F464016

General Info

Members Datasets Scaffolds Average Seq Length
563 185 563 252

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100306511|Ga0070668_1003065111
Length 257
Sequence MRKLTTITLALVFAYTSFTPMSAAVAKPADVAAAVAATSDRSEDNVKLDEGRKPAEVLSFLGLKTGMQAIDMFGGNRYWVEIMAPAVGPKGYVTVWEPTQFYNQEAADKFAAFQQKTPNTHLIVTPFEALALPTNAYDFMMINLNYHDVYWESAKYGVVRMEPEAFLKTVYASMKPGGIVGVIDHVGNLGDTRETVEKFHRIDPAVVKADFEKAGFKLDGESDILRNPADDHSLLVFNPQIRGKTDRFIYKFRKPAS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.73
Rhizosphere 96.09
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018382 3300001979 Bacteria 2481
2 JGI24739J22299_10006214 3300001989 Unclassified 4513
3 JGI24739J22299_10051028 3300001989 Bacteria 1336
4 JGI24737J22298_10001018 3300001990 Bacteria 9931
5 JGI24737J22298_10015221 3300001990 Bacteria 2491
6 JGI24743J22301_10002934 3300001991 Bacteria 2639
7 JGI24735J21928_10001119 3300002067 Bacteria 9616
8 JGI24735J21928_10009950 3300002067 Unclassified 3045
9 JGI24738J21930_10002699 3300002075 Unclassified 4571
10 rootH2_10021211 3300003320 Bacteria 2355
11 Ga0065712_10179321 3300005290 Bacteria 1195
12 Ga0070658_10006601 3300005327 Bacteria 9405
13 Ga0070658_10006865 3300005327 Bacteria 9202
14 Ga0070676_10029658 3300005328 Bacteria 3113
15 Ga0070683_100007532 3300005329 Bacteria 9203
16 Ga0070683_100120812 3300005329 Unclassified 2475
17 Ga0070690_100001887 3300005330 Bacteria 11122
18 Ga0070690_100013661 3300005330 Unclassified 4805
19 Ga0070670_100021348 3300005331 Bacteria 5571
20 Ga0070670_100092745 3300005331 Bacteria 2597
21 Ga0070670_100105345 3300005331 Bacteria 2430
22 Ga0070670_100314901 3300005331 Bacteria 1370
23 Ga0070670_100315006 3300005331 Bacteria 1370
24 Ga0070677_10000369 3300005333 Bacteria 15838
25 Ga0070666_10001159 3300005335 Bacteria 16007
26 Ga0070666_10003944 3300005335 Bacteria 9012
27 Ga0070666_10055060 3300005335 Bacteria 2684
28 Ga0070680_100265494 3300005336 Bacteria 1453
29 Ga0070682_100045835 3300005337 Bacteria 2712
30 Ga0068868_100022629 3300005338 Bacteria 4747
31 Ga0070660_100000877 3300005339 Bacteria 20087
32 Ga0070660_100009198 3300005339 Bacteria 6942
33 Ga0070660_100036976 3300005339 Bacteria 3700
34 Ga0070660_100088962 3300005339 Unclassified 2432
35 Ga0070660_100099727 3300005339 Bacteria 2300
36 Ga0070660_100180374 3300005339 Bacteria 1709
37 Ga0070660_100614393 3300005339 Unclassified 909
38 Ga0070687_100078358 3300005343 Bacteria 1796
39 Ga0070661_100000033 3300005344 Bacteria 111757
40 Ga0070661_100047187 3300005344 Unclassified 3152
41 Ga0070661_100117540 3300005344 Bacteria 1989
42 Ga0070661_100213657 3300005344 Bacteria 1477
43 Ga0070692_10030352 3300005345 Bacteria 2702
44 Ga0070692_10302710 3300005345 Unclassified 977
45 Ga0070668_100023818 3300005347 Bacteria 4634
46 Ga0070668_100306511 3300005347 Bacteria 1333
47 Ga0070669_100014864 3300005353 Bacteria 5546
48 Ga0070675_100007737 3300005354 Bacteria 8317
49 Ga0070675_100011928 3300005354 Bacteria 6809
50 Ga0070675_100035689 3300005354 Bacteria 4042
51 Ga0070675_100195526 3300005354 Bacteria 1754
52 Ga0070675_100499460 3300005354 Bacteria 1096
53 Ga0070671_100002272 3300005355 Bacteria 14832
54 Ga0070671_100020497 3300005355 Bacteria 5392
55 Ga0070671_100033857 3300005355 Bacteria 4228
56 Ga0070671_100059847 3300005355 Bacteria 3170
57 Ga0070671_100162628 3300005355 Bacteria 1887
58 Ga0070671_100311224 3300005355 Bacteria 1341
59 Ga0070674_100021148 3300005356 Bacteria 4171
60 Ga0070674_100054817 3300005356 Bacteria 2758
61 Ga0070674_100062865 3300005356 Bacteria 2596
62 Ga0070674_100101197 3300005356 Unclassified 2100
63 Ga0070673_100005516 3300005364 Bacteria 8104
64 Ga0070673_100018258 3300005364 Bacteria 5007
65 Ga0070673_100045086 3300005364 Bacteria 3417
66 Ga0070673_100109041 3300005364 Bacteria 2293
67 Ga0070673_100327007 3300005364 Bacteria 1355
68 Ga0070659_100005681 3300005366 Bacteria 8973
69 Ga0070659_100006282 3300005366 Bacteria 8588
70 Ga0070659_100007599 3300005366 Bacteria 7880
71 Ga0070659_100007865 3300005366 Bacteria 7763
72 Ga0070659_100016006 3300005366 Bacteria 5626
73 Ga0070659_100021219 3300005366 Bacteria 4942
74 Ga0070659_100038873 3300005366 Bacteria 3712
75 Ga0070659_100039612 3300005366 Bacteria 3679
76 Ga0070659_100055808 3300005366 Bacteria 3114
77 Ga0070659_100086311 3300005366 Bacteria 2511
78 Ga0070659_100107042 3300005366 Unclassified 2254
79 Ga0070659_100583262 3300005366 Bacteria 959
80 Ga0070667_100018096 3300005367 Bacteria 5841
81 Ga0070667_100039457 3300005367 Bacteria 3958
82 Ga0070667_100046568 3300005367 Bacteria 3649
83 Ga0070667_100053746 3300005367 Bacteria 3399
84 Ga0070667_100352755 3300005367 Bacteria 1332
85 Ga0070663_100001259 3300005455 Bacteria 13908
86 Ga0070663_100004559 3300005455 Bacteria 8165
87 Ga0070678_100005530 3300005456 Bacteria 7321
88 Ga0070678_100015725 3300005456 Bacteria 4817
89 Ga0070678_100057106 3300005456 Bacteria 2858
90 Ga0070662_100000021 3300005457 Bacteria 93909
91 Ga0070662_100000425 3300005457 Bacteria 25023
92 Ga0070662_100013930 3300005457 Bacteria 5357
93 Ga0070662_100018379 3300005457 Bacteria 4728
94 Ga0070662_100021344 3300005457 Bacteria 4421
95 Ga0070662_100029440 3300005457 Bacteria 3832
96 Ga0070662_100041827 3300005457 Bacteria 3272
97 Ga0070662_100146076 3300005457 Unclassified 1837
98 Ga0070662_100181331 3300005457 Bacteria 1660
99 Ga0070662_100234025 3300005457 Bacteria 1471
100 Ga0070662_100516206 3300005457 Bacteria 998
101 Ga0070681_10034708 3300005458 Bacteria 5065
102 Ga0070681_10220814 3300005458 Unclassified 1810
103 Ga0068867_100002266 3300005459 Bacteria 13531
104 Ga0068867_100016953 3300005459 Bacteria 5176
105 Ga0070679_100063837 3300005530 Unclassified 3671
106 Ga0070679_100114501 3300005530 Bacteria 2682
107 Ga0070679_100179256 3300005530 Unclassified 2091
108 Ga0070679_100619762 3300005530 Bacteria 1025
109 Ga0070679_100861413 3300005530 Bacteria 849
110 Ga0070684_100110508 3300005535 Bacteria 2465
111 Ga0070684_100148560 3300005535 Bacteria 2122
112 Ga0068853_100000220 3300005539 Bacteria 40376
113 Ga0068853_100032678 3300005539 Bacteria 4410
114 Ga0068853_100034974 3300005539 Bacteria 4265
115 Ga0068853_100155169 3300005539 Bacteria 2063
116 Ga0068853_100584855 3300005539 Bacteria 1059
117 Ga0070672_100032880 3300005543 Bacteria 3921
118 Ga0070672_100089563 3300005543 Unclassified 2479
119 Ga0070672_100657865 3300005543 Bacteria 915
120 Ga0070686_100034610 3300005544 Bacteria 3114
121 Ga0070693_100020549 3300005547 Bacteria 3484
122 Ga0070693_100059932 3300005547 Bacteria 2208
123 Ga0070665_100001858 3300005548 Bacteria 23957
124 Ga0070665_100011029 3300005548 Bacteria 9133
125 Ga0070665_100053760 3300005548 Bacteria 4039
126 Ga0070665_100233770 3300005548 Unclassified 1838
127 Ga0068855_100001017 3300005563 Bacteria 34928
128 Ga0068855_100034766 3300005563 Bacteria 6006
129 Ga0070664_100000127 3300005564 Bacteria 51101
130 Ga0070664_100001413 3300005564 Bacteria 19196
131 Ga0070664_100125429 3300005564 Bacteria 2251
132 Ga0070664_100172698 3300005564 Unclassified 1918
133 Ga0070664_100765121 3300005564 Bacteria 902
134 Ga0068857_100031562 3300005577 Bacteria 4682
135 Ga0068857_100103002 3300005577 Bacteria 2563
136 Ga0068857_100233338 3300005577 Bacteria 1683
137 Ga0068857_100526984 3300005577 Unclassified 1111
138 Ga0068854_100012148 3300005578 Bacteria 5633
139 Ga0068854_100013314 3300005578 Bacteria 5395
140 Ga0068854_100045382 3300005578 Bacteria 3125
141 Ga0068854_100113157 3300005578 Bacteria 2050
142 Ga0068854_100161727 3300005578 Unclassified 1735
143 Ga0068856_100000177 3300005614 Bacteria 66207
144 Ga0068856_100099579 3300005614 Bacteria 2898
145 Ga0068856_100173676 3300005614 Bacteria 2167
146 Ga0068856_100213133 3300005614 Bacteria 1947
147 Ga0068856_100537435 3300005614 Unclassified 1190
148 Ga0068852_100005050 3300005616 Bacteria 9387
149 Ga0068852_100044035 3300005616 Bacteria 3788
150 Ga0068852_100052579 3300005616 Unclassified 3501
151 Ga0068852_100054987 3300005616 Bacteria 3434
152 Ga0068852_100068472 3300005616 Bacteria 3107
153 Ga0068852_100357110 3300005616 Bacteria 1428
154 Ga0068859_100003970 3300005617 Bacteria 15093
155 Ga0068859_100083625 3300005617 Unclassified 3235
156 Ga0068864_100012223 3300005618 Bacteria 7095
157 Ga0068864_100028179 3300005618 Bacteria 4746
158 Ga0068864_100041159 3300005618 Unclassified 3952
159 Ga0068864_100096926 3300005618 Bacteria 2611
160 Ga0068866_10009487 3300005718 Bacteria 4133
161 Ga0068851_10163511 3300005834 Bacteria 1224
162 Ga0068851_10251781 3300005834 Unclassified 1002
163 Ga0068851_10255601 3300005834 Unclassified 995
164 Ga0068858_100008562 3300005842 Bacteria 9828
165 Ga0068858_100026535 3300005842 Bacteria 5381
166 Ga0068858_100251292 3300005842 Bacteria 1679
167 Ga0068858_100442799 3300005842 Bacteria 1251
168 Ga0068860_100026769 3300005843 Bacteria 5557
169 Ga0068860_100478675 3300005843 Unclassified 1241
170 Ga0068862_100017421 3300005844 Bacteria 5983
171 Ga0097621_100018095 3300006237 Bacteria 5373
172 Ga0097621_100108300 3300006237 Bacteria 2345
173 Ga0097621_100310151 3300006237 Bacteria 1396
174 Ga0097621_100497016 3300006237 Bacteria 1104
175 Ga0068871_100008583 3300006358 Bacteria 7345
176 Ga0068871_100028347 3300006358 Bacteria 4389
177 Ga0068871_100065730 3300006358 Bacteria 2971
178 Ga0068865_100016743 3300006881 Bacteria 4699
179 Ga0068865_100099898 3300006881 Bacteria 2122
180 Ga0097620_100003970 3300006931 Bacteria 15093
181 Ga0097620_100083625 3300006931 Unclassified 3235
182 Ga0105240_10427770 3300009093 Bacteria 1486
183 Ga0105245_10029375 3300009098 Bacteria 4855
184 Ga0105247_10246099 3300009101 Unclassified 1220
185 Ga0105241_10011915 3300009174 Bacteria 6388
186 Ga0105241_10268083 3300009174 Bacteria 1454
187 Ga0105242_10003949 3300009176 Bacteria 11520
188 Ga0105248_10002904 3300009177 Bacteria 19020
189 Ga0105248_10031785 3300009177 Bacteria 5898
190 Ga0105248_10065350 3300009177 Bacteria 4085
191 Ga0105248_10072961 3300009177 Bacteria 3857
192 Ga0105248_10145023 3300009177 Bacteria 2679
193 Ga0105248_10295055 3300009177 Bacteria 1826
194 Ga0105238_10008220 3300009551 Bacteria 10438
195 Ga0105238_10015109 3300009551 Bacteria 7821
196 Ga0105238_10076447 3300009551 Bacteria 3339
197 Ga0105238_10188133 3300009551 Bacteria 2041
198 Ga0105249_10066917 3300009553 Bacteria 3309
199 Ga0105239_10055565 3300010375 Bacteria 4342
200 Ga0105246_10023424 3300011119 Bacteria 3995
201 Ga0157373_10005905 3300013100 Bacteria 9162
202 Ga0157373_10015225 3300013100 Bacteria 5624
203 Ga0157373_10019900 3300013100 Bacteria 4882
204 Ga0157373_10032283 3300013100 Bacteria 3769
205 Ga0157373_10117328 3300013100 Bacteria 1871
206 Ga0157373_10124908 3300013100 Unclassified 1809
207 Ga0157373_10539851 3300013100 Bacteria 845
208 Ga0157371_10000934 3300013102 Bacteria 32706
209 Ga0157371_10004403 3300013102 Bacteria 12311
210 Ga0157371_10009947 3300013102 Bacteria 7443
211 Ga0157370_10029982 3300013104 Bacteria 5332
212 Ga0157370_10069237 3300013104 Unclassified 3333
213 Ga0157370_10147346 3300013104 Bacteria 2191
214 Ga0157370_10255274 3300013104 Bacteria 1621
215 Ga0157369_10114745 3300013105 Unclassified 2860
216 Ga0157369_10406777 3300013105 Bacteria 1412
217 Ga0157374_10005377 3300013296 Bacteria 10757
218 Ga0157374_10021680 3300013296 Bacteria 5721
219 Ga0157374_10149573 3300013296 Bacteria 2269
220 Ga0157374_10260035 3300013296 Bacteria 1709
221 Ga0157378_10016413 3300013297 Bacteria 6483
222 Ga0157378_10032316 3300013297 Bacteria 4624
223 Ga0157378_10385460 3300013297 Bacteria 1377
224 Ga0163162_10015290 3300013306 Bacteria 7497
225 Ga0163162_10133872 3300013306 Bacteria 2589
226 Ga0163162_10189958 3300013306 Bacteria 2181
227 Ga0157372_10017691 3300013307 Bacteria 7651
228 Ga0157372_10068359 3300013307 Bacteria 3993
229 Ga0157375_10001828 3300013308 Bacteria 18269
230 Ga0157375_10007587 3300013308 Bacteria 9488
231 Ga0157375_10019815 3300013308 Bacteria 6130
232 Ga0157375_10195449 3300013308 Bacteria 2178
233 Ga0157375_10242110 3300013308 Unclassified 1963
234 Ga0163163_10000587 3300014325 Bacteria 32106
235 Ga0163163_10022760 3300014325 Bacteria 5938
236 Ga0163163_10073173 3300014325 Bacteria 3417
237 Ga0163163_10260965 3300014325 Bacteria 1783
238 Ga0157377_10193962 3300014745 Bacteria 1285
239 Ga0157379_10030156 3300014968 Bacteria 4825
240 Ga0157376_10007200 3300014969 Bacteria 7912
241 Ga0157376_10298469 3300014969 Bacteria 1524
242 Ga0163161_10001848 3300017792 Bacteria 15466
243 Ga0207697_10029959 3300025315 Bacteria 2227
244 Ga0207656_10002771 3300025321 Bacteria 5952
245 Ga0207656_10003187 3300025321 Bacteria 5607
246 Ga0207656_10183682 3300025321 Bacteria 1005
247 Ga0207682_10000308 3300025893 Bacteria 22087
248 Ga0207642_10085005 3300025899 Bacteria 1547
249 Ga0207688_10054181 3300025901 Bacteria 2250
250 Ga0207680_10003483 3300025903 Bacteria 7410
251 Ga0207680_10004450 3300025903 Bacteria 6648
252 Ga0207680_10271163 3300025903 Bacteria 1177
253 Ga0207680_10319022 3300025903 Bacteria 1086
254 Ga0207647_10009118 3300025904 Bacteria 7064
255 Ga0207647_10011465 3300025904 Bacteria 6216
256 Ga0207647_10048890 3300025904 Bacteria 2625
257 Ga0207647_10081893 3300025904 Bacteria 1934
258 Ga0207705_10001151 3300025909 Bacteria 21513
259 Ga0207705_10004175 3300025909 Bacteria 10958
260 Ga0207705_10007147 3300025909 Bacteria 8231
261 Ga0207705_10021921 3300025909 Bacteria 4557
262 Ga0207705_10052063 3300025909 Unclassified 2946
263 Ga0207705_10081665 3300025909 Bacteria 2356
264 Ga0207705_10103189 3300025909 Bacteria 2100
265 Ga0207705_10151066 3300025909 Unclassified 1740
266 Ga0207707_10024428 3300025912 Bacteria 5288
267 Ga0207707_10066941 3300025912 Bacteria 3128
268 Ga0207695_10037215 3300025913 Bacteria 5252
269 Ga0207695_10655436 3300025913 Unclassified 931
270 Ga0207660_10003520 3300025917 Bacteria 10203
271 Ga0207660_10411547 3300025917 Bacteria 1090
272 Ga0207662_10051154 3300025918 Bacteria 2457
273 Ga0207657_10000173 3300025919 Bacteria 66220
274 Ga0207657_10000863 3300025919 Bacteria 31953
275 Ga0207657_10001033 3300025919 Bacteria 29450
276 Ga0207657_10009692 3300025919 Bacteria 9661
277 Ga0207657_10014714 3300025919 Bacteria 7619
278 Ga0207657_10025795 3300025919 Bacteria 5413
279 Ga0207657_10039304 3300025919 Bacteria 4206
280 Ga0207657_10047945 3300025919 Bacteria 3731
281 Ga0207657_10058442 3300025919 Bacteria 3318
282 Ga0207657_10128027 3300025919 Bacteria 2084
283 Ga0207657_10136539 3300025919 Bacteria 2006
284 Ga0207657_10146339 3300025919 Unclassified 1927
285 Ga0207657_10307417 3300025919 Bacteria 1255
286 Ga0207657_10309841 3300025919 Bacteria 1250
287 Ga0207649_10000014 3300025920 Bacteria 255001
288 Ga0207649_10328768 3300025920 Bacteria 1125
289 Ga0207649_10329443 3300025920 Unclassified 1124
290 Ga0207652_10030919 3300025921 Bacteria 4490
291 Ga0207652_10148251 3300025921 Unclassified 2100
292 Ga0207681_10074385 3300025923 Bacteria 2380
293 Ga0207681_10076844 3300025923 Bacteria 2346
294 Ga0207694_10010505 3300025924 Bacteria 6985
295 Ga0207694_10047887 3300025924 Bacteria 3306
296 Ga0207650_10038246 3300025925 Bacteria 3503
297 Ga0207650_10328072 3300025925 Bacteria 1255
298 Ga0207659_10029132 3300025926 Unclassified 3760
299 Ga0207659_10041144 3300025926 Bacteria 3236
300 Ga0207659_10049212 3300025926 Bacteria 2989
301 Ga0207644_10000812 3300025931 Bacteria 19829
302 Ga0207644_10007571 3300025931 Bacteria 7079
303 Ga0207644_10023238 3300025931 Bacteria 4244
304 Ga0207644_10123986 3300025931 Bacteria 1970
305 Ga0207644_10228755 3300025931 Unclassified 1477
306 Ga0207690_10000150 3300025932 Bacteria 55157
307 Ga0207690_10007622 3300025932 Bacteria 6420
308 Ga0207690_10009493 3300025932 Bacteria 5779
309 Ga0207690_10045147 3300025932 Bacteria 2909
310 Ga0207690_10048794 3300025932 Bacteria 2818
311 Ga0207690_10066743 3300025932 Bacteria 2465
312 Ga0207690_10094814 3300025932 Unclassified 2118
313 Ga0207690_10185004 3300025932 Bacteria 1571
314 Ga0207690_10294984 3300025932 Bacteria 1267
315 Ga0207706_10000358 3300025933 Bacteria 49357
316 Ga0207706_10000582 3300025933 Bacteria 38878
317 Ga0207706_10002597 3300025933 Bacteria 17590
318 Ga0207706_10006116 3300025933 Bacteria 11181
319 Ga0207706_10016022 3300025933 Bacteria 6774
320 Ga0207706_10017106 3300025933 Bacteria 6538
321 Ga0207706_10017528 3300025933 Bacteria 6455
322 Ga0207706_10017713 3300025933 Bacteria 6416
323 Ga0207706_10034456 3300025933 Bacteria 4504
324 Ga0207706_10117878 3300025933 Bacteria 2335
325 Ga0207706_10201089 3300025933 Bacteria 1747
326 Ga0207706_10218924 3300025933 Unclassified 1667
327 Ga0207706_10224160 3300025933 Bacteria 1645
328 Ga0207706_10394136 3300025933 Unclassified 1201
329 Ga0207670_10279158 3300025936 Bacteria 1301
330 Ga0207669_10139965 3300025937 Bacteria 1678
331 Ga0207704_10312198 3300025938 Bacteria 1209
332 Ga0207691_10003105 3300025940 Bacteria 16216
333 Ga0207691_10014546 3300025940 Bacteria 7504
334 Ga0207691_10094337 3300025940 Bacteria 2678
335 Ga0207691_10188513 3300025940 Bacteria 1800
336 Ga0207711_10001672 3300025941 Bacteria 20424
337 Ga0207711_10009489 3300025941 Bacteria 8119
338 Ga0207711_10057505 3300025941 Unclassified 3343
339 Ga0207711_10257176 3300025941 Bacteria 1604
340 Ga0207661_10002288 3300025944 Bacteria 13191
341 Ga0207661_10056706 3300025944 Unclassified 3146
342 Ga0207679_10003009 3300025945 Bacteria 10454
343 Ga0207679_10125902 3300025945 Bacteria 2047
344 Ga0207667_10001713 3300025949 Bacteria 27586
345 Ga0207667_10551773 3300025949 Bacteria 1165
346 Ga0207667_10723864 3300025949 Bacteria 996
347 Ga0207651_10018110 3300025960 Bacteria 4182
348 Ga0207651_10028832 3300025960 Bacteria 3508
349 Ga0207651_10102903 3300025960 Bacteria 2124
350 Ga0207651_10143651 3300025960 Bacteria 1847
351 Ga0207651_10495587 3300025960 Bacteria 1055
352 Ga0207712_10008209 3300025961 Bacteria 6598
353 Ga0207668_10046179 3300025972 Bacteria 2975
354 Ga0207640_10004923 3300025981 Bacteria 7254
355 Ga0207640_10022494 3300025981 Bacteria 3774
356 Ga0207640_10054175 3300025981 Bacteria 2621
357 Ga0207640_10126092 3300025981 Bacteria 1843
358 Ga0207640_10146478 3300025981 Bacteria 1729
359 Ga0207640_10225008 3300025981 Bacteria 1439
360 Ga0207658_10027919 3300025986 Bacteria 3970
361 Ga0207658_10032293 3300025986 Bacteria 3725
362 Ga0207658_10334954 3300025986 Bacteria 1314
363 Ga0207658_10523830 3300025986 Bacteria 1058
364 Ga0207658_10639043 3300025986 Unclassified 958
365 Ga0207658_10643930 3300025986 Unclassified 955
366 Ga0207677_10008452 3300026023 Bacteria 5752
367 Ga0207677_10262697 3300026023 Bacteria 1408
368 Ga0207703_10012252 3300026035 Bacteria 6686
369 Ga0207703_10291783 3300026035 Bacteria 1485
370 Ga0207703_10293665 3300026035 Unclassified 1480
371 Ga0207639_10000581 3300026041 Bacteria 25117
372 Ga0207639_10001048 3300026041 Bacteria 18783
373 Ga0207639_10021541 3300026041 Bacteria 4630
374 Ga0207639_10082577 3300026041 Bacteria 2548
375 Ga0207639_10231294 3300026041 Bacteria 1602
376 Ga0207639_10348442 3300026041 Bacteria 1322
377 Ga0207639_10538190 3300026041 Bacteria 1071
378 Ga0207639_10601654 3300026041 Bacteria 1014
379 Ga0207678_10001299 3300026067 Bacteria 23141
380 Ga0207678_10014579 3300026067 Bacteria 6915
381 Ga0207678_10022803 3300026067 Bacteria 5482
382 Ga0207678_10030864 3300026067 Bacteria 4678
383 Ga0207678_10111686 3300026067 Bacteria 2332
384 Ga0207678_10582226 3300026067 Bacteria 980
385 Ga0207702_10002591 3300026078 Bacteria 16993
386 Ga0207702_10054450 3300026078 Bacteria 3390
387 Ga0207702_10079332 3300026078 Unclassified 2845
388 Ga0207702_10162423 3300026078 Bacteria 2041
389 Ga0207702_10379914 3300026078 Bacteria 1358
390 Ga0207702_10559356 3300026078 Bacteria 1119
391 Ga0207641_10055177 3300026088 Bacteria 3373
392 Ga0207648_10003823 3300026089 Bacteria 15732
393 Ga0207648_10044795 3300026089 Bacteria 3882
394 Ga0207676_10083882 3300026095 Unclassified 2596
395 Ga0207676_10139775 3300026095 Unclassified 2071
396 Ga0207676_10152229 3300026095 Bacteria 1993
397 Ga0207676_10814075 3300026095 Bacteria 912
398 Ga0207674_10016657 3300026116 Bacteria 8035
399 Ga0207674_10533001 3300026116 Unclassified 1134
400 Ga0207675_100202343 3300026118 Bacteria 1908
401 Ga0207683_10001741 3300026121 Bacteria 19346
402 Ga0207683_10014751 3300026121 Bacteria 6651
403 Ga0207683_10016564 3300026121 Bacteria 6275
404 Ga0207698_10008129 3300026142 Bacteria 6613
405 Ga0207698_10013712 3300026142 Bacteria 5360
406 Ga0207698_10023714 3300026142 Bacteria 4291
407 Ga0207698_10025393 3300026142 Unclassified 4174
408 Ga0207698_10043417 3300026142 Bacteria 3368
409 Ga0207698_10067323 3300026142 Bacteria 2823
410 Ga0209983_1017198 3300027665 Unclassified 1495
411 Ga0209974_10002531 3300027876 Bacteria 6630
412 Ga0268266_10003459 3300028379 Bacteria 15752
413 Ga0268266_10065165 3300028379 Unclassified 3149
414 Ga0268264_10203633 3300028381 Bacteria 1812
415 Ga0307408_100021346 3300031548 Bacteria 4382
416 Ga0307405_10002928 3300031731 Bacteria 7701
417 Ga0307405_10049861 3300031731 Bacteria 2590
418 Ga0307405_10119632 3300031731 Bacteria 1800
419 Ga0307413_10016220 3300031824 Bacteria 3840
420 Ga0307413_10142445 3300031824 Bacteria 1658
421 Ga0307413_10153127 3300031824 Bacteria 1609
422 Ga0307410_10014640 3300031852 Bacteria 4623
423 Ga0307410_10034860 3300031852 Bacteria 3263
424 Ga0307410_10040478 3300031852 Bacteria 3067
425 Ga0307410_10053923 3300031852 Unclassified 2723
426 Ga0307410_10058358 3300031852 Bacteria 2631
427 Ga0307410_10117361 3300031852 Bacteria 1935
428 Ga0307410_10442795 3300031852 Bacteria 1058
429 Ga0307406_10052494 3300031901 Bacteria 2593
430 Ga0307406_10073916 3300031901 Bacteria 2243
431 Ga0307407_10004991 3300031903 Bacteria 5709
432 Ga0307407_10041841 3300031903 Unclassified 2565
433 Ga0307407_10055706 3300031903 Bacteria 2286
434 Ga0307407_10299906 3300031903 Bacteria 1120
435 Ga0307412_10008364 3300031911 Bacteria 5901
436 Ga0307412_10020808 3300031911 Bacteria 3998
437 Ga0307412_10032143 3300031911 Bacteria 3321
438 Ga0307412_10222706 3300031911 Bacteria 1447
439 Ga0307409_100004917 3300031995 Bacteria 7605
440 Ga0307409_100095103 3300031995 Bacteria 2454
441 Ga0307409_100240546 3300031995 Bacteria 1647
442 Ga0307409_100340155 3300031995 Unclassified 1411
443 Ga0307416_100001807 3300032002 Bacteria 11886
444 Ga0307416_100100953 3300032002 Bacteria 2511
445 Ga0307416_100291655 3300032002 Bacteria 1615
446 Ga0307414_10003774 3300032004 Bacteria 8139
447 Ga0307414_10109248 3300032004 Unclassified 2100
448 Ga0307414_10113103 3300032004 Unclassified 2071
449 Ga0307414_10669769 3300032004 Bacteria 937
450 Ga0307411_10006730 3300032005 Bacteria 5779
451 Ga0307411_10021155 3300032005 Bacteria 3800
452 Ga0307411_10058753 3300032005 Bacteria 2546
453 Ga0307411_10068787 3300032005 Bacteria 2388
454 Ga0307411_10150399 3300032005 Bacteria 1729
455 Ga0307411_10182148 3300032005 Bacteria 1595
456 Ga0307411_10210316 3300032005 Unclassified 1501
457 Ga0307415_100006693 3300032126 Bacteria 6240
458 Ga0307415_100067584 3300032126 Bacteria 2498
459 Ga0373931_0300618 3300035691 Unclassified 991
460 Ga0373937_0666869 3300036401 Bacteria 986
461 Ga0395899_0006347 3300037312 Bacteria 9153
462 Ga0395899_0027401 3300037312 Bacteria 4297
463 Ga0395899_0048033 3300037312 Bacteria 3176
464 Ga0395899_0310488 3300037312 Bacteria 1065
465 Ga0395899_0334588 3300037312 Unclassified 1017
466 Ga0395900_0028072 3300037418 Bacteria 5762
467 Ga0395900_0059869 3300037418 Bacteria 3920
468 Ga0395900_0102666 3300037418 Unclassified 2937
469 Ga0395900_0168033 3300037418 Unclassified 2234
470 Ga0395900_0177111 3300037418 Bacteria 2168
471 Ga0395900_0271651 3300037418 Unclassified 1690
472 Ga0395900_0283626 3300037418 Unclassified 1647
473 Ga0395900_0488944 3300037418 Unclassified 1182
474 Ga0395898_0004715 3300037466 Bacteria 14837
475 Ga0395898_0027924 3300037466 Bacteria 5659
476 Ga0395898_0047540 3300037466 Bacteria 4210
477 Ga0395898_0071542 3300037466 Bacteria 3351
478 Ga0395898_0081507 3300037466 Bacteria 3120
479 Ga0395898_0090083 3300037466 Bacteria 2952
480 Ga0395898_0321482 3300037466 Unclassified 1476
481 Ga0395898_0351530 3300037466 Bacteria 1405
482 Ga0395905_0025061 3300037471 Bacteria 5626
483 Ga0395905_0039770 3300037471 Bacteria 4413
484 Ga0395905_0052049 3300037471 Bacteria 3835
485 Ga0395905_0060642 3300037471 Bacteria 3537
486 Ga0395905_0097843 3300037471 Bacteria 2755
487 Ga0395905_0204575 3300037471 Bacteria 1850
488 Ga0395905_0430752 3300037471 Unclassified 1216
489 Ga0395901_0042951 3300038443 Bacteria 4689
490 Ga0395901_0051450 3300038443 Bacteria 4283
491 Ga0395901_0078943 3300038443 Bacteria 3436
492 Ga0395901_0086651 3300038443 Bacteria 3274
493 Ga0395901_0110176 3300038443 Unclassified 2891
494 Ga0395901_0148489 3300038443 Unclassified 2463
495 Ga0395901_0171003 3300038443 Bacteria 2280
496 Ga0395901_0215926 3300038443 Unclassified 2006
497 Ga0395901_0682132 3300038443 Bacteria 1027
498 Ga0395901_0929355 3300038443 Unclassified 850
499 Ga0466972_0016362 3300044658 Bacteria 3709
500 Ga0466966_0004450 3300044684 Bacteria 9242
501 Ga0466966_0016018 3300044684 Bacteria 4957
502 Ga0466961_0001957 3300044693 Bacteria 12837
503 Ga0466961_0125925 3300044693 Unclassified 1607
504 Ga0466961_0177519 3300044693 Unclassified 1323
505 Ga0466963_0000903 3300044694 Bacteria 15076
506 Ga0466963_0026925 3300044694 Bacteria 3678
507 Ga0466963_0047085 3300044694 Bacteria 2845
508 Ga0466963_0246309 3300044694 Bacteria 1254
509 Ga0466963_0255604 3300044694 Bacteria 1230
510 Ga0466964_0003668 3300044706 Bacteria 5617
511 Ga0466964_0029655 3300044706 Bacteria 2161
512 Ga0466971_0003475 3300044719 Bacteria 6729
513 Ga0466968_0006092 3300044735 Bacteria 4530
514 Ga0466970_0010206 3300044765 Bacteria 4759
515 Ga0466970_0063479 3300044765 Bacteria 1980
516 Ga0466957_0000132 3300044842 Bacteria 31445
517 Ga0466957_0015549 3300044842 Bacteria 4444
518 Ga0466957_0044343 3300044842 Bacteria 2695
519 Ga0466959_0030078 3300045049 Bacteria 4022
520 Ga0466959_0034811 3300045049 Bacteria 3725
521 Ga0466958_0002512 3300045836 Bacteria 9244
522 Ga0466958_0022143 3300045836 Bacteria 3720
523 Ga0466958_0094604 3300045836 Bacteria 1851
524 Ga0466967_0000096 3300045976 Bacteria 31385
525 Ga0466967_0196566 3300045976 Bacteria 1908
526 Ga0466967_0394567 3300045976 Bacteria 1345
527 Ga0466967_0512693 3300045976 Unclassified 1178
528 Ga0495598_0010785 3300046537 Bacteria 2198
529 Ga0495621_0000038 3300046539 Bacteria 25465
530 Ga0495621_0001366 3300046539 Bacteria 6313
531 Ga0495669_0033772 3300046684 Bacteria 2253
532 Ga0495669_0041050 3300046684 Bacteria 2053
533 Ga0495670_0005979 3300046691 Bacteria 5961
534 Ga0495670_0006293 3300046691 Bacteria 5827
535 Ga0495685_016122 3300047447 Bacteria 2554
536 Ga0496100_0006837 3300048903 Bacteria 6250
537 Ga0496101_0000725 3300048904 Bacteria 19617
538 Ga0496101_0034071 3300048904 Bacteria 3595
539 Ga0496101_0107603 3300048904 Bacteria 2095
540 Ga0496102_0266090 3300048905 Bacteria 1616
541 Ga0496106_0254993 3300048909 Bacteria 1403
542 Ga0496107_0011790 3300048910 Bacteria 6101
543 Ga0496107_0021580 3300048910 Bacteria 4552
544 Ga0496107_0030369 3300048910 Bacteria 3851
545 Ga0496108_0007068 3300048911 Bacteria 9090
546 Ga0496108_0021029 3300048911 Bacteria 5364
547 Ga0496108_0043516 3300048911 Bacteria 3750
548 Ga0496109_0037120 3300048912 Bacteria 4401
549 Ga0496109_0072374 3300048912 Bacteria 3166
550 Ga0496109_0226947 3300048912 Bacteria 1757
551 Ga0496110_0030450 3300048913 Bacteria 4652
552 Ga0496110_0032003 3300048913 Bacteria 4540
553 Ga0496111_0003292 3300048914 Bacteria 9987
554 Ga0496112_0008461 3300048915 Bacteria 9219
555 Ga0496113_0008399 3300048916 Bacteria 6727
556 Ga0496114_0007031 3300048917 Bacteria 8880
557 Ga0501074_0061689 3300049590 Bacteria 2701
558 Ga0590075_037523 3300059424 Bacteria 1236
559 Ga0590075_069790 3300059424 Bacteria 908
560 Ga0466962_0033218 3300061719 Bacteria 2469
561 Ga0466962_0080657 3300061719 Unclassified 1556
562 Ga0466962_0090673 3300061719 Unclassified 1464
563 Ga0466962_0167775 3300061719 Bacteria 1068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100034974 Ga0068853_1000349743 222
2 3300005543 Ga0070672_100657865 Ga0070672_1006578651 222
3 3300005618 Ga0068864_100096926 Ga0068864_1000969261 222
4 3300005842 Ga0068858_100442799 Ga0068858_1004427992 222
5 3300006237 Ga0097621_100108300 Ga0097621_1001083002 222
6 3300006881 Ga0068865_100099898 Ga0068865_1000998982 222
7 3300013306 Ga0163162_10189958 Ga0163162_101899582 222
8 3300013308 Ga0157375_10001828 Ga0157375_1000182810 222
9 3300014325 Ga0163163_10073173 Ga0163163_100731732 222
10 3300017792 Ga0163161_10001848 Ga0163161_100018488 222
11 3300025940 Ga0207691_10188513 Ga0207691_101885132 222
12 3300026041 Ga0207639_10348442 Ga0207639_103484421 222
13 3300005354 Ga0070675_100195526 Ga0070675_1001955262 228
14 3300005331 Ga0070670_100105345 Ga0070670_1001053453 230
15 3300005333 Ga0070677_10000369 Ga0070677_1000036915 230
16 3300005347 Ga0070668_100023818 Ga0070668_1000238184 230
17 3300025893 Ga0207682_10000308 Ga0207682_1000030822 230
18 3300025923 Ga0207681_10076844 Ga0207681_100768442 230
19 3300025972 Ga0207668_10046179 Ga0207668_100461793 230
20 3300059424 Ga0590075_037523 Ga0590075_037523_155_928 230
21 3300005354 Ga0070675_100007737 Ga0070675_1000077379 233
22 3300005355 Ga0070671_100033857 Ga0070671_1000338571 233
23 3300025931 Ga0207644_10023238 Ga0207644_100232382 233
24 3300031824 Ga0307413_10153127 Ga0307413_101531272 233
25 3300031995 Ga0307409_100340155 Ga0307409_1003401552 233
26 3300005355 Ga0070671_100059847 Ga0070671_1000598472 235
27 3300005564 Ga0070664_100765121 Ga0070664_1007651211 235
28 3300025931 Ga0207644_10228755 Ga0207644_102287551 235
29 3300046537 Ga0495598_0010785 Ga0495598_0010785_643_1413 235
30 3300046539 Ga0495621_0001366 Ga0495621_0001366_5464_6234 235
31 3300046684 Ga0495669_0041050 Ga0495669_0041050_1098_1868 235
32 3300046691 Ga0495670_0006293 Ga0495670_0006293_4870_5640 235
33 3300027665 Ga0209983_1017198 Ga0209983_10171982 237
34 3300027876 Ga0209974_10002531 Ga0209974_100025319 237
35 3300031731 Ga0307405_10049861 Ga0307405_100498612 237
36 3300031852 Ga0307410_10058358 Ga0307410_100583582 237
37 3300031903 Ga0307407_10299906 Ga0307407_102999062 237
38 3300031995 Ga0307409_100095103 Ga0307409_1000951032 237
39 3300032005 Ga0307411_10021155 Ga0307411_100211553 237
40 3300047447 Ga0495685_016122 Ga0495685_016122_1235_2068 242
41 3300005345 Ga0070692_10030352 Ga0070692_100303522 243
42 3300005455 Ga0070663_100004559 Ga0070663_1000045593 243
43 3300005577 Ga0068857_100103002 Ga0068857_1001030022 243
44 3300037312 Ga0395899_0048033 Ga0395899_0048033_861_1619 243
45 3300037466 Ga0395898_0071542 Ga0395898_0071542_1481_2239 243
46 3300044684 Ga0466966_0016018 Ga0466966_0016018_3194_4102 243
47 3300005290 Ga0065712_10179321 Ga0065712_101793212 244
48 3300005331 Ga0070670_100092745 Ga0070670_1000927452 244
49 3300005354 Ga0070675_100035689 Ga0070675_1000356894 244
50 3300025315 Ga0207697_10029959 Ga0207697_100299592 244
51 3300025925 Ga0207650_10038246 Ga0207650_100382462 244
52 3300025926 Ga0207659_10041144 Ga0207659_100411442 244
53 3300025932 Ga0207690_10294984 Ga0207690_102949842 244
54 3300025960 Ga0207651_10495587 Ga0207651_104955871 244
55 3300001989 JGI24739J22299_10051028 JGI24739J22299_100510282 245
56 3300001990 JGI24737J22298_10015221 JGI24737J22298_100152212 245
57 3300005327 Ga0070658_10006601 Ga0070658_100066015 245
58 3300005328 Ga0070676_10029658 Ga0070676_100296582 245
59 3300005330 Ga0070690_100001887 Ga0070690_1000018879 245
60 3300005335 Ga0070666_10003944 Ga0070666_100039448 245
61 3300005338 Ga0068868_100022629 Ga0068868_1000226293 245
62 3300005355 Ga0070671_100020497 Ga0070671_1000204978 245
63 3300005356 Ga0070674_100054817 Ga0070674_1000548174 245
64 3300005364 Ga0070673_100018258 Ga0070673_1000182588 245
65 3300005366 Ga0070659_100007865 Ga0070659_1000078656 245
66 3300005456 Ga0070678_100005530 Ga0070678_1000055309 245
67 3300005457 Ga0070662_100234025 Ga0070662_1002340252 245
68 3300005459 Ga0068867_100016953 Ga0068867_1000169535 245
69 3300005544 Ga0070686_100034610 Ga0070686_1000346103 245
70 3300005578 Ga0068854_100113157 Ga0068854_1001131572 245
71 3300005616 Ga0068852_100005050 Ga0068852_10000505010 245
72 3300005617 Ga0068859_100003970 Ga0068859_1000039709 245
73 3300005618 Ga0068864_100012223 Ga0068864_1000122236 245
74 3300005718 Ga0068866_10009487 Ga0068866_100094873 245
75 3300005842 Ga0068858_100008562 Ga0068858_1000085628 245
76 3300005843 Ga0068860_100026769 Ga0068860_1000267692 245
77 3300006237 Ga0097621_100018095 Ga0097621_1000180952 245
78 3300006358 Ga0068871_100008583 Ga0068871_1000085838 245
79 3300006931 Ga0097620_100003970 Ga0097620_1000039709 245
80 3300009093 Ga0105240_10427770 Ga0105240_104277702 245
81 3300009098 Ga0105245_10029375 Ga0105245_100293754 245
82 3300009101 Ga0105247_10246099 Ga0105247_102460992 245
83 3300009176 Ga0105242_10003949 Ga0105242_100039498 245
84 3300009177 Ga0105248_10031785 Ga0105248_100317854 245
85 3300009551 Ga0105238_10015109 Ga0105238_100151093 245
86 3300010375 Ga0105239_10055565 Ga0105239_100555653 245
87 3300013102 Ga0157371_10009947 Ga0157371_100099472 245
88 3300013296 Ga0157374_10149573 Ga0157374_101495732 245
89 3300013297 Ga0157378_10032316 Ga0157378_100323162 245
90 3300013306 Ga0163162_10015290 Ga0163162_100152903 245
91 3300013308 Ga0157375_10007587 Ga0157375_100075879 245
92 3300014745 Ga0157377_10193962 Ga0157377_101939621 245
93 3300014968 Ga0157379_10030156 Ga0157379_100301568 245
94 3300014969 Ga0157376_10007200 Ga0157376_100072008 245
95 3300025321 Ga0207656_10002771 Ga0207656_100027712 245
96 3300025899 Ga0207642_10085005 Ga0207642_100850051 245
97 3300025904 Ga0207647_10081893 Ga0207647_100818932 245
98 3300025909 Ga0207705_10007147 Ga0207705_100071473 245
99 3300025913 Ga0207695_10655436 Ga0207695_106554361 245
100 3300025919 Ga0207657_10047945 Ga0207657_100479453 245
101 3300025920 Ga0207649_10329443 Ga0207649_103294432 245
102 3300025924 Ga0207694_10047887 Ga0207694_100478873 245
103 3300025931 Ga0207644_10000812 Ga0207644_100008127 245
104 3300025933 Ga0207706_10017528 Ga0207706_100175284 245
105 3300025936 Ga0207670_10279158 Ga0207670_102791582 245
106 3300025940 Ga0207691_10003105 Ga0207691_100031054 245
107 3300025941 Ga0207711_10009489 Ga0207711_1000948910 245
108 3300025960 Ga0207651_10018110 Ga0207651_100181104 245
109 3300025981 Ga0207640_10146478 Ga0207640_101464782 245
110 3300025986 Ga0207658_10639043 Ga0207658_106390432 245
111 3300026023 Ga0207677_10008452 Ga0207677_100084522 245
112 3300026041 Ga0207639_10538190 Ga0207639_105381901 245
113 3300026078 Ga0207702_10379914 Ga0207702_103799141 245
114 3300026088 Ga0207641_10055177 Ga0207641_100551772 245
115 3300026089 Ga0207648_10003823 Ga0207648_100038239 245
116 3300026121 Ga0207683_10001741 Ga0207683_1000174121 245
117 3300026142 Ga0207698_10008129 Ga0207698_100081294 245
118 3300035691 Ga0373931_0300618 Ga0373931_0300618_192_953 245
119 3300048903 Ga0496100_0006837 Ga0496100_0006837_3126_3887 245
120 3300048904 Ga0496101_0000725 Ga0496101_0000725_11347_12108 245
121 3300048905 Ga0496102_0266090 Ga0496102_0266090_95_856 245
122 3300048909 Ga0496106_0254993 Ga0496106_0254993_272_1033 245
123 3300048910 Ga0496107_0011790 Ga0496107_0011790_1655_2416 245
124 3300048911 Ga0496108_0043516 Ga0496108_0043516_746_1507 245
125 3300048912 Ga0496109_0037120 Ga0496109_0037120_1746_2507 245
126 3300048913 Ga0496110_0030450 Ga0496110_0030450_1895_2656 245
127 3300048914 Ga0496111_0003292 Ga0496111_0003292_3261_4022 245
128 3300048916 Ga0496113_0008399 Ga0496113_0008399_3325_4086 245
129 3300005614 Ga0068856_100173676 Ga0068856_1001736762 246
130 3300013297 Ga0157378_10385460 Ga0157378_103854601 246
131 3300026095 Ga0207676_10814075 Ga0207676_108140751 246
132 3300005347 Ga0070668_100306511 Ga0070668_1003065111 247
133 3300005353 Ga0070669_100014864 Ga0070669_1000148644 247
134 3300005354 Ga0070675_100499460 Ga0070675_1004994602 247
135 3300005364 Ga0070673_100109041 Ga0070673_1001090412 247
136 3300005457 Ga0070662_100041827 Ga0070662_1000418272 247
137 3300025901 Ga0207688_10054181 Ga0207688_100541812 247
138 3300025933 Ga0207706_10117878 Ga0207706_101178782 247
139 3300025960 Ga0207651_10028832 Ga0207651_100288324 247
140 3300031731 Ga0307405_10119632 Ga0307405_101196322 247
141 3300031824 Ga0307413_10016220 Ga0307413_100162203 247
142 3300031852 Ga0307410_10040478 Ga0307410_100404783 247
143 3300031852 Ga0307410_10053923 Ga0307410_100539234 247
144 3300031852 Ga0307410_10442795 Ga0307410_104427952 247
145 3300031901 Ga0307406_10073916 Ga0307406_100739161 247
146 3300031903 Ga0307407_10004991 Ga0307407_100049912 247
147 3300031903 Ga0307407_10041841 Ga0307407_100418412 247
148 3300031911 Ga0307412_10032143 Ga0307412_100321433 247
149 3300031911 Ga0307412_10222706 Ga0307412_102227061 247
150 3300031995 Ga0307409_100240546 Ga0307409_1002405462 247
151 3300032002 Ga0307416_100100953 Ga0307416_1001009532 247
152 3300032004 Ga0307414_10113103 Ga0307414_101131031 247
153 3300032004 Ga0307414_10669769 Ga0307414_106697691 247
154 3300032005 Ga0307411_10058753 Ga0307411_100587532 247
155 3300032005 Ga0307411_10150399 Ga0307411_101503993 247
156 3300032005 Ga0307411_10182148 Ga0307411_101821482 247
157 3300032005 Ga0307411_10210316 Ga0307411_102103163 247
158 3300032126 Ga0307415_100067584 Ga0307415_1000675842 247
159 3300044684 Ga0466966_0004450 Ga0466966_0004450_7662_8432 247
160 3300044693 Ga0466961_0001957 Ga0466961_0001957_11323_12093 247
161 3300044706 Ga0466964_0029655 Ga0466964_0029655_1349_2119 247
162 3300044719 Ga0466971_0003475 Ga0466971_0003475_5662_6432 247
163 3300044842 Ga0466957_0015549 Ga0466957_0015549_423_1193 247
164 3300045049 Ga0466959_0034811 Ga0466959_0034811_2056_2826 247
165 3300045836 Ga0466958_0094604 Ga0466958_0094604_978_1748 247
166 3300046684 Ga0495669_0033772 Ga0495669_0033772_939_1706 247
167 3300061719 Ga0466962_0090673 Ga0466962_0090673_128_898 247
168 3300005331 Ga0070670_100021348 Ga0070670_1000213483 248
169 3300005344 Ga0070661_100117540 Ga0070661_1001175402 248
170 3300005564 Ga0070664_100001413 Ga0070664_10000141320 248
171 3300005577 Ga0068857_100233338 Ga0068857_1002333382 248
172 3300059424 Ga0590075_069790 Ga0590075_069790_49_804 248
173 3300005364 Ga0070673_100327007 Ga0070673_1003270072 249
174 3300013100 Ga0157373_10539851 Ga0157373_105398511 249
175 3300025919 Ga0207657_10146339 Ga0207657_101463392 249
176 3300025932 Ga0207690_10048794 Ga0207690_100487942 249
177 3300025933 Ga0207706_10017713 Ga0207706_100177133 249
178 3300025940 Ga0207691_10094337 Ga0207691_100943372 249
179 3300001991 JGI24743J22301_10002934 JGI24743J22301_100029343 250
180 3300005335 Ga0070666_10055060 Ga0070666_100550603 250
181 3300005336 Ga0070680_100265494 Ga0070680_1002654942 250
182 3300005337 Ga0070682_100045835 Ga0070682_1000458352 250
183 3300005339 Ga0070660_100036976 Ga0070660_1000369764 250
184 3300005339 Ga0070660_100088962 Ga0070660_1000889622 250
185 3300005343 Ga0070687_100078358 Ga0070687_1000783582 250
186 3300005344 Ga0070661_100047187 Ga0070661_1000471874 250
187 3300005366 Ga0070659_100016006 Ga0070659_1000160067 250
188 3300005366 Ga0070659_100583262 Ga0070659_1005832621 250
189 3300005367 Ga0070667_100053746 Ga0070667_1000537462 250
190 3300005457 Ga0070662_100000425 Ga0070662_10000042523 250
191 3300005457 Ga0070662_100013930 Ga0070662_1000139304 250
192 3300005458 Ga0070681_10220814 Ga0070681_102208142 250
193 3300005459 Ga0068867_100002266 Ga0068867_10000226613 250
194 3300005530 Ga0070679_100114501 Ga0070679_1001145012 250
195 3300005530 Ga0070679_100179256 Ga0070679_1001792563 250
196 3300005535 Ga0070684_100110508 Ga0070684_1001105082 250
197 3300005539 Ga0068853_100155169 Ga0068853_1001551692 250
198 3300005547 Ga0070693_100059932 Ga0070693_1000599322 250
199 3300005548 Ga0070665_100053760 Ga0070665_1000537604 250
200 3300005578 Ga0068854_100013314 Ga0068854_1000133144 250
201 3300005578 Ga0068854_100045382 Ga0068854_1000453824 250
202 3300005616 Ga0068852_100044035 Ga0068852_1000440354 250
203 3300005616 Ga0068852_100357110 Ga0068852_1003571102 250
204 3300005834 Ga0068851_10163511 Ga0068851_101635112 250
205 3300005842 Ga0068858_100251292 Ga0068858_1002512922 250
206 3300009174 Ga0105241_10268083 Ga0105241_102680832 250
207 3300011119 Ga0105246_10023424 Ga0105246_100234243 250
208 3300013100 Ga0157373_10005905 Ga0157373_100059054 250
209 3300013100 Ga0157373_10117328 Ga0157373_101173282 250
210 3300013104 Ga0157370_10147346 Ga0157370_101473462 250
211 3300013307 Ga0157372_10068359 Ga0157372_100683593 250
212 3300014325 Ga0163163_10260965 Ga0163163_102609652 250
213 3300025321 Ga0207656_10003187 Ga0207656_100031876 250
214 3300025903 Ga0207680_10004450 Ga0207680_100044505 250
215 3300025904 Ga0207647_10048890 Ga0207647_100488902 250
216 3300025909 Ga0207705_10103189 Ga0207705_101031891 250
217 3300025912 Ga0207707_10066941 Ga0207707_100669413 250
218 3300025917 Ga0207660_10411547 Ga0207660_104115471 250
219 3300025918 Ga0207662_10051154 Ga0207662_100511543 250
220 3300025919 Ga0207657_10009692 Ga0207657_100096927 250
221 3300025919 Ga0207657_10039304 Ga0207657_100393045 250
222 3300025920 Ga0207649_10328768 Ga0207649_103287681 250
223 3300025921 Ga0207652_10148251 Ga0207652_101482513 250
224 3300025923 Ga0207681_10074385 Ga0207681_100743852 250
225 3300025925 Ga0207650_10328072 Ga0207650_103280722 250
226 3300025931 Ga0207644_10123986 Ga0207644_101239862 250
227 3300025932 Ga0207690_10045147 Ga0207690_100451472 250
228 3300025933 Ga0207706_10000582 Ga0207706_1000058215 250
229 3300025933 Ga0207706_10002597 Ga0207706_1000259718 250
230 3300025933 Ga0207706_10201089 Ga0207706_102010892 250
231 3300025945 Ga0207679_10125902 Ga0207679_101259022 250
232 3300025949 Ga0207667_10551773 Ga0207667_105517731 250
233 3300025949 Ga0207667_10723864 Ga0207667_107238641 250
234 3300025960 Ga0207651_10102903 Ga0207651_101029033 250
235 3300025960 Ga0207651_10143651 Ga0207651_101436512 250
236 3300025961 Ga0207712_10008209 Ga0207712_100082098 250
237 3300025981 Ga0207640_10004923 Ga0207640_100049235 250
238 3300025981 Ga0207640_10126092 Ga0207640_101260921 250
239 3300025986 Ga0207658_10334954 Ga0207658_103349542 250
240 3300026035 Ga0207703_10291783 Ga0207703_102917832 250
241 3300026041 Ga0207639_10082577 Ga0207639_100825773 250
242 3300026067 Ga0207678_10001299 Ga0207678_100012997 250
243 3300026067 Ga0207678_10030864 Ga0207678_100308645 250
244 3300026089 Ga0207648_10044795 Ga0207648_100447951 250
245 3300026095 Ga0207676_10152229 Ga0207676_101522292 250
246 3300026118 Ga0207675_100202343 Ga0207675_1002023432 250
247 3300026142 Ga0207698_10013712 Ga0207698_100137124 250
248 3300026142 Ga0207698_10043417 Ga0207698_100434173 250
249 3300028379 Ga0268266_10003459 Ga0268266_1000345917 250
250 3300028381 Ga0268264_10203633 Ga0268264_102036332 250
251 3300031548 Ga0307408_100021346 Ga0307408_1000213462 250
252 3300031731 Ga0307405_10002928 Ga0307405_1000292810 250
253 3300031824 Ga0307413_10142445 Ga0307413_101424452 250
254 3300031852 Ga0307410_10014640 Ga0307410_100146402 250
255 3300031852 Ga0307410_10034860 Ga0307410_100348603 250
256 3300031901 Ga0307406_10052494 Ga0307406_100524942 250
257 3300031903 Ga0307407_10055706 Ga0307407_100557062 250
258 3300031911 Ga0307412_10008364 Ga0307412_100083647 250
259 3300031911 Ga0307412_10020808 Ga0307412_100208083 250
260 3300031995 Ga0307409_100004917 Ga0307409_1000049174 250
261 3300032002 Ga0307416_100001807 Ga0307416_1000018077 250
262 3300032002 Ga0307416_100291655 Ga0307416_1002916553 250
263 3300032004 Ga0307414_10003774 Ga0307414_100037749 250
264 3300032004 Ga0307414_10109248 Ga0307414_101092482 250
265 3300032005 Ga0307411_10006730 Ga0307411_100067303 250
266 3300032005 Ga0307411_10068787 Ga0307411_100687872 250
267 3300032126 Ga0307415_100006693 Ga0307415_1000066933 250
268 3300037418 Ga0395900_0177111 Ga0395900_0177111_866_1687 250
269 3300037418 Ga0395900_0283626 Ga0395900_0283626_661_1422 250
270 3300037466 Ga0395898_0090083 Ga0395898_0090083_62_823 250
271 3300037471 Ga0395905_0039770 Ga0395905_0039770_2405_3166 250
272 3300037471 Ga0395905_0097843 Ga0395905_0097843_1966_2727 250
273 3300037471 Ga0395905_0430752 Ga0395905_0430752_70_831 250
274 3300038443 Ga0395901_0042951 Ga0395901_0042951_2733_3494 250
275 3300038443 Ga0395901_0051450 Ga0395901_0051450_2674_3435 250
276 3300038443 Ga0395901_0110176 Ga0395901_0110176_2031_2792 250
277 3300048912 Ga0496109_0226947 Ga0496109_0226947_525_1286 250
278 3300005339 Ga0070660_100099727 Ga0070660_1000997272 251
279 3300005356 Ga0070674_100101197 Ga0070674_1001011972 251
280 3300005366 Ga0070659_100007599 Ga0070659_1000075995 251
281 3300005367 Ga0070667_100018096 Ga0070667_1000180962 251
282 3300005457 Ga0070662_100021344 Ga0070662_1000213443 251
283 3300005844 Ga0068862_100017421 Ga0068862_1000174214 251
284 3300009553 Ga0105249_10066917 Ga0105249_100669172 251
285 3300025903 Ga0207680_10319022 Ga0207680_103190221 251
286 3300025904 Ga0207647_10009118 Ga0207647_100091185 251
287 3300025909 Ga0207705_10081665 Ga0207705_100816652 251
288 3300025933 Ga0207706_10017106 Ga0207706_100171063 251
289 3300025986 Ga0207658_10032293 Ga0207658_100322933 251
290 3300037312 Ga0395899_0310488 Ga0395899_0310488_207_971 251
291 3300037418 Ga0395900_0102666 Ga0395900_0102666_601_1365 251
292 3300037418 Ga0395900_0271651 Ga0395900_0271651_682_1446 251
293 3300037466 Ga0395898_0321482 Ga0395898_0321482_553_1317 251
294 3300037471 Ga0395905_0025061 Ga0395905_0025061_3723_4487 251
295 3300037471 Ga0395905_0060642 Ga0395905_0060642_2366_3223 251
296 3300038443 Ga0395901_0929355 Ga0395901_0929355_15_779 251
297 3300002067 JGI24735J21928_10001119 JGI24735J21928_100011197 252
298 3300003320 rootH2_10021211 rootH2_100212112 252
299 3300005329 Ga0070683_100120812 Ga0070683_1001208122 252
300 3300005331 Ga0070670_100315006 Ga0070670_1003150062 252
301 3300005339 Ga0070660_100614393 Ga0070660_1006143931 252
302 3300005344 Ga0070661_100213657 Ga0070661_1002136572 252
303 3300005354 Ga0070675_100011928 Ga0070675_1000119284 252
304 3300005355 Ga0070671_100162628 Ga0070671_1001626282 252
305 3300005355 Ga0070671_100311224 Ga0070671_1003112242 252
306 3300005356 Ga0070674_100021148 Ga0070674_1000211482 252
307 3300005356 Ga0070674_100062865 Ga0070674_1000628652 252
308 3300005364 Ga0070673_100005516 Ga0070673_1000055163 252
309 3300005364 Ga0070673_100045086 Ga0070673_1000450864 252
310 3300005366 Ga0070659_100005681 Ga0070659_1000056816 252
311 3300005366 Ga0070659_100021219 Ga0070659_1000212195 252
312 3300005366 Ga0070659_100039612 Ga0070659_1000396122 252
313 3300005366 Ga0070659_100107042 Ga0070659_1001070422 252
314 3300005367 Ga0070667_100046568 Ga0070667_1000465682 252
315 3300005367 Ga0070667_100352755 Ga0070667_1003527551 252
316 3300005456 Ga0070678_100015725 Ga0070678_1000157253 252
317 3300005456 Ga0070678_100057106 Ga0070678_1000571062 252
318 3300005457 Ga0070662_100018379 Ga0070662_1000183793 252
319 3300005457 Ga0070662_100029440 Ga0070662_1000294404 252
320 3300005457 Ga0070662_100181331 Ga0070662_1001813312 252
321 3300005457 Ga0070662_100516206 Ga0070662_1005162062 252
322 3300005530 Ga0070679_100063837 Ga0070679_1000638373 252
323 3300005530 Ga0070679_100619762 Ga0070679_1006197621 252
324 3300005539 Ga0068853_100584855 Ga0068853_1005848551 252
325 3300005543 Ga0070672_100032880 Ga0070672_1000328805 252
326 3300005543 Ga0070672_100089563 Ga0070672_1000895633 252
327 3300005548 Ga0070665_100011029 Ga0070665_1000110294 252
328 3300005548 Ga0070665_100233770 Ga0070665_1002337702 252
329 3300005563 Ga0068855_100034766 Ga0068855_1000347662 252
330 3300005564 Ga0070664_100125429 Ga0070664_1001254291 252
331 3300005564 Ga0070664_100172698 Ga0070664_1001726982 252
332 3300005577 Ga0068857_100031562 Ga0068857_1000315624 252
333 3300005578 Ga0068854_100012148 Ga0068854_1000121482 252
334 3300005578 Ga0068854_100161727 Ga0068854_1001617272 252
335 3300005614 Ga0068856_100213133 Ga0068856_1002131332 252
336 3300005614 Ga0068856_100537435 Ga0068856_1005374352 252
337 3300005616 Ga0068852_100052579 Ga0068852_1000525792 252
338 3300005616 Ga0068852_100054987 Ga0068852_1000549872 252
339 3300005618 Ga0068864_100028179 Ga0068864_1000281792 252
340 3300005834 Ga0068851_10251781 Ga0068851_102517812 252
341 3300005834 Ga0068851_10255601 Ga0068851_102556011 252
342 3300005842 Ga0068858_100026535 Ga0068858_1000265354 252
343 3300005843 Ga0068860_100478675 Ga0068860_1004786752 252
344 3300006237 Ga0097621_100310151 Ga0097621_1003101512 252
345 3300006358 Ga0068871_100028347 Ga0068871_1000283472 252
346 3300006881 Ga0068865_100016743 Ga0068865_1000167432 252
347 3300009177 Ga0105248_10065350 Ga0105248_100653502 252
348 3300009177 Ga0105248_10072961 Ga0105248_100729612 252
349 3300009177 Ga0105248_10145023 Ga0105248_101450232 252
350 3300009177 Ga0105248_10295055 Ga0105248_102950551 252
351 3300009551 Ga0105238_10008220 Ga0105238_100082205 252
352 3300009551 Ga0105238_10076447 Ga0105238_100764474 252
353 3300013100 Ga0157373_10032283 Ga0157373_100322832 252
354 3300013100 Ga0157373_10124908 Ga0157373_101249082 252
355 3300013104 Ga0157370_10029982 Ga0157370_100299827 252
356 3300013104 Ga0157370_10069237 Ga0157370_100692372 252
357 3300013105 Ga0157369_10114745 Ga0157369_101147454 252
358 3300013105 Ga0157369_10406777 Ga0157369_104067772 252
359 3300013296 Ga0157374_10005377 Ga0157374_100053772 252
360 3300013296 Ga0157374_10021680 Ga0157374_100216805 252
361 3300013297 Ga0157378_10016413 Ga0157378_100164133 252
362 3300013306 Ga0163162_10133872 Ga0163162_101338722 252
363 3300013307 Ga0157372_10017691 Ga0157372_100176916 252
364 3300013308 Ga0157375_10019815 Ga0157375_100198156 252
365 3300013308 Ga0157375_10195449 Ga0157375_101954492 252
366 3300013308 Ga0157375_10242110 Ga0157375_102421102 252
367 3300014325 Ga0163163_10022760 Ga0163163_100227606 252
368 3300014969 Ga0157376_10298469 Ga0157376_102984692 252
369 3300025321 Ga0207656_10183682 Ga0207656_101836821 252
370 3300025903 Ga0207680_10271163 Ga0207680_102711632 252
371 3300025904 Ga0207647_10011465 Ga0207647_100114656 252
372 3300025909 Ga0207705_10021921 Ga0207705_100219212 252
373 3300025909 Ga0207705_10052063 Ga0207705_100520634 252
374 3300025909 Ga0207705_10151066 Ga0207705_101510662 252
375 3300025912 Ga0207707_10024428 Ga0207707_100244282 252
376 3300025913 Ga0207695_10037215 Ga0207695_100372154 252
377 3300025919 Ga0207657_10014714 Ga0207657_100147146 252
378 3300025919 Ga0207657_10025795 Ga0207657_100257952 252
379 3300025919 Ga0207657_10058442 Ga0207657_100584422 252
380 3300025919 Ga0207657_10128027 Ga0207657_101280272 252
381 3300025919 Ga0207657_10309841 Ga0207657_103098412 252
382 3300025921 Ga0207652_10030919 Ga0207652_100309193 252
383 3300025924 Ga0207694_10010505 Ga0207694_100105058 252
384 3300025926 Ga0207659_10029132 Ga0207659_100291322 252
385 3300025926 Ga0207659_10049212 Ga0207659_100492123 252
386 3300025932 Ga0207690_10007622 Ga0207690_100076226 252
387 3300025932 Ga0207690_10094814 Ga0207690_100948142 252
388 3300025933 Ga0207706_10006116 Ga0207706_100061163 252
389 3300025933 Ga0207706_10016022 Ga0207706_100160224 252
390 3300025933 Ga0207706_10034456 Ga0207706_100344562 252
391 3300025933 Ga0207706_10224160 Ga0207706_102241602 252
392 3300025933 Ga0207706_10394136 Ga0207706_103941362 252
393 3300025937 Ga0207669_10139965 Ga0207669_101399652 252
394 3300025938 Ga0207704_10312198 Ga0207704_103121982 252
395 3300025940 Ga0207691_10014546 Ga0207691_100145466 252
396 3300025941 Ga0207711_10057505 Ga0207711_100575053 252
397 3300025941 Ga0207711_10257176 Ga0207711_102571762 252
398 3300025944 Ga0207661_10056706 Ga0207661_100567062 252
399 3300025981 Ga0207640_10022494 Ga0207640_100224944 252
400 3300025981 Ga0207640_10225008 Ga0207640_102250082 252
401 3300025986 Ga0207658_10523830 Ga0207658_105238302 252
402 3300025986 Ga0207658_10643930 Ga0207658_106439302 252
403 3300026023 Ga0207677_10262697 Ga0207677_102626972 252
404 3300026035 Ga0207703_10012252 Ga0207703_100122527 252
405 3300026035 Ga0207703_10293665 Ga0207703_102936651 252
406 3300026041 Ga0207639_10001048 Ga0207639_1000104813 252
407 3300026041 Ga0207639_10231294 Ga0207639_102312942 252
408 3300026041 Ga0207639_10601654 Ga0207639_106016542 252
409 3300026067 Ga0207678_10014579 Ga0207678_100145795 252
410 3300026067 Ga0207678_10582226 Ga0207678_105822262 252
411 3300026078 Ga0207702_10054450 Ga0207702_100544502 252
412 3300026078 Ga0207702_10079332 Ga0207702_100793324 252
413 3300026078 Ga0207702_10162423 Ga0207702_101624233 252
414 3300026095 Ga0207676_10139775 Ga0207676_101397751 252
415 3300026116 Ga0207674_10016657 Ga0207674_100166574 252
416 3300026121 Ga0207683_10014751 Ga0207683_100147516 252
417 3300026121 Ga0207683_10016564 Ga0207683_100165646 252
418 3300026142 Ga0207698_10023714 Ga0207698_100237145 252
419 3300026142 Ga0207698_10025393 Ga0207698_100253934 252
420 3300031852 Ga0307410_10117361 Ga0307410_101173612 252
421 3300036401 Ga0373937_0666869 Ga0373937_0666869_169_930 252
422 3300037312 Ga0395899_0006347 Ga0395899_0006347_4153_5022 252
423 3300037312 Ga0395899_0027401 Ga0395899_0027401_165_932 252
424 3300037312 Ga0395899_0334588 Ga0395899_0334588_55_819 252
425 3300037418 Ga0395900_0028072 Ga0395900_0028072_193_1062 252
426 3300037418 Ga0395900_0168033 Ga0395900_0168033_1205_1972 252
427 3300037466 Ga0395898_0004715 Ga0395898_0004715_9410_10279 252
428 3300037466 Ga0395898_0047540 Ga0395898_0047540_2853_3620 252
429 3300037466 Ga0395898_0081507 Ga0395898_0081507_1014_1772 252
430 3300037471 Ga0395905_0052049 Ga0395905_0052049_2458_3222 252
431 3300037471 Ga0395905_0204575 Ga0395905_0204575_739_1608 252
432 3300038443 Ga0395901_0078943 Ga0395901_0078943_1876_2643 252
433 3300038443 Ga0395901_0086651 Ga0395901_0086651_555_1322 252
434 3300038443 Ga0395901_0148489 Ga0395901_0148489_243_1112 252
435 3300038443 Ga0395901_0171003 Ga0395901_0171003_469_1227 252
436 3300038443 Ga0395901_0215926 Ga0395901_0215926_155_919 252
437 3300044658 Ga0466972_0016362 Ga0466972_0016362_211_981 252
438 3300044693 Ga0466961_0125925 Ga0466961_0125925_194_964 252
439 3300044693 Ga0466961_0177519 Ga0466961_0177519_147_914 252
440 3300044694 Ga0466963_0026925 Ga0466963_0026925_1613_2383 252
441 3300044694 Ga0466963_0047085 Ga0466963_0047085_767_1531 252
442 3300044694 Ga0466963_0246309 Ga0466963_0246309_243_1010 252
443 3300044694 Ga0466963_0255604 Ga0466963_0255604_183_947 252
444 3300044706 Ga0466964_0003668 Ga0466964_0003668_2286_3056 252
445 3300044735 Ga0466968_0006092 Ga0466968_0006092_2067_2837 252
446 3300044765 Ga0466970_0010206 Ga0466970_0010206_217_987 252
447 3300044765 Ga0466970_0063479 Ga0466970_0063479_1172_1939 252
448 3300044842 Ga0466957_0044343 Ga0466957_0044343_1605_2372 252
449 3300045049 Ga0466959_0030078 Ga0466959_0030078_2329_3099 252
450 3300045836 Ga0466958_0002512 Ga0466958_0002512_2795_3559 252
451 3300045836 Ga0466958_0022143 Ga0466958_0022143_462_1232 252
452 3300045976 Ga0466967_0196566 Ga0466967_0196566_129_899 252
453 3300045976 Ga0466967_0394567 Ga0466967_0394567_246_1013 252
454 3300045976 Ga0466967_0512693 Ga0466967_0512693_154_921 252
455 3300046539 Ga0495621_0000038 Ga0495621_0000038_15291_16052 252
456 3300046691 Ga0495670_0005979 Ga0495670_0005979_3913_4674 252
457 3300048904 Ga0496101_0034071 Ga0496101_0034071_1710_2480 252
458 3300048904 Ga0496101_0107603 Ga0496101_0107603_1183_1950 252
459 3300048910 Ga0496107_0030369 Ga0496107_0030369_1069_1839 252
460 3300048911 Ga0496108_0007068 Ga0496108_0007068_413_1180 252
461 3300048911 Ga0496108_0021029 Ga0496108_0021029_2939_3706 252
462 3300048912 Ga0496109_0072374 Ga0496109_0072374_953_1720 252
463 3300048913 Ga0496110_0032003 Ga0496110_0032003_714_1481 252
464 3300048915 Ga0496112_0008461 Ga0496112_0008461_7925_8692 252
465 3300048917 Ga0496114_0007031 Ga0496114_0007031_3953_4723 252
466 3300061719 Ga0466962_0033218 Ga0466962_0033218_1301_2068 252
467 3300061719 Ga0466962_0080657 Ga0466962_0080657_481_1251 252
468 3300013104 Ga0157370_10255274 Ga0157370_102552742 253
469 3300037418 Ga0395900_0488944 Ga0395900_0488944_19_813 253
470 3300037466 Ga0395898_0027924 Ga0395898_0027924_133_933 253
471 3300037466 Ga0395898_0351530 Ga0395898_0351530_189_989 253
472 3300038443 Ga0395901_0682132 Ga0395901_0682132_88_888 253
473 3300001979 JGI24740J21852_10018382 JGI24740J21852_100183822 254
474 3300001989 JGI24739J22299_10006214 JGI24739J22299_100062143 254
475 3300001990 JGI24737J22298_10001018 JGI24737J22298_100010184 254
476 3300002067 JGI24735J21928_10009950 JGI24735J21928_100099502 254
477 3300002075 JGI24738J21930_10002699 JGI24738J21930_100026993 254
478 3300005327 Ga0070658_10006865 Ga0070658_1000686510 254
479 3300005329 Ga0070683_100007532 Ga0070683_10000753210 254
480 3300005330 Ga0070690_100013661 Ga0070690_1000136613 254
481 3300005331 Ga0070670_100314901 Ga0070670_1003149012 254
482 3300005335 Ga0070666_10001159 Ga0070666_1000115911 254
483 3300005339 Ga0070660_100000877 Ga0070660_1000008778 254
484 3300005339 Ga0070660_100009198 Ga0070660_1000091989 254
485 3300005339 Ga0070660_100180374 Ga0070660_1001803742 254
486 3300005344 Ga0070661_100000033 Ga0070661_10000003353 254
487 3300005345 Ga0070692_10302710 Ga0070692_103027101 254
488 3300005355 Ga0070671_100002272 Ga0070671_1000022727 254
489 3300005366 Ga0070659_100006282 Ga0070659_1000062824 254
490 3300005366 Ga0070659_100038873 Ga0070659_1000388732 254
491 3300005366 Ga0070659_100055808 Ga0070659_1000558082 254
492 3300005366 Ga0070659_100086311 Ga0070659_1000863112 254
493 3300005367 Ga0070667_100039457 Ga0070667_1000394571 254
494 3300005455 Ga0070663_100001259 Ga0070663_1000012595 254
495 3300005457 Ga0070662_100000021 Ga0070662_1000000218 254
496 3300005457 Ga0070662_100146076 Ga0070662_1001460762 254
497 3300005458 Ga0070681_10034708 Ga0070681_100347082 254
498 3300005530 Ga0070679_100861413 Ga0070679_1008614131 254
499 3300005535 Ga0070684_100148560 Ga0070684_1001485602 254
500 3300005539 Ga0068853_100000220 Ga0068853_10000022038 254
501 3300005539 Ga0068853_100032678 Ga0068853_1000326782 254
502 3300005547 Ga0070693_100020549 Ga0070693_1000205492 254
503 3300005548 Ga0070665_100001858 Ga0070665_1000018582 254
504 3300005563 Ga0068855_100001017 Ga0068855_10000101710 254
505 3300005564 Ga0070664_100000127 Ga0070664_10000012753 254
506 3300005577 Ga0068857_100526984 Ga0068857_1005269842 254
507 3300005614 Ga0068856_100000177 Ga0068856_10000017767 254
508 3300005614 Ga0068856_100099579 Ga0068856_1000995792 254
509 3300005616 Ga0068852_100068472 Ga0068852_1000684725 254
510 3300005617 Ga0068859_100083625 Ga0068859_1000836254 254
511 3300005618 Ga0068864_100041159 Ga0068864_1000411592 254
512 3300006237 Ga0097621_100497016 Ga0097621_1004970162 254
513 3300006358 Ga0068871_100065730 Ga0068871_1000657303 254
514 3300006931 Ga0097620_100083625 Ga0097620_1000836254 254
515 3300009174 Ga0105241_10011915 Ga0105241_100119151 254
516 3300009177 Ga0105248_10002904 Ga0105248_1000290420 254
517 3300009551 Ga0105238_10188133 Ga0105238_101881333 254
518 3300013100 Ga0157373_10015225 Ga0157373_100152252 254
519 3300013100 Ga0157373_10019900 Ga0157373_100199004 254
520 3300013102 Ga0157371_10000934 Ga0157371_1000093432 254
521 3300013102 Ga0157371_10004403 Ga0157371_100044039 254
522 3300013296 Ga0157374_10260035 Ga0157374_102600352 254
523 3300014325 Ga0163163_10000587 Ga0163163_1000058724 254
524 3300025903 Ga0207680_10003483 Ga0207680_100034836 254
525 3300025909 Ga0207705_10001151 Ga0207705_100011518 254
526 3300025909 Ga0207705_10004175 Ga0207705_1000417510 254
527 3300025917 Ga0207660_10003520 Ga0207660_100035203 254
528 3300025919 Ga0207657_10000173 Ga0207657_1000017367 254
529 3300025919 Ga0207657_10000863 Ga0207657_1000086321 254
530 3300025919 Ga0207657_10001033 Ga0207657_1000103311 254
531 3300025919 Ga0207657_10136539 Ga0207657_101365392 254
532 3300025919 Ga0207657_10307417 Ga0207657_103074172 254
533 3300025920 Ga0207649_10000014 Ga0207649_1000001450 254
534 3300025931 Ga0207644_10007571 Ga0207644_100075718 254
535 3300025932 Ga0207690_10000150 Ga0207690_1000015053 254
536 3300025932 Ga0207690_10009493 Ga0207690_100094932 254
537 3300025932 Ga0207690_10066743 Ga0207690_100667432 254
538 3300025932 Ga0207690_10185004 Ga0207690_101850042 254
539 3300025933 Ga0207706_10000358 Ga0207706_1000035848 254
540 3300025933 Ga0207706_10218924 Ga0207706_102189242 254
541 3300025941 Ga0207711_10001672 Ga0207711_1000167220 254
542 3300025944 Ga0207661_10002288 Ga0207661_100022885 254
543 3300025945 Ga0207679_10003009 Ga0207679_1000300911 254
544 3300025949 Ga0207667_10001713 Ga0207667_1000171323 254
545 3300025981 Ga0207640_10054175 Ga0207640_100541752 254
546 3300025986 Ga0207658_10027919 Ga0207658_100279192 254
547 3300026041 Ga0207639_10000581 Ga0207639_1000058124 254
548 3300026041 Ga0207639_10021541 Ga0207639_100215415 254
549 3300026067 Ga0207678_10022803 Ga0207678_100228032 254
550 3300026067 Ga0207678_10111686 Ga0207678_101116862 254
551 3300026078 Ga0207702_10002591 Ga0207702_100025915 254
552 3300026078 Ga0207702_10559356 Ga0207702_105593562 254
553 3300026095 Ga0207676_10083882 Ga0207676_100838823 254
554 3300026116 Ga0207674_10533001 Ga0207674_105330012 254
555 3300026142 Ga0207698_10067323 Ga0207698_100673233 254
556 3300028379 Ga0268266_10065165 Ga0268266_100651653 254
557 3300037418 Ga0395900_0059869 Ga0395900_0059869_75_881 254
558 3300044694 Ga0466963_0000903 Ga0466963_0000903_7090_7857 254
559 3300044842 Ga0466957_0000132 Ga0466957_0000132_30520_31287 254
560 3300045976 Ga0466967_0000096 Ga0466967_0000096_126_893 254
561 3300048910 Ga0496107_0021580 Ga0496107_0021580_986_1903 254
562 3300049590 Ga0501074_0061689 Ga0501074_0061689_999_1763 254
563 3300061719 Ga0466962_0167775 Ga0466962_0167775_217_984 254

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8188 43 186
6wlf-assembly2.cif.gz_B phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8123 41 186
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.7783 52 181
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.7732 52 179
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.7716 39 251
ID Description Score Start End Superfamily
af_P9WKL5_23_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7759 53 212 3.40.50.150
1dl5B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7723 52 183 3.40.50.150
3dh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7716 39 251 3.40.50.150
af_P96246_2_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7573 39 254 3.40.50.150
3uj6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7539 45 221 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7G9SEF1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9892 26 253 GO:0008168
GO:0032259
AF-A0A7X9WPN9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9807 28 254 GO:0008168
GO:0032259
AF-A0A6G7ZIL3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9749 29 254 GO:0008168
GO:0032259
AF-A0A2E2IRW8-F1-model_v4 Methyltransferase 0.9733 29 254 GO:0008168
GO:0032259
AF-A0A4V1SQJ0-F1-model_v4 Methyltransferase 0.973 29 254 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.81 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map