005275841 Bacteria 6929066
536 8005288006 8005282627 Bacteria 6675747
537 8005289444 8005289223 Bacteria 6634003
538 8005305225 8005301065 Bacteria 6614431
539 8005313327 8005307578 Bacteria 7395396
540 8005382136 8005376324 Bacteria 6590079
541 8005388616 8005382845 Bacteria 6732062
542 8005398022 8005395548 Bacteria 6806915
543 8005431297 8005430974 Bacteria 6689030
544 8005466582 8005460587 Bacteria 7157962
545 8005503294 8005497431 Bacteria 6477605
546 8005561960 8005556819 Bacteria 6908598
547 8005567300 8005563573 Bacteria 7153261
548 8005625435 8005619151 Bacteria 7030230
549 8005630417 8005626139 Bacteria 6534237
550 8005674812 8005668836 Bacteria 6953162
551 8005689247 8005688590 Bacteria 6610080
552 8005696885 8005695170 Bacteria 6912330
553 8018127758 8018127388 Bacteria 7351159
554 8018166188 8018163183 Bacteria 7277977
555 8018182916 8018176218 Bacteria 6896178
556 8023688353 8023680758 Bacteria 7729763
557 8024483988 8024479707 Bacteria 6954785
558 8024503978 8024501048 Bacteria 6427847
559 8056375347 8056375014 Bacteria 7006639
560 8056383124 8056382006 Bacteria 6408074
561 8057880807 8057874678 Bacteria 7494653
562 Ga0501033_0020693
563 JGI24740J21852_10000890
564 JGI24739J22299_10004216
565 JGI24737J22298_10026654
566 JGI25155J39150_1000098
567 JGI25156J39149_1000163
568 JGI25154J39366_1000183
569 JGI25154J39366_1001790
570 JGI25157J39369_1000135
571 JGI25157J39369_1000209
572 JGI25150J39212_1008450
573 JGI25159J45721_1000271
574 JGI25151J46595_10000274
575 JGI25153J46596_10000480
576 JGI25153J46596_10001740
577 rootH1_10040789
578 rootH2_10015358
579 rootH2_10130503
580 rootL2_10123658
581 rootH1_10005734
582 JGI25160J50197_1000212
583 JGI25160J50197_1000494
584 JGI25161J50226_1000151
585 JGI25161J50226_1005788
586 Ga0006562J51391_1027984
587 Ga0006562J51391_1027986
588 Ga0055533_1000172
589 Ga0055525_1001042
590 Ga0055535_1000641
591 Ga0055529_1000602
592 Ga0055526_1001782
593 Ga0055526_1002394
594 Ga0055526_1005662
595 Ga0055537_1011344
596 Ga0055524_1000082
597 Ga0055524_1005911
598 Ga0055524_1011941
599 Ga0055534_1001660
600 Ga0055528_1000511
601 Ga0055528_1002493
602 Ga0055528_1003441
603 Ga0055528_1020245
604 Ga0055540_1000010
605 Ga0055540_1004378
606 Ga0055531_10001298
607 Ga0055543_1000394
608 Ga0055543_1001641
609 Ga0065165_1010503
610 Ga0065165_1014130
611 Ga0065704_10134648
612 Ga0070667_100000183
613 Ga0070663_100000125
614 Ga0070663_100043673
615 Ga0070663_100184805
616 Ga0070685_10001154
617 Ga0068853_100405412
618 Ga0068855_100015586
619 Ga0068855_100029391
620 Ga0068857_100002648
621 Ga0068857_100051962
622 Ga0068854_100001124
623 Ga0068854_100007140
624 Ga0068856_100000116
625 Ga0068856_100004917
626 Ga0068863_100069231
627 Ga0068858_100037754
628 Ga0068862_100198035
629 Ga0075365_10015292
630 Ga0075362_10006704
631 Ga0075362_10064246
632 Ga0075367_10035768
633 Ga0075366_10018038
634 Ga0075366_10104946
635 Ga0079104_1000011
636 Ga0079104_1005385
637 Ga0105250_10011200
638 Ga0105240_10000254
639 Ga0105240_10000385
640 Ga0105240_10000668
641 Ga0105240_10002661
642 Ga0105240_10009760
643 Ga0105240_10088882
644 Ga0105243_10001827
645 Ga0105243_10057611
646 Ga0105241_10129443
647 Ga0105248_10000209
648 Ga0105237_10000105
649 Ga0105237_10000876
650 Ga0105237_10058676
651 Ga0105237_10073419
652 Ga0105238_10002261
653 Ga0105238_10052076
654 Ga0105238_10079574
655 Ga0105249_10000601
656 Ga0105239_10000030
657 Ga0105239_10144458
658 Ga0157370_10162439
659 Ga0157378_10048640
660 Ga0182008_10024609
661 Ga0182006_1000246
662 Ga0182005_1004217
663 Ga0213872_10005058
664 Ga0209435_100010
665 Ga0209674_100088
666 Ga0209563_100160
667 Ga0207427_100296
668 Ga0209258_100630
669 Ga0209258_101241
670 Ga0207425_1001861
671 Ga0209646_1000001
672 Ga0209646_1000214
673 Ga0209026_1000001
674 Ga0209026_1000059
675 Ga0209026_1000111
676 Ga0209026_1011177
677 Ga0209677_100162
678 Ga0209677_100226
679 Ga0209759_1000001
680 Ga0209759_1000365
681 Ga0209759_1001640
682 Ga0209759_1009710
683 Ga0209129_1000514
684 Ga0209565_1000036
685 Ga0209455_1000211
686 Ga0209455_1000508
687 Ga0209455_1002009
688 Ga0209673_1000023
689 Ga0209673_1000212
690 Ga0209673_1000282
691 Ga0209673_1001489
692 Ga0209673_1017380
693 Ga0209130_1000042
694 Ga0209130_1000151
695 Ga0209675_1000751
696 Ga0209676_1000007
697 Ga0209676_1003880
698 Ga0209025_1000300
699 Ga0209025_1005150
700 Ga0209025_1007501
701 Ga0209025_1010080
702 Ga0209025_1017601
703 Ga0209564_1000112
704 Ga0209564_1000402
705 Ga0209564_1000729
706 Ga0209564_1000903
707 Ga0209758_1000053
708 Ga0209758_1000276
709 Ga0209758_1002527
710 Ga0209050_1000003
711 Ga0209050_1003577
712 Ga0209050_1019396
713 Ga0209256_1000001
714 Ga0209256_1000485
715 Ga0209256_1000678
716 Ga0207426_1000035
717 Ga0207426_1000097
718 Ga0209051_1000003
719 Ga0209051_1000119
720 Ga0209051_1003793
721 Ga0209257_1000020
722 Ga0207647_10018554
723 Ga0207695_10000007
724 Ga0207695_10000408
725 Ga0207695_10000517
726 Ga0207695_10001526
727 Ga0207695_10001623
728 Ga0207695_10027940
729 Ga0207695_10132564
730 Ga0207671_10000031
731 Ga0207671_10002583
732 Ga0207671_10004557
733 Ga0207671_10054116
734 Ga0207657_10158558
735 Ga0207657_10162860
736 Ga0207694_10001589
737 Ga0207694_10053688
738 Ga0207686_10042748
739 Ga0207709_10000074
740 Ga0207711_10000720
741 Ga0207667_10000082
742 Ga0207667_10000806
743 Ga0207667_10002183
744 Ga0207667_10019766
745 Ga0207712_10001934
746 Ga0207668_10045273
747 Ga0207640_10000018
748 Ga0207640_10000579
749 Ga0207640_10006220
750 Ga0207658_10000056
751 Ga0207703_10032449
752 Ga0207639_10271618
753 Ga0207678_10000590
754 Ga0207678_10006028
755 Ga0207678_10053822
756 Ga0207678_10158486
757 Ga0207708_10083830
758 Ga0207702_10000170
759 Ga0207702_10009865
760 Ga0207676_10030246
761 Ga0207674_10001067
762 Ga0207674_10005021
763 Ga0207674_10187773
764 Ga0209281_1000005
765 Ga0307517_10000122
766 Ga0307515_10000571
767 Ga0307515_10045626
768 Ga0265324_10001806
769 Ga0265325_10054682
770 Ga0265316_10027715
771 Ga0265316_10159686
772 Ga0307513_10000011
773 Ga0307513_10008208
774 Ga0307513_10064864
775 Ga0307513_10085269
776 Ga0307408_100080719
777 Ga0265313_10004214
778 Ga0265313_10004285
779 Ga0265313_10038203
780 Ga0307508_10006278
781 Ga0307514_10001114
782 Ga0265314_10065768
783 Ga0265342_10005326
784 Ga0307406_10078324
785 Ga0307412_10000272
786 Ga0307409_100014189
787 Ga0307416_100030722
788 Ga0307415_100058441
789 Ga0395900_0149930
790 Ga0395898_0036497
791 Ga0395905_0029715
792 Ga0395901_0010225
793 Ga0436361_1143890
794 Ga0439436_0000001
795 Ga0439465_0000698
796 Ga0451791_0110928
797 Ga0451833_0091336
798 Ga0451851_0374511
799 Ga0451853_1630839
800 Ga0439449_0020632
801 Ga0466972_0030229
802 Ga0466982_0000004
803 Ga0466966_0059241
804 Ga0466961_0057164
805 Ga0466971_0001157
806 Ga0466968_0010068
807 Ga0466968_0024702
808 Ga0466960_0031417
809 Ga0495638_0000142
810 Ga0495650_0005279
811 Ga0495605_0005281
812 Ga0495605_0099187
813 Ga0495639_0073105
814 Ga0495585_0093176
815 Ga0495607_0030443
816 Ga0495583_0021267
817 Ga0495606_0003502
818 Ga0495606_0022855
819 Ga0495606_0050836
820 Ga0495610_0000954
821 Ga0495610_0041276
822 Ga0495616_0024549
823 Ga0495620_0032748
824 Ga0495632_0087833
825 Ga0495654_0000884
826 Ga0495597_0016301
827 Ga0495633_0002721
828 Ga0495668_0006798
829 Ga0495611_0012918
830 Ga0495625_0002570
831 Ga0495625_0080350
832 Ga0495588_0085718
833 Ga0495670_0000608
834 Ga0495670_0024794
835 Ga0495672_0018013
836 Ga0495686_0000574
837 Ga0495686_0009589
838 Ga0495686_0018052
839 Ga0496100_0032387
840 Ga0496101_0123307
841 Ga0496102_0002413
842 Ga0496104_0315878
843 Ga0496105_0013981
844 Ga0496107_0177627
845 Ga0496110_0224964
846 Ga0496115_0027081
847 Ga0496116_0144149
848 Ga0496117_0002926
849 Ga0496117_0052428
850 Ga0496117_0068555
851 Ga0496118_0000366
852 Ga0496118_0000678
853 Ga0496118_0001987
854 Ga0496118_0009608
855 Ga0496118_0059351
856 Ga0496119_0000382
857 Ga0496119_0009132
858 Ga0496119_0011994
859 Ga0496120_0000335
860 Ga0496120_0000343
861 Ga0496121_0000369
862 Ga0496121_0005991
863 Ga0496121_0083278
864 Ga0496121_0129801
865 Ga0496121_0156546
866 Ga0496121_0179021
867 Ga0496122_0000642
868 Ga0496122_0025252
869 Ga0496122_0027219
870 Ga0496123_0000464
871 Ga0496123_0050775
872 Ga0496123_0128665
873 Ga0496124_0000086
874 Ga0496124_0013655
875 Ga0496125_0000455
876 Ga0496125_0000729
877 Ga0496125_0014131
878 Ga0496125_0018025
879 Ga0496125_0165782
880 Ga0496126_0000757
881 Ga0496126_0013879
882 Ga0496126_0032821
883 Ga0496126_0088302
884 Ga0496126_0169634
885 Ga0501031_0009984
886 Ga0501032_0064622
887 Ga0501032_0113515
888 Ga0501033_0071948
889 Ga0501033_0078938
890 Ga0501033_0140504
891 Ga0501034_0145013
892 Ga0501034_0174749
893 Ga0501034_0185493
894 Ga0501034_0227063
895 Ga0501036_0106940
896 Ga0501036_0143264
897 Ga0501036_0306545
898 Ga0501037_0148626
899 Ga0501038_0027405
900 Ga0501038_0044931
901 Ga0501038_0199298
902 Ga0501043_0173822
903 Ga0501046_0108994
904 Ga0501046_0122589
905 Ga0501047_0070772
906 Ga0501047_0116416
907 Ga0501048_0107161
908 Ga0501070_0092275
909 Ga0501073_0061521
910 Ga0501073_0199236
911 Ga0501080_0059651
912 Ga0501080_0301794
913 Ga0501083_0087522
914 Ga0501044_0031662
915 Ga0501044_0052644
916 Ga0501044_0135732
917 Ga0501044_0209620
918 nmdc:mga0k408_91003_c1
919 nmdc:mga07m45_32622_c1
920 Ga0500610_0018254
921 Ga0500578_0167275
922 Ga0500643_008875
923 Ga0500644_0002764
924 Ga0500650_0043679
925 Ga0500557_000707
926 Ga0500593_000131
927 Ga0500594_0000642
928 Ga0500597_000256
929 Ga0500618_019307
930 Ga0500658_0000491
931 Ga0500559_0010847
932 Ga0500568_0000291
933 Ga0500573_0019696
934 Ga0500616_0003188
935 Ga0500619_000415
936 Ga0500645_000397
937 Ga0500645_000644
938 Ga0500645_009597
939 2509077036
940 2509385798
941 2509448148
942 2510899953
943 2510900549
944 2511247211
945 2513569806
946 2513576661
947 2513631657
948 2513710073
949 2513910044
950 2513928778
951 2514021412
952 2515115357
953 2515636086
954 2515644758
955 2515658057
956 2515742220
957 2517041647
958 2517080772
959 2517099100
960 2517410673
961 2520377354
962 2530644865
963 2585228094
964 2585524454
965 2585539055
966 2585837005
967 2599415012
968 2616295049
969 2644191702
970 2644287738
971 2719183520
972 2719388264
973 2719667884
974 2719727961
975 2720494647
976 2720610982
977 2720616150
978 2720629231
979 2720771803
980 2721144822
981 2721155561
982 2721166909
983 2721402887
984 2722837887
985 2722884051
986 2723562840
987 2723570830
988 2724035244
989 2724042155
990 2724086623
991 2724106781
992 2725945633
993 2730161660
994 2730300668
995 2739033513
996 2766068650
997 2774868402
998 2776262598
999 2793314859
1000 2793321516
1001 2793325887
1002 2793340313
1003 2793345994
1004 2793355214
1005 2793357964
1006 2793366725
1007 2805927895
1008 2805933742
1009 2806044992
1010 2806053851
1011 2806060057
1012 2806065889
1013 2806075417
1014 2835313064
1015 2838019300
1016 2838026635
1017 2838039262
1018 2838050365
1019 2838063069
1020 2838071634
1021 2838667628
1022 2838673700
1023 2838684222
1024 2838692259
1025 2838699712
1026 2838705267
1027 2838712002
1028 2838734322
1029 2838746774
1030 2841853465
1031 2841869154
1032 2842081688
1033 2842114616
1034 2842122264
1035 2842150243
1036 2842161450
1037 2842167346
1038 2842185749
1039 2842195486
1040 2842202238
1041 2842210523
1042 2842223103
1043 2842234080
1044 2842241414
1045 2842246381
1046 2842254929
1047 2842260759
1048 2842269344
1049 2842276048
1050 2842283977
1051 2842289857
1052 2842295344
1053 2842308633
1054 2842311964
1055 2842319248
1056 2842344304
1057 2842368210
1058 2842375887
1059 2842381881
1060 2842388813
1061 2842396698
1062 2842407003
1063 2842413895
1064 2842420537
1065 2842425267
1066 2842432699
1067 2842438853
1068 2842445483
1069 2842449937
1070 2842467728
1071 2842473468
1072 2842491694
1073 2842502086
1074 2842919290
1075 2844460812
1076 2857519487
1077 2882459194
1078 2884298741
1079 2894024592
1080 2894234866
1081 2932422603
1082 2933017121
1083 2933575236
1084 2933590528
1085 2933602433
1086 2935898437
1087 2935906870
1088 2936370462
1089 2936378127
1090 2936385455
1091 2939633451
1092 2953998262
1093 2996896730
1094 3005413649
1095 639651366
1096 8005276979
1097 8005288006
1098 8005289444
1099 8005305225
1100 8005313327
1101 8005382136
1102 8005388616
1103 8005398022
1104 8005431297
1105 8005466582
1106 8005503294
1107 8005561960
1108 8005567300
1109 8005625435
1110 8005630417
1111 8005674812
1112 8005689247
1113 8005696885
1114 8018127758
1115 8018166188
1116 8018182916
1117 8023688353
1118 8024483988
1119 8024503978
1120 8056375347
1121 8056383124
1122 8057880807

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

81

234

0.94

PF07690

MFS_1

Major Facilitator Superfamily

55

400

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.9295 7 389
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.9277 1 389
6vs2-assembly1.cif.gz_A protein d 0.9261 5 389
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.9209 1 389
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.9203 7 389
ID Description Score Start End Superfamily
af_P28246_11_389_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9682 9 385 1.20.1720.10
af_P28246_11_389_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9582 9 385 1.20.1720.10
af_Q2G2I3_14_312_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9475 9 297 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9457 11 185 1.20.1250.20
af_Q2FVI5_15_392_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9423 9 385 1.20.1720.10
ID Description Score Start End GO Terms
AF-C4WF17-F1-model_v4 Bcr/CflA family efflux transporter 0.9922 1 390 GO:0005886
GO:0042910
GO:1990961
AF-M5JWB5-F1-model_v4 Bcr/CflA family efflux transporter 0.992 1 390 GO:0005886
GO:0042910
GO:1990961
AF-A0A0R0MFL3-F1-model_v4 Bcr/CflA family efflux transporter 0.9916 1 391 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A0R0MFL3-F1-model_v4 Bcr/CflA family efflux transporter 0.9891 1 391 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A2U0TDC5-F1-model_v4 deleted 0.9887 1 390

Map