F464014

General Info

Members Datasets Scaffolds Average Seq Length
563 255 1126 247

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100127231|Ga0070689_1001272313
Length 294
Sequence MHRGCVGTTTSGVFIAAGAIPVALWGSNRDHPRHSSIRRRLAGQGERREAARVTYCVGMKVDEGMIFASDSRTNAGLDNIAKFCKMTLFERAGDRVMVLLSSGNLAGTQAIISLLSQRGDDPDNPGSLWKARTMFDAVNLVSDAMRDIERRDGPSLQASEVTFNASFILGGQIRGEEMRLFRIYAEGNFIESGALTPYIQTGETKYGKPIIDRVITTTTNLADAAKCVLVSFDSTMRSNVSVGMPIDLICYERDSLQVQMRRRFDDGDPYFTSLHRSWSEGTRRVFRELPELLW

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
173 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
192 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
193 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
196 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
253 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
254 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
255 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.36
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 0
Rhizoplane 4.26
Rhizosphere 87.74
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100127231 3300005340 Bacteria 2040
2 Ga0055540_1000231 3300003792 Bacteria 51661
3 Ga0065707_10049975 3300005295 Bacteria 1011
4 Ga0070676_10225468 3300005328 Bacteria 1240
5 Ga0070670_100028390 3300005331 Bacteria 4815
6 Ga0070670_100077873 3300005331 Bacteria 2848
7 Ga0070677_10000382 3300005333 Bacteria 15572
8 Ga0070677_10057419 3300005333 Bacteria 1595
9 Ga0068869_100000865 3300005334 Bacteria 17407
10 Ga0070666_10000758 3300005335 Bacteria 19568
11 Ga0070666_10058312 3300005335 Bacteria 2611
12 Ga0070680_100027471 3300005336 Bacteria 4557
13 Ga0070682_100036759 3300005337 Bacteria 2995
14 Ga0070682_100141760 3300005337 Bacteria 1639
15 Ga0068868_100013034 3300005338 Bacteria 6086
16 Ga0068868_100019465 3300005338 Bacteria 5087
17 Ga0068868_100023141 3300005338 Bacteria 4699
18 Ga0068868_100043514 3300005338 Bacteria 3508
19 Ga0068868_100464418 3300005338 Bacteria 1103
20 Ga0070687_100104610 3300005343 Bacteria 1591
21 Ga0070687_100213866 3300005343 Bacteria 1176
22 Ga0070661_100695694 3300005344 Bacteria 828
23 Ga0070668_100001436 3300005347 Bacteria 17192
24 Ga0070668_100003834 3300005347 Bacteria 11107
25 Ga0070668_100005761 3300005347 Bacteria 9189
26 Ga0070668_100183826 3300005347 Bacteria 1709
27 Ga0070669_100009853 3300005353 Bacteria 6806
28 Ga0070669_100061188 3300005353 Bacteria 2766
29 Ga0070669_100068664 3300005353 Bacteria 2616
30 Ga0070675_100000463 3300005354 Bacteria 27714
31 Ga0070675_100001023 3300005354 Bacteria 20128
32 Ga0070675_100008274 3300005354 Bacteria 8069
33 Ga0070675_100167959 3300005354 Bacteria 1890
34 Ga0070671_100010891 3300005355 Bacteria 7303
35 Ga0070671_100021662 3300005355 Bacteria 5249
36 Ga0070671_100074683 3300005355 Bacteria 2832
37 Ga0070671_100130406 3300005355 Bacteria 2117
38 Ga0070674_100000094 3300005356 Bacteria 41372
39 Ga0070674_100008211 3300005356 Bacteria 6200
40 Ga0070674_100407246 3300005356 Bacteria 1113
41 Ga0070674_100636891 3300005356 Bacteria 905
42 Ga0070673_100000753 3300005364 Bacteria 17978
43 Ga0070673_100002697 3300005364 Bacteria 10877
44 Ga0070673_100195151 3300005364 Bacteria 1741
45 Ga0070673_100212399 3300005364 Bacteria 1672
46 Ga0070673_100625613 3300005364 Bacteria 984
47 Ga0070688_100041715 3300005365 Bacteria 2819
48 Ga0070659_100179555 3300005366 Bacteria 1737
49 Ga0070659_100688934 3300005366 Bacteria 883
50 Ga0070667_100001746 3300005367 Bacteria 19433
51 Ga0070667_100006402 3300005367 Bacteria 9784
52 Ga0070667_100013445 3300005367 Bacteria 6767
53 Ga0070667_100017690 3300005367 Bacteria 5907
54 Ga0070667_100040533 3300005367 Bacteria 3905
55 Ga0070667_100044461 3300005367 Bacteria 3730
56 Ga0070713_100000020 3300005436 Bacteria 108930
57 Ga0070713_100381694 3300005436 Bacteria 1313
58 Ga0070711_100240581 3300005439 Bacteria 1415
59 Ga0070700_100040098 3300005441 Bacteria 2865
60 Ga0070700_100076953 3300005441 Bacteria 2144
61 Ga0070700_100179573 3300005441 Bacteria 1472
62 Ga0070708_100038472 3300005445 Bacteria 4179
63 Ga0070663_100304410 3300005455 Bacteria 1277
64 Ga0070678_100000409 3300005456 Bacteria 20280
65 Ga0070678_100103717 3300005456 Bacteria 2210
66 Ga0070678_100217398 3300005456 Bacteria 1587
67 Ga0070662_100157711 3300005457 Bacteria 1773
68 Ga0070662_100326084 3300005457 Bacteria 1253
69 Ga0070681_10118114 3300005458 Bacteria 2588
70 Ga0068867_100006509 3300005459 Bacteria 8254
71 Ga0068867_100008769 3300005459 Bacteria 7139
72 Ga0068867_100079353 3300005459 Bacteria 2470
73 Ga0068867_100290235 3300005459 Bacteria 1345
74 Ga0070685_10050616 3300005466 Bacteria 2400
75 Ga0070706_100017714 3300005467 Bacteria 6573
76 Ga0070707_100077286 3300005468 Bacteria 3212
77 Ga0070698_100071307 3300005471 Bacteria 3484
78 Ga0070699_100338673 3300005518 Bacteria 1354
79 Ga0070684_100702359 3300005535 Bacteria 943
80 Ga0070684_100740714 3300005535 Bacteria 917
81 Ga0068853_100000300 3300005539 Bacteria 34560
82 Ga0068853_100005616 3300005539 Bacteria 9851
83 Ga0068853_100005626 3300005539 Bacteria 9843
84 Ga0068853_100021946 3300005539 Bacteria 5326
85 Ga0068853_100069540 3300005539 Bacteria 3063
86 Ga0070672_100000552 3300005543 Bacteria 22019
87 Ga0070672_100001803 3300005543 Bacteria 13392
88 Ga0070672_100029609 3300005543 Bacteria 4107
89 Ga0070672_100089043 3300005543 Bacteria 2486
90 Ga0070672_100129261 3300005543 Bacteria 2075
91 Ga0070672_100152446 3300005543 Bacteria 1912
92 Ga0070672_100166921 3300005543 Bacteria 1829
93 Ga0070686_100057560 3300005544 Bacteria 2497
94 Ga0070665_100002419 3300005548 Bacteria 20581
95 Ga0070665_100009078 3300005548 Bacteria 10071
96 Ga0070665_100020178 3300005548 Bacteria 6690
97 Ga0070665_100025134 3300005548 Bacteria 6001
98 Ga0070665_100382044 3300005548 Bacteria 1416
99 Ga0070665_100383054 3300005548 Bacteria 1414
100 Ga0070665_100395323 3300005548 Bacteria 1390
101 Ga0070665_100724347 3300005548 Bacteria 1008
102 Ga0070704_100097565 3300005549 Bacteria 2206
103 Ga0068855_100276821 3300005563 Bacteria 1865
104 Ga0070664_100224438 3300005564 Bacteria 1682
105 Ga0068857_100008978 3300005577 Bacteria 8663
106 Ga0068857_100030542 3300005577 Bacteria 4758
107 Ga0068857_100110444 3300005577 Bacteria 2471
108 Ga0068856_100122077 3300005614 Bacteria 2607
109 Ga0070702_100084926 3300005615 Bacteria 1905
110 Ga0068852_100019333 3300005616 Bacteria 5388
111 Ga0068852_100270969 3300005616 Bacteria 1633
112 Ga0068852_100571108 3300005616 Bacteria 1133
113 Ga0068852_100695960 3300005616 Bacteria 1026
114 Ga0068859_100001747 3300005617 Bacteria 22150
115 Ga0068859_100052895 3300005617 Bacteria 4084
116 Ga0068859_100209850 3300005617 Bacteria 2034
117 Ga0068864_100008836 3300005618 Bacteria 8306
118 Ga0068864_100009680 3300005618 Bacteria 7951
119 Ga0068864_100014755 3300005618 Bacteria 6491
120 Ga0068864_100156525 3300005618 Bacteria 2068
121 Ga0068866_10153168 3300005718 Bacteria 1337
122 Ga0068866_10246877 3300005718 Bacteria 1090
123 Ga0068861_100000564 3300005719 Bacteria 21995
124 Ga0068861_100029241 3300005719 Bacteria 4030
125 Ga0068861_100086200 3300005719 Bacteria 2468
126 Ga0068861_100123958 3300005719 Bacteria 2088
127 Ga0068851_10000941 3300005834 Bacteria 12604
128 Ga0068851_10099000 3300005834 Bacteria 1545
129 Ga0068870_10042210 3300005840 Bacteria 2374
130 Ga0068870_10055677 3300005840 Bacteria 2108
131 Ga0068870_10127155 3300005840 Bacteria 1476
132 Ga0068863_100004874 3300005841 Bacteria 13221
133 Ga0068863_100022879 3300005841 Bacteria 5973
134 Ga0068863_100045403 3300005841 Bacteria 4170
135 Ga0068863_100061670 3300005841 Bacteria 3546
136 Ga0068863_100127749 3300005841 Bacteria 2426
137 Ga0068863_100305860 3300005841 Bacteria 1543
138 Ga0068863_100490523 3300005841 Bacteria 1209
139 Ga0068858_100011382 3300005842 Bacteria 8401
140 Ga0068858_100021251 3300005842 Bacteria 6062
141 Ga0068858_100058894 3300005842 Bacteria 3551
142 Ga0068858_100111244 3300005842 Bacteria 2558
143 Ga0068858_100284925 3300005842 Bacteria 1574
144 Ga0068858_100750236 3300005842 Bacteria 951
145 Ga0068860_100025029 3300005843 Bacteria 5762
146 Ga0068860_100115312 3300005843 Bacteria 2569
147 Ga0068860_100147446 3300005843 Bacteria 2265
148 Ga0068860_100158482 3300005843 Bacteria 2181
149 Ga0068862_100031354 3300005844 Bacteria 4486
150 Ga0068862_100144529 3300005844 Bacteria 2113
151 Ga0068862_100145317 3300005844 Bacteria 2107
152 Ga0070717_10029680 3300006028 Bacteria 4390
153 Ga0075364_10181337 3300006051 Bacteria 1425
154 Ga0075367_10183240 3300006178 Bacteria 1306
155 Ga0075369_10000833 3300006186 Bacteria 10168
156 Ga0075369_10038299 3300006186 Bacteria 2045
157 Ga0075366_10073931 3300006195 Bacteria 2032
158 Ga0075366_10377159 3300006195 Bacteria 872
159 Ga0097621_100018068 3300006237 Bacteria 5377
160 Ga0097621_100231089 3300006237 Bacteria 1615
161 Ga0075370_10019556 3300006353 Bacteria 3690
162 Ga0075370_10021653 3300006353 Bacteria 3522
163 Ga0075370_10134635 3300006353 Bacteria 1443
164 Ga0068871_100004702 3300006358 Bacteria 9546
165 Ga0068871_100032120 3300006358 Bacteria 4144
166 Ga0068865_100535886 3300006881 Bacteria 981
167 Ga0097620_100001747 3300006931 Bacteria 22150
168 Ga0097620_100052895 3300006931 Bacteria 4084
169 Ga0097620_100209860 3300006931 Bacteria 2034
170 Ga0105240_10001580 3300009093 Bacteria 38653
171 Ga0105240_10055003 3300009093 Bacteria 4985
172 Ga0105240_10080523 3300009093 Bacteria 4005
173 Ga0111539_10017990 3300009094 Bacteria 8754
174 Ga0111539_10176415 3300009094 Bacteria 2496
175 Ga0105245_10016254 3300009098 Bacteria 6488
176 Ga0105245_10114570 3300009098 Bacteria 2511
177 Ga0105247_10107572 3300009101 Bacteria 1791
178 Ga0105247_10160628 3300009101 Bacteria 1487
179 Ga0105243_10179041 3300009148 Bacteria 1842
180 Ga0105243_10791060 3300009148 Bacteria 934
181 Ga0105242_10043620 3300009176 Bacteria 3628
182 Ga0105242_10671956 3300009176 Bacteria 1010
183 Ga0105248_10016230 3300009177 Bacteria 8198
184 Ga0105248_10111238 3300009177 Bacteria 3089
185 Ga0105248_10316026 3300009177 Bacteria 1759
186 Ga0105248_10387261 3300009177 Bacteria 1574
187 Ga0105237_10001046 3300009545 Bacteria 37146
188 Ga0105237_10241639 3300009545 Bacteria 1807
189 Ga0105237_10264731 3300009545 Unclassified 1722
190 Ga0105238_10007419 3300009551 Bacteria 10984
191 Ga0105238_10246661 3300009551 Bacteria 1764
192 Ga0105238_10507360 3300009551 Bacteria 1208
193 Ga0105249_10108176 3300009553 Bacteria 2624
194 Ga0105249_10192611 3300009553 Bacteria 1991
195 Ga0105249_10277108 3300009553 Bacteria 1673
196 Ga0105249_10443358 3300009553 Bacteria 1336
197 Ga0105249_10793917 3300009553 Bacteria 1010
198 Ga0105239_10001284 3300010375 Bacteria 33916
199 Ga0105239_10366887 3300010375 Bacteria 1627
200 Ga0105239_10742594 3300010375 Bacteria 1123
201 Ga0157374_10063917 3300013296 Bacteria 3452
202 Ga0157374_10102567 3300013296 Bacteria 2744
203 Ga0157374_10284991 3300013296 Bacteria 1631
204 Ga0157374_10420358 3300013296 Bacteria 1335
205 Ga0157374_10440469 3300013296 Bacteria 1303
206 Ga0157378_10010166 3300013297 Bacteria 8208
207 Ga0157378_10016847 3300013297 Bacteria 6407
208 Ga0157378_10051384 3300013297 Bacteria 3668
209 Ga0157378_10275785 3300013297 Bacteria 1619
210 Ga0163162_10014935 3300013306 Bacteria 7583
211 Ga0163162_10041082 3300013306 Bacteria 4627
212 Ga0163162_10054481 3300013306 Bacteria 4023
213 Ga0163162_10216437 3300013306 Bacteria 2045
214 Ga0163162_10219098 3300013306 Bacteria 2033
215 Ga0157372_10241435 3300013307 Bacteria 2096
216 Ga0157375_10004106 3300013308 Bacteria 12629
217 Ga0157375_10011287 3300013308 Bacteria 7887
218 Ga0157375_10086690 3300013308 Bacteria 3182
219 Ga0157375_10105221 3300013308 Bacteria 2912
220 Ga0157375_10115214 3300013308 Bacteria 2790
221 Ga0157375_10138475 3300013308 Bacteria 2559
222 Ga0157375_10152956 3300013308 Bacteria 2444
223 Ga0157375_10180916 3300013308 Bacteria 2259
224 Ga0157375_10420408 3300013308 Bacteria 1503
225 Ga0157375_10442300 3300013308 Bacteria 1466
226 Ga0157375_11416751 3300013308 Bacteria 819
227 Ga0163163_10078621 3300014325 Bacteria 3295
228 Ga0163163_10365842 3300014325 Bacteria 1499
229 Ga0163163_10507632 3300014325 Bacteria 1268
230 Ga0157380_10052009 3300014326 Bacteria 3242
231 Ga0157380_10061653 3300014326 Bacteria 3002
232 Ga0157380_10063192 3300014326 Bacteria 2968
233 Ga0157380_10185677 3300014326 Bacteria 1831
234 Ga0157380_10445550 3300014326 Bacteria 1242
235 Ga0157380_10797396 3300014326 Bacteria 961
236 Ga0157379_10001057 3300014968 Bacteria 22428
237 Ga0157379_10002624 3300014968 Bacteria 15116
238 Ga0157379_10942414 3300014968 Bacteria 821
239 Ga0157376_10038509 3300014969 Bacteria 3891
240 Ga0157376_10069703 3300014969 Bacteria 2982
241 Ga0157376_10289135 3300014969 Bacteria 1547
242 Ga0157376_10365782 3300014969 Bacteria 1385
243 Ga0157376_10658637 3300014969 Bacteria 1048
244 Ga0163161_10049193 3300017792 Bacteria 3046
245 Ga0163161_10117090 3300017792 Bacteria 1998
246 Ga0163161_10126069 3300017792 Bacteria 1928
247 Ga0163161_10244336 3300017792 Bacteria 1397
248 Ga0163161_10817916 3300017792 Bacteria 784
249 Ga0209051_1000048 3300025303 Bacteria 292755
250 Ga0209257_1026414 3300025304 Bacteria 1958
251 Ga0207697_10014167 3300025315 Bacteria 3314
252 Ga0207656_10003408 3300025321 Bacteria 5460
253 Ga0207682_10002512 3300025893 Bacteria 8199
254 Ga0207642_10095909 3300025899 Bacteria 1477
255 Ga0207680_10041527 3300025903 Bacteria 2684
256 Ga0207645_10004706 3300025907 Bacteria 10041
257 Ga0207645_10007637 3300025907 Bacteria 7620
258 Ga0207645_10086099 3300025907 Bacteria 2018
259 Ga0207645_10178523 3300025907 Bacteria 1393
260 Ga0207645_10262855 3300025907 Bacteria 1143
261 Ga0207643_10041542 3300025908 Bacteria 2592
262 Ga0207643_10043562 3300025908 Bacteria 2533
263 Ga0207684_10003448 3300025910 Bacteria 15423
264 Ga0207684_10155772 3300025910 Bacteria 1966
265 Ga0207654_10091887 3300025911 Bacteria 1852
266 Ga0207707_10195205 3300025912 Bacteria 1766
267 Ga0207695_10013552 3300025913 Bacteria 9714
268 Ga0207671_10002719 3300025914 Bacteria 18528
269 Ga0207671_10127247 3300025914 Bacteria 1952
270 Ga0207660_10042148 3300025917 Bacteria 3202
271 Ga0207660_10318319 3300025917 Bacteria 1242
272 Ga0207662_10142365 3300025918 Bacteria 1520
273 Ga0207646_10333505 3300025922 Bacteria 1370
274 Ga0207681_10011126 3300025923 Bacteria 5527
275 Ga0207681_10014702 3300025923 Bacteria 4872
276 Ga0207694_10014747 3300025924 Bacteria 5893
277 Ga0207694_10024439 3300025924 Bacteria 4589
278 Ga0207694_10034092 3300025924 Bacteria 3902
279 Ga0207694_10114621 3300025924 Bacteria 2147
280 Ga0207694_10537259 3300025924 Bacteria 981
281 Ga0207650_10016788 3300025925 Bacteria 5120
282 Ga0207650_10017344 3300025925 Bacteria 5040
283 Ga0207650_10018525 3300025925 Bacteria 4886
284 Ga0207650_10023927 3300025925 Bacteria 4336
285 Ga0207650_10095306 3300025925 Bacteria 2281
286 Ga0207659_10010777 3300025926 Bacteria 5752
287 Ga0207659_10016864 3300025926 Bacteria 4762
288 Ga0207659_10069050 3300025926 Bacteria 2572
289 Ga0207687_10004824 3300025927 Bacteria 8967
290 Ga0207687_10022894 3300025927 Bacteria 4161
291 Ga0207700_10000086 3300025928 Bacteria 58118
292 Ga0207700_10304540 3300025928 Bacteria 1377
293 Ga0207644_10001344 3300025931 Bacteria 15805
294 Ga0207644_10012267 3300025931 Bacteria 5689
295 Ga0207644_10083288 3300025931 Bacteria 2368
296 Ga0207644_10163159 3300025931 Bacteria 1734
297 Ga0207644_10165021 3300025931 Bacteria 1725
298 Ga0207706_10023984 3300025933 Bacteria 5474
299 Ga0207706_10136364 3300025933 Bacteria 2159
300 Ga0207706_10152693 3300025933 Bacteria 2031
301 Ga0207686_10580369 3300025934 Bacteria 880
302 Ga0207709_10025299 3300025935 Bacteria 3397
303 Ga0207670_10010745 3300025936 Bacteria 5285
304 Ga0207669_10003485 3300025937 Bacteria 6803
305 Ga0207669_10008259 3300025937 Bacteria 4880
306 Ga0207669_10415108 3300025937 Bacteria 1058
307 Ga0207704_10242419 3300025938 Bacteria 1348
308 Ga0207704_10535206 3300025938 Bacteria 950
309 Ga0207691_10000018 3300025940 Bacteria 134343
310 Ga0207691_10000509 3300025940 Bacteria 38750
311 Ga0207691_10003508 3300025940 Bacteria 15262
312 Ga0207691_10014158 3300025940 Bacteria 7610
313 Ga0207691_10033514 3300025940 Bacteria 4781
314 Ga0207691_10139309 3300025940 Bacteria 2138
315 Ga0207711_10073235 3300025941 Bacteria 2977
316 Ga0207711_10081316 3300025941 Bacteria 2831
317 Ga0207689_10000174 3300025942 Bacteria 56242
318 Ga0207689_10004337 3300025942 Bacteria 12921
319 Ga0207689_10421192 3300025942 Bacteria 1114
320 Ga0207661_10068898 3300025944 Bacteria 2883
321 Ga0207679_10206178 3300025945 Bacteria 1646
322 Ga0207651_10002164 3300025960 Bacteria 9298
323 Ga0207651_10002176 3300025960 Bacteria 9280
324 Ga0207651_10282497 3300025960 Bacteria 1372
325 Ga0207712_10313407 3300025961 Bacteria 1292
326 Ga0207668_10002010 3300025972 Bacteria 11871
327 Ga0207668_10002470 3300025972 Bacteria 10799
328 Ga0207668_10016568 3300025972 Bacteria 4601
329 Ga0207668_10029303 3300025972 Bacteria 3607
330 Ga0207668_10100816 3300025972 Bacteria 2145
331 Ga0207658_10008875 3300025986 Bacteria 6823
332 Ga0207658_10013016 3300025986 Bacteria 5682
333 Ga0207658_10016070 3300025986 Bacteria 5140
334 Ga0207658_10034666 3300025986 Bacteria 3609
335 Ga0207658_10051891 3300025986 Bacteria 3024
336 Ga0207658_10078755 3300025986 Bacteria 2519
337 Ga0207658_10082139 3300025986 Bacteria 2474
338 Ga0207658_10339222 3300025986 Bacteria 1306
339 Ga0207677_10003221 3300026023 Bacteria 8613
340 Ga0207677_10013142 3300026023 Bacteria 4786
341 Ga0207703_10193637 3300026035 Bacteria 1802
342 Ga0207703_10644804 3300026035 Bacteria 1004
343 Ga0207639_10000508 3300026041 Bacteria 26945
344 Ga0207639_10009051 3300026041 Bacteria 6860
345 Ga0207639_10090056 3300026041 Bacteria 2453
346 Ga0207639_10093910 3300026041 Bacteria 2407
347 Ga0207678_10006420 3300026067 Bacteria 10433
348 Ga0207708_10006963 3300026075 Bacteria 8361
349 Ga0207708_10080620 3300026075 Bacteria 2501
350 Ga0207708_10202874 3300026075 Bacteria 1582
351 Ga0207702_10278949 3300026078 Bacteria 1579
352 Ga0207641_10014012 3300026088 Bacteria 6573
353 Ga0207641_10027403 3300026088 Bacteria 4705
354 Ga0207641_10057332 3300026088 Bacteria 3312
355 Ga0207641_10099950 3300026088 Bacteria 2554
356 Ga0207641_10165395 3300026088 Bacteria 2014
357 Ga0207648_10001922 3300026089 Bacteria 22701
358 Ga0207648_10015731 3300026089 Bacteria 6940
359 Ga0207648_10033203 3300026089 Bacteria 4552
360 Ga0207648_10189296 3300026089 Bacteria 1823
361 Ga0207648_10220267 3300026089 Bacteria 1686
362 Ga0207648_10334797 3300026089 Bacteria 1362
363 Ga0207676_10010076 3300026095 Bacteria 6725
364 Ga0207676_10013354 3300026095 Bacteria 5899
365 Ga0207676_10034639 3300026095 Bacteria 3824
366 Ga0207676_10130273 3300026095 Bacteria 2137
367 Ga0207674_10041103 3300026116 Bacteria 4784
368 Ga0207674_10090058 3300026116 Bacteria 3059
369 Ga0207674_10581134 3300026116 Unclassified 1082
370 Ga0207675_100000847 3300026118 Bacteria 30430
371 Ga0207675_100021000 3300026118 Bacteria 6087
372 Ga0207675_100033377 3300026118 Bacteria 4796
373 Ga0207675_100058168 3300026118 Bacteria 3608
374 Ga0207683_10000020 3300026121 Bacteria 118805
375 Ga0207683_10002464 3300026121 Bacteria 16138
376 Ga0207683_10029090 3300026121 Bacteria 4782
377 Ga0207683_10137516 3300026121 Bacteria 2199
378 Ga0207698_10007168 3300026142 Bacteria 6981
379 Ga0207698_10208502 3300026142 Bacteria 1756
380 Ga0207428_10371703 3300027907 Bacteria 1050
381 Ga0268266_10013368 3300028379 Bacteria 7071
382 Ga0268266_10063383 3300028379 Bacteria 3191
383 Ga0268266_10078638 3300028379 Bacteria 2870
384 Ga0268266_10173632 3300028379 Bacteria 1958
385 Ga0268266_10335395 3300028379 Bacteria 1418
386 Ga0268266_10388485 3300028379 Bacteria 1318
387 Ga0268265_10028173 3300028380 Bacteria 4019
388 Ga0268265_10030373 3300028380 Bacteria 3891
389 Ga0268265_10134089 3300028380 Bacteria 2063
390 Ga0268265_10142539 3300028380 Bacteria 2008
391 Ga0268265_10631954 3300028380 Bacteria 1027
392 Ga0268264_10002310 3300028381 Bacteria 16863
393 Ga0268264_10152755 3300028381 Bacteria 2072
394 Ga0268264_10229254 3300028381 Bacteria 1714
395 Ga0268264_10254749 3300028381 Bacteria 1632
396 Ga0268264_10338371 3300028381 Bacteria 1429
397 Ga0268264_10388798 3300028381 Bacteria 1338
398 Ga0265319_1047676 3300028563 Bacteria 1425
399 Ga0265318_10000108 3300028577 Bacteria 77334
400 Ga0265318_10000878 3300028577 Bacteria 19643
401 Ga0265336_10002346 3300028666 Bacteria 7871
402 Ga0307517_10272545 3300028786 Bacteria 972
403 Ga0265338_10004756 3300028800 Bacteria 18161
404 Ga0265338_10192985 3300028800 Bacteria 1542
405 Ga0265330_10000201 3300031235 Bacteria 46135
406 Ga0265330_10002606 3300031235 Bacteria 9801
407 Ga0265330_10005212 3300031235 Bacteria 6492
408 Ga0265332_10000255 3300031238 Bacteria 42422
409 Ga0265332_10000447 3300031238 Bacteria 29010
410 Ga0265332_10002933 3300031238 Bacteria 8391
411 Ga0265328_10000254 3300031239 Bacteria 24536
412 Ga0265328_10001319 3300031239 Bacteria 11456
413 Ga0265328_10002130 3300031239 Bacteria 8936
414 Ga0265328_10010589 3300031239 Bacteria 3705
415 Ga0265320_10000085 3300031240 Bacteria 78884
416 Ga0265320_10001256 3300031240 Bacteria 18602
417 Ga0265320_10002076 3300031240 Bacteria 14103
418 Ga0265320_10011178 3300031240 Bacteria 5294
419 Ga0265320_10061572 3300031240 Bacteria 1789
420 Ga0265325_10031821 3300031241 Bacteria 2820
421 Ga0265329_10003349 3300031242 Bacteria 7009
422 Ga0265329_10005103 3300031242 Bacteria 5355
423 Ga0265339_10003541 3300031249 Bacteria 10916
424 Ga0265339_10008026 3300031249 Bacteria 6753
425 Ga0265339_10084862 3300031249 Bacteria 1668
426 Ga0265331_10000179 3300031250 Bacteria 77238
427 Ga0265331_10000354 3300031250 Bacteria 48614
428 Ga0265331_10000762 3300031250 Bacteria 26873
429 Ga0265327_10028928 3300031251 Bacteria 3160
430 Ga0265316_10003342 3300031344 Bacteria 16262
431 Ga0265316_10003383 3300031344 Bacteria 16155
432 Ga0265316_10152207 3300031344 Bacteria 1732
433 Ga0265313_10000103 3300031595 Bacteria 85452
434 Ga0265313_10017259 3300031595 Bacteria 4110
435 Ga0265313_10018126 3300031595 Bacteria 3966
436 Ga0316579_10014904 3300031691 Bacteria 3369
437 Ga0316579_10269876 3300031691 Bacteria 822
438 Ga0265314_10000235 3300031711 Bacteria 82170
439 Ga0265314_10002694 3300031711 Bacteria 17787
440 Ga0265314_10017420 3300031711 Bacteria 5640
441 Ga0265314_10031242 3300031711 Bacteria 3935
442 Ga0265342_10000463 3300031712 Bacteria 44008
443 Ga0265342_10001967 3300031712 Bacteria 18369
444 Ga0265342_10003566 3300031712 Bacteria 12730
445 Ga0265342_10009235 3300031712 Bacteria 6974
446 Ga0265342_10025498 3300031712 Bacteria 3715
447 Ga0265342_10086579 3300031712 Bacteria 1801
448 Ga0316578_10025420 3300031728 Bacteria 3329
449 Ga0307516_10006932 3300031730 Bacteria 13155
450 Ga0316577_10149253 3300031733 Bacteria 1317
451 Ga0307518_10381583 3300031838 Bacteria 799
452 Ga0307414_10033653 3300032004 Bacteria 3390
453 Ga0307411_10000039 3300032005 Bacteria 40183
454 Ga0316583_10054956 3300032133 Bacteria 1400
455 Ga0316583_10135685 3300032133 Bacteria 857
456 Ga0316585_10026141 3300032137 Bacteria 1813
457 Ga0316593_10012065 3300032168 Bacteria 2528
458 Ga0316596_1007743 3300033541 Bacteria 2544
459 Ga0373945_0154736 3300035116 Bacteria 931
460 Ga0373956_0191930 3300035119 Bacteria 967
461 Ga0373943_0262802 3300035170 Bacteria 972
462 Ga0316574_0050562 3300035398 Bacteria 2587
463 Ga0316574_0103129 3300035398 Bacteria 1826
464 Ga0373931_0186196 3300035691 Bacteria 1232
465 Ga0373931_0189163 3300035691 Bacteria 1224
466 Ga0373935_0024014 3300035692 Bacteria 3748
467 Ga0373927_0013717 3300035695 Bacteria 5380
468 Ga0373933_0326290 3300035724 Bacteria 996
469 Ga0373947_0011346 3300035725 Bacteria 5115
470 Ga0373937_0302455 3300036401 Bacteria 1512
471 Ga0373937_0395001 3300036401 Bacteria 1312
472 Ga0373937_0946341 3300036401 Bacteria 810
473 Ga0316582_0077427 3300036647 Bacteria 2164
474 Ga0316584_0214441 3300036712 Bacteria 1416
475 Ga0373925_0023031 3300037068 Bacteria 4545
476 Ga0316581_0092571 3300037588 Bacteria 930
477 Ga0451791_1069114 3300041451 Bacteria 961
478 Ga0451793_1183674 3300041452 Bacteria 926
479 Ga0451798_0182565 3300041458 Bacteria 1595
480 Ga0451800_1048118 3300041459 Bacteria 1042
481 Ga0451802_0675091 3300041460 Bacteria 1019
482 Ga0451807_0545829 3300041486 Bacteria 1270
483 Ga0451837_0610918 3300041494 Bacteria 1104
484 Ga0451843_1081050 3300041509 Unclassified 766
485 Ga0439448_0008586 3300042005 Bacteria 2994
486 Ga0439450_023743 3300042008 Unclassified 1333
487 Ga0451577_0000168 3300042876 Bacteria 144187
488 Ga0451577_0004136 3300042876 Bacteria 15551
489 Ga0451577_0056986 3300042876 Bacteria 3484
490 Ga0453684_0000642 3300044712 Bacteria 126116
491 Ga0453684_0078329 3300044712 Bacteria 4136
492 Ga0453684_0081004 3300044712 Bacteria 4051
493 Ga0453684_0082276 3300044712 Bacteria 4012
494 Ga0453684_0102584 3300044712 Bacteria 3497
495 Ga0451576_0185013 3300045051 Bacteria 2175
496 Ga0451576_0328737 3300045051 Bacteria 1600
497 Ga0495580_0123890 3300046472 Bacteria 1794
498 Ga0495630_0114451 3300046517 Bacteria 2044
499 Ga0495648_0070545 3300046524 Bacteria 2030
500 Ga0495658_0178633 3300046683 Bacteria 1316
501 Ga0495658_0246490 3300046683 Bacteria 1123
502 Ga0495624_0009675 3300046690 Bacteria 6674
503 Ga0495671_0125560 3300046692 Bacteria 1251
504 Ga0495674_0241349 3300047319 Bacteria 1489
505 Ga0495676_0010954 3300047321 Bacteria 8199
506 Ga0495602_0172370 3300048088 Bacteria 1678
507 Ga0496100_0000133 3300048903 Bacteria 41506
508 Ga0496101_0000661 3300048904 Bacteria 20755
509 Ga0496102_0205966 3300048905 Bacteria 1854
510 Ga0496103_0012076 3300048906 Bacteria 5130
511 Ga0496104_0616238 3300048907 Bacteria 995
512 Ga0496105_0332438 3300048908 Bacteria 1216
513 Ga0496105_0534599 3300048908 Bacteria 917
514 Ga0496106_0000992 3300048909 Bacteria 20718
515 Ga0496106_0114597 3300048909 Bacteria 2102
516 Ga0496107_0501879 3300048910 Bacteria 900
517 Ga0496108_0279919 3300048911 Bacteria 1452
518 Ga0496109_0000529 3300048912 Bacteria 32345
519 Ga0496109_0573604 3300048912 Bacteria 1064
520 Ga0496110_0013633 3300048913 Bacteria 6729
521 Ga0496110_0141582 3300048913 Bacteria 2174
522 Ga0496111_0006650 3300048914 Bacteria 7521
523 Ga0496113_0023631 3300048916 Bacteria 4359
524 Ga0496114_0001244 3300048917 Bacteria 19276
525 Ga0496116_0031538 3300048919 Bacteria 3792
526 Ga0496117_0000752 3300048920 Bacteria 51072
527 Ga0496118_0038785 3300048921 Bacteria 3812
528 Ga0496119_0014870 3300048922 Bacteria 6051
529 Ga0496121_0000027 3300048924 Bacteria 444747
530 Ga0496122_0000611 3300048925 Bacteria 73411
531 Ga0496123_0003205 3300048926 Bacteria 18661
532 Ga0496123_0063787 3300048926 Bacteria 2351
533 Ga0496124_0000016 3300048927 Bacteria 444747
534 Ga0496125_0000008 3300048928 Bacteria 704677
535 Ga0496126_0000025 3300048929 Bacteria 444747
536 Ga0496126_0017258 3300048929 Bacteria 7193
537 Ga0501069_0153713 3300049585 Bacteria 1323
538 Ga0501070_0000007 3300049586 Bacteria 219869
539 Ga0501079_0031117 3300049741 Bacteria 4101
540 Ga0501081_0116894 3300049743 Bacteria 1896
541 Ga0501083_0002000 3300049744 Bacteria 14027
542 nmdc:mga00v17_239889_c1 3300050491 Bacteria 1175
543 nmdc:mga0k408_19618_c1 3300050493 Bacteria 3781
544 nmdc:mga0k408_50155_c1 3300050493 Bacteria 2416
545 nmdc:mga0k408_85703_c1 3300050493 Bacteria 1849
546 nmdc:mga06z11_110865_c1 3300050494 Bacteria 1519
547 nmdc:mga07m45_176366_c1 3300050496 Bacteria 1243
548 nmdc:mga07m45_208756_c1 3300050496 Bacteria 1136
549 nmdc:mga07m45_5468_c1 3300050496 Bacteria 6325
550 nmdc:mga0qj67_361777_c1 3300050509 Bacteria 1172
551 nmdc:mga08y16_210431_c1 3300050511 Bacteria 2014
552 nmdc:mga08y16_61528_c1 3300050511 Bacteria 3920
553 Ga0495612_0177941 3300053078 Bacteria 933
554 Ga0495619_0017309 3300053085 Bacteria 4565
555 Ga0500641_0014674 3300053096 Bacteria 2894
556 Ga0500641_0043432 3300053096 Bacteria 1824
557 Ga0500588_0119327 3300053146 Bacteria 929
558 Ga0500645_027882 3300053730 Bacteria 1711
559 Ga0501082_0042165 3300060353 Bacteria 3934
560 2644305181 2643221654 Bacteria 5273570
561 2738668811 2738541264 Bacteria 5935393
562 2739148003 2738541356 Bacteria 5935017
563 2989392834 2989392574 Bacteria 4554005
564 Ga0070689_100127231
565 Ga0055540_1000231
566 Ga0065707_10049975
567 Ga0070676_10225468
568 Ga0070670_100028390
569 Ga0070670_100077873
570 Ga0070677_10000382
571 Ga0070677_10057419
572 Ga0068869_100000865
573 Ga0070666_10000758
574 Ga0070666_10058312
575 Ga0070680_100027471
576 Ga0070682_100036759
577 Ga0070682_100141760
578 Ga0068868_100013034
579 Ga0068868_100019465
580 Ga0068868_100023141
581 Ga0068868_100043514
582 Ga0068868_100464418
583 Ga0070687_100104610
584 Ga0070687_100213866
585 Ga0070661_100695694
586 Ga0070668_100001436
587 Ga0070668_100003834
588 Ga0070668_100005761
589 Ga0070668_100183826
590 Ga0070669_100009853
591 Ga0070669_100061188
592 Ga0070669_100068664
593 Ga0070675_100000463
594 Ga0070675_100001023
595 Ga0070675_100008274
596 Ga0070675_100167959
597 Ga0070671_100010891
598 Ga0070671_100021662
599 Ga0070671_100074683
600 Ga0070671_100130406
601 Ga0070674_100000094
602 Ga0070674_100008211
603 Ga0070674_100407246
604 Ga0070674_100636891
605 Ga0070673_100000753
606 Ga0070673_100002697
607 Ga0070673_100195151
608 Ga0070673_100212399
609 Ga0070673_100625613
610 Ga0070688_100041715
611 Ga0070659_100179555
612 Ga0070659_100688934
613 Ga0070667_100001746
614 Ga0070667_100006402
615 Ga0070667_100013445
616 Ga0070667_100017690
617 Ga0070667_100040533
618 Ga0070667_100044461
619 Ga0070713_100000020
620 Ga0070713_100381694
621 Ga0070711_100240581
622 Ga0070700_100040098
623 Ga0070700_100076953
624 Ga0070700_100179573
625 Ga0070708_100038472
626 Ga0070663_100304410
627 Ga0070678_100000409
628 Ga0070678_100103717
629 Ga0070678_100217398
630 Ga0070662_100157711
631 Ga0070662_100326084
632 Ga0070681_10118114
633 Ga0068867_100006509
634 Ga0068867_100008769
635 Ga0068867_100079353
636 Ga0068867_100290235
637 Ga0070685_10050616
638 Ga0070706_100017714
639 Ga0070707_100077286
640 Ga0070698_100071307
641 Ga0070699_100338673
642 Ga0070684_100702359
643 Ga0070684_100740714
644 Ga0068853_100000300
645 Ga0068853_100005616
646 Ga0068853_100005626
647 Ga0068853_100021946
648 Ga0068853_100069540
649 Ga0070672_100000552
650 Ga0070672_100001803
651 Ga0070672_100029609
652 Ga0070672_100089043
653 Ga0070672_100129261
654 Ga0070672_100152446
655 Ga0070672_100166921
656 Ga0070686_100057560
657 Ga0070665_100002419
658 Ga0070665_100009078
659 Ga0070665_100020178
660 Ga0070665_100025134
661 Ga0070665_100382044
662 Ga0070665_100383054
663 Ga0070665_100395323
664 Ga0070665_100724347
665 Ga0070704_100097565
666 Ga0068855_100276821
667 Ga0070664_100224438
668 Ga0068857_100008978
669 Ga0068857_100030542
670 Ga0068857_100110444
671 Ga0068856_100122077
672 Ga0070702_100084926
673 Ga0068852_100019333
674 Ga0068852_100270969
675 Ga0068852_100571108
676 Ga0068852_100695960
677 Ga0068859_100001747
678 Ga0068859_100052895
679 Ga0068859_100209850
680 Ga0068864_100008836
681 Ga0068864_100009680
682 Ga0068864_100014755
683 Ga0068864_100156525
684 Ga0068866_10153168
685 Ga0068866_10246877
686 Ga0068861_100000564
687 Ga0068861_100029241
688 Ga0068861_100086200
689 Ga0068861_100123958
690 Ga0068851_10000941
691 Ga0068851_10099000
692 Ga0068870_10042210
693 Ga0068870_10055677
694 Ga0068870_10127155
695 Ga0068863_100004874
696 Ga0068863_100022879
697 Ga0068863_100045403
698 Ga0068863_100061670
699 Ga0068863_100127749
700 Ga0068863_100305860
701 Ga0068863_100490523
702 Ga0068858_100011382
703 Ga0068858_100021251
704 Ga0068858_100058894
705 Ga0068858_100111244
706 Ga0068858_100284925
707 Ga0068858_100750236
708 Ga0068860_100025029
709 Ga0068860_100115312
710 Ga0068860_100147446
711 Ga0068860_100158482
712 Ga0068862_100031354
713 Ga0068862_100144529
714 Ga0068862_100145317
715 Ga0070717_10029680
716 Ga0075364_10181337
717 Ga0075367_10183240
718 Ga0075369_10000833
719 Ga0075369_10038299
720 Ga0075366_10073931
721 Ga0075366_10377159
722 Ga0097621_100018068
723 Ga0097621_100231089
724 Ga0075370_10019556
725 Ga0075370_10021653
726 Ga0075370_10134635
727 Ga0068871_100004702
728 Ga0068871_100032120
729 Ga0068865_100535886
730 Ga0097620_100001747
731 Ga0097620_100052895
732 Ga0097620_100209860
733 Ga0105240_10001580
734 Ga0105240_10055003
735 Ga0105240_10080523
736 Ga0111539_10017990
737 Ga0111539_10176415
738 Ga0105245_10016254
739 Ga0105245_10114570
740 Ga0105247_10107572
741 Ga0105247_10160628
742 Ga0105243_10179041
743 Ga0105243_10791060
744 Ga0105242_10043620
745 Ga0105242_10671956
746 Ga0105248_10016230
747 Ga0105248_10111238
748 Ga0105248_10316026
749 Ga0105248_10387261
750 Ga0105237_10001046
751 Ga0105237_10241639
752 Ga0105237_10264731
753 Ga0105238_10007419
754 Ga0105238_10246661
755 Ga0105238_10507360
756 Ga0105249_10108176
757 Ga0105249_10192611
758 Ga0105249_10277108
759 Ga0105249_10443358
760 Ga0105249_10793917
761 Ga0105239_10001284
762 Ga0105239_10366887
763 Ga0105239_10742594
764 Ga0157374_10063917
765 Ga0157374_10102567
766 Ga0157374_10284991
767 Ga0157374_10420358
768 Ga0157374_10440469
769 Ga0157378_10010166
770 Ga0157378_10016847
771 Ga0157378_10051384
772 Ga0157378_10275785
773 Ga0163162_10014935
774 Ga0163162_10041082
775 Ga0163162_10054481
776 Ga0163162_10216437
777 Ga0163162_10219098
778 Ga0157372_10241435
779 Ga0157375_10004106
780 Ga0157375_10011287
781 Ga0157375_10086690
782 Ga0157375_10105221
783 Ga0157375_10115214
784 Ga0157375_10138475
785 Ga0157375_10152956
786 Ga0157375_10180916
787 Ga0157375_10420408
788 Ga0157375_10442300
789 Ga0157375_11416751
790 Ga0163163_10078621
791 Ga0163163_10365842
792 Ga0163163_10507632
793 Ga0157380_10052009
794 Ga0157380_10061653
795 Ga0157380_10063192
796 Ga0157380_10185677
797 Ga0157380_10445550
798 Ga0157380_10797396
799 Ga0157379_10001057
800 Ga0157379_10002624
801 Ga0157379_10942414
802 Ga0157376_10038509
803 Ga0157376_10069703
804 Ga0157376_10289135
805 Ga0157376_10365782
806 Ga0157376_10658637
807 Ga0163161_10049193
808 Ga0163161_10117090
809 Ga0163161_10126069
810 Ga0163161_10244336
811 Ga0163161_10817916
812 Ga0209051_1000048
813 Ga0209257_1026414
814 Ga0207697_10014167
815 Ga0207656_10003408
816 Ga0207682_10002512
817 Ga0207642_10095909
818 Ga0207680_10041527
819 Ga0207645_10004706
820 Ga0207645_10007637
821 Ga0207645_10086099
822 Ga0207645_10178523
823 Ga0207645_10262855
824 Ga0207643_10041542
825 Ga0207643_10043562
826 Ga0207684_10003448
827 Ga0207684_10155772
828 Ga0207654_10091887
829 Ga0207707_10195205
830 Ga0207695_10013552
831 Ga0207671_10002719
832 Ga0207671_10127247
833 Ga0207660_10042148
834 Ga0207660_10318319
835 Ga0207662_10142365
836 Ga0207646_10333505
837 Ga0207681_10011126
838 Ga0207681_10014702
839 Ga0207694_10014747
840 Ga0207694_10024439
841 Ga0207694_10034092
842 Ga0207694_10114621
843 Ga0207694_10537259
844 Ga0207650_10016788
845 Ga0207650_10017344
846 Ga0207650_10018525
847 Ga0207650_10023927
848 Ga0207650_10095306
849 Ga0207659_10010777
850 Ga0207659_10016864
851 Ga0207659_10069050
852 Ga0207687_10004824
853 Ga0207687_10022894
854 Ga0207700_10000086
855 Ga0207700_10304540
856 Ga0207644_10001344
857 Ga0207644_10012267
858 Ga0207644_10083288
859 Ga0207644_10163159
860 Ga0207644_10165021
861 Ga0207706_10023984
862 Ga0207706_10136364
863 Ga0207706_10152693
864 Ga0207686_10580369
865 Ga0207709_10025299
866 Ga0207670_10010745
867 Ga0207669_10003485
868 Ga0207669_10008259
869 Ga0207669_10415108
870 Ga0207704_10242419
871 Ga0207704_10535206
872 Ga0207691_10000018
873 Ga0207691_10000509
874 Ga0207691_10003508
875 Ga0207691_10014158
876 Ga0207691_10033514
877 Ga0207691_10139309
878 Ga0207711_10073235
879 Ga0207711_10081316
880 Ga0207689_10000174
881 Ga0207689_10004337
882 Ga0207689_10421192
883 Ga0207661_10068898
884 Ga0207679_10206178
885 Ga0207651_10002164
886 Ga0207651_10002176
887 Ga0207651_10282497
888 Ga0207712_10313407
889 Ga0207668_10002010
890 Ga0207668_10002470
891 Ga0207668_10016568
892 Ga0207668_10029303
893 Ga0207668_10100816
894 Ga0207658_10008875
895 Ga0207658_10013016
896 Ga0207658_10016070
897 Ga0207658_10034666
898 Ga0207658_10051891
899 Ga0207658_10078755
900 Ga0207658_10082139
901 Ga0207658_10339222
902 Ga0207677_10003221
903 Ga0207677_10013142
904 Ga0207703_10193637
905 Ga0207703_10644804
906 Ga0207639_10000508
907 Ga0207639_10009051
908 Ga0207639_10090056
909 Ga0207639_10093910
910 Ga0207678_10006420
911 Ga0207708_10006963
912 Ga0207708_10080620
913 Ga0207708_10202874
914 Ga0207702_10278949
915 Ga0207641_10014012
916 Ga0207641_10027403
917 Ga0207641_10057332
918 Ga0207641_10099950
919 Ga0207641_10165395
920 Ga0207648_10001922
921 Ga0207648_10015731
922 Ga0207648_10033203
923 Ga0207648_10189296
924 Ga0207648_10220267
925 Ga0207648_10334797
926 Ga0207676_10010076
927 Ga0207676_10013354
928 Ga0207676_10034639
929 Ga0207676_10130273
930 Ga0207674_10041103
931 Ga0207674_10090058
932 Ga0207674_10581134
933 Ga0207675_100000847
934 Ga0207675_100021000
935 Ga0207675_100033377
936 Ga0207675_100058168
937 Ga0207683_10000020
938 Ga0207683_10002464
939 Ga0207683_10029090
940 Ga0207683_10137516
941 Ga0207698_10007168
942 Ga0207698_10208502
943 Ga0207428_10371703
944 Ga0268266_10013368
945 Ga0268266_10063383
946 Ga0268266_10078638
947 Ga0268266_10173632
948 Ga0268266_10335395
949 Ga0268266_10388485
950 Ga0268265_10028173
951 Ga0268265_10030373
952 Ga0268265_10134089
953 Ga0268265_10142539
954 Ga0268265_10631954
955 Ga0268264_10002310
956 Ga0268264_10152755
957 Ga0268264_10229254
958 Ga0268264_10254749
959 Ga0268264_10338371
960 Ga0268264_10388798
961 Ga0265319_1047676
962 Ga0265318_10000108
963 Ga0265318_10000878
964 Ga0265336_10002346
965 Ga0307517_10272545
966 Ga0265338_10004756
967 Ga0265338_10192985
968 Ga0265330_10000201
969 Ga0265330_10002606
970 Ga0265330_10005212
971 Ga0265332_10000255
972 Ga0265332_10000447
973 Ga0265332_10002933
974 Ga0265328_10000254
975 Ga0265328_10001319
976 Ga0265328_10002130
977 Ga0265328_10010589
978 Ga0265320_10000085
979 Ga0265320_10001256
980 Ga0265320_10002076
981 Ga0265320_10011178
982 Ga0265320_10061572
983 Ga0265325_10031821
984 Ga0265329_10003349
985 Ga0265329_10005103
986 Ga0265339_10003541
987 Ga0265339_10008026
988 Ga0265339_10084862
989 Ga0265331_10000179
990 Ga0265331_10000354
991 Ga0265331_10000762
992 Ga0265327_10028928
993 Ga0265316_10003342
994 Ga0265316_10003383
995 Ga0265316_10152207
996 Ga0265313_10000103
997 Ga0265313_10017259
998 Ga0265313_10018126
999 Ga0316579_10014904
1000 Ga0316579_10269876
1001 Ga0265314_10000235
1002 Ga0265314_10002694
1003 Ga0265314_10017420
1004 Ga0265314_10031242
1005 Ga0265342_10000463
1006 Ga0265342_10001967
1007 Ga0265342_10003566
1008 Ga0265342_10009235
1009 Ga0265342_10025498
1010 Ga0265342_10086579
1011 Ga0316578_10025420
1012 Ga0307516_10006932
1013 Ga0316577_10149253
1014 Ga0307518_10381583
1015 Ga0307414_10033653
1016 Ga0307411_10000039
1017 Ga0316583_10054956
1018 Ga0316583_10135685
1019 Ga0316585_10026141
1020 Ga0316593_10012065
1021 Ga0316596_1007743
1022 Ga0373945_0154736
1023 Ga0373956_0191930
1024 Ga0373943_0262802
1025 Ga0316574_0050562
1026 Ga0316574_0103129
1027 Ga0373931_0186196
1028 Ga0373931_0189163
1029 Ga0373935_0024014
1030 Ga0373927_0013717
1031 Ga0373933_0326290
1032 Ga0373947_0011346
1033 Ga0373937_0302455
1034 Ga0373937_0395001
1035 Ga0373937_0946341
1036 Ga0316582_0077427
1037 Ga0316584_0214441
1038 Ga0373925_0023031
1039 Ga0316581_0092571
1040 Ga0451791_1069114
1041 Ga0451793_1183674
1042 Ga0451798_0182565
1043 Ga0451800_1048118
1044 Ga0451802_0675091
1045 Ga0451807_0545829
1046 Ga0451837_0610918
1047 Ga0451843_1081050
1048 Ga0439448_0008586
1049 Ga0439450_023743
1050 Ga0451577_0000168
1051 Ga0451577_0004136
1052 Ga0451577_0056986
1053 Ga0453684_0000642
1054 Ga0453684_0078329
1055 Ga0453684_0081004
1056 Ga0453684_0082276
1057 Ga0453684_0102584
1058 Ga0451576_0185013
1059 Ga0451576_0328737
1060 Ga0495580_0123890
1061 Ga0495630_0114451
1062 Ga0495648_0070545
1063 Ga0495658_0178633
1064 Ga0495658_0246490
1065 Ga0495624_0009675
1066 Ga0495671_0125560
1067 Ga0495674_0241349
1068 Ga0495676_0010954
1069 Ga0495602_0172370
1070 Ga0496100_0000133
1071 Ga0496101_0000661
1072 Ga0496102_0205966
1073 Ga0496103_0012076
1074 Ga0496104_0616238
1075 Ga0496105_0332438
1076 Ga0496105_0534599
1077 Ga0496106_0000992
1078 Ga0496106_0114597
1079 Ga0496107_0501879
1080 Ga0496108_0279919
1081 Ga0496109_0000529
1082 Ga0496109_0573604
1083 Ga0496110_0013633
1084 Ga0496110_0141582
1085 Ga0496111_0006650
1086 Ga0496113_0023631
1087 Ga0496114_0001244
1088 Ga0496116_0031538
1089 Ga0496117_0000752
1090 Ga0496118_0038785
1091 Ga0496119_0014870
1092 Ga0496121_0000027
1093 Ga0496122_0000611
1094 Ga0496123_0003205
1095 Ga0496123_0063787
1096 Ga0496124_0000016
1097 Ga0496125_0000008
1098 Ga0496126_0000025
1099 Ga0496126_0017258
1100 Ga0501069_0153713
1101 Ga0501070_0000007
1102 Ga0501079_0031117
1103 Ga0501081_0116894
1104 Ga0501083_0002000
1105 nmdc:mga00v17_239889_c1
1106 nmdc:mga0k408_19618_c1
1107 nmdc:mga0k408_50155_c1
1108 nmdc:mga0k408_85703_c1
1109 nmdc:mga06z11_110865_c1
1110 nmdc:mga07m45_176366_c1
1111 nmdc:mga07m45_208756_c1
1112 nmdc:mga07m45_5468_c1
1113 nmdc:mga0qj67_361777_c1
1114 nmdc:mga08y16_210431_c1
1115 nmdc:mga08y16_61528_c1
1116 Ga0495612_0177941
1117 Ga0495619_0017309
1118 Ga0500641_0014674
1119 Ga0500641_0043432
1120 Ga0500588_0119327
1121 Ga0500645_027882
1122 Ga0501082_0042165
1123 2644305181
1124 2738668811
1125 2739148003
1126 2989392834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5loy-assembly2.cif.gz_D helical assembly of a designed anbu protein 0.9732 9 248
5nyw-assembly2.cif.gz_1 anbu (ancestral beta-subunit) from yersinia bercovieri 0.9725 9 247
5nyw-assembly2.cif.gz_O anbu (ancestral beta-subunit) from yersinia bercovieri 0.9707 9 247
5nyw-assembly2.cif.gz_W anbu (ancestral beta-subunit) from yersinia bercovieri 0.9699 9 248
5nyw-assembly1.cif.gz_M anbu (ancestral beta-subunit) from yersinia bercovieri 0.9697 9 247
ID Description Score Start End Superfamily
af_Q8T915_50_270_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8297 9 219 3.60.20.10
af_A4HV47_25_244_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8244 8 217 3.60.20.10
6qm8X00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8233 4 219 3.60.20.10
5lexN00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8137 9 223 3.60.20.10
af_Q966I8_19_219_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8111 6 219 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A356VN81-F1-model_v4 deleted 0.9861 120 199
AF-A0A352KM52-F1-model_v4 Peptidase 0.9811 122 248
AF-A0A833LSZ3-F1-model_v4 Proteasome-type protease 0.9789 8 248 GO:0005839
GO:0008233
GO:0051603
AF-M3AC61-F1-model_v4 Proteasome-type protease 0.9769 8 248 GO:0005839
GO:0008233
GO:0051603
AF-A0A7C9GSW5-F1-model_v4 Peptidase 0.9766 8 248 GO:0005839
GO:0051603

Map