F464019
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 563 | 246 | 1126 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100005750|Ga0070671_1000057506 |
| Length | 255 |
| Sequence | MIRLTNVCKDYPTRVGMRRVLDSINVTVQPGEHLGILGRNGAGKSTLVRLISGAEAPTLGTIERNMAVSWPLAFSGGFQGSLTGADNVRFICRIYGVDYQPRFEFVKDFSELGIYLNEPVATYSSGMRARLAFAISMTIDFDCYLIDEVMAVGDQRFRERCRVELFEKRRDKAMLIVSHSHRYLKNVCDRFLLIEGGRLEDHNDFDEVYFRYKQLIGEGFESREDMVAAMDASTPEAQLRRERKRLRRLAANAGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 175 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 181 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 203 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 204 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 209 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 213 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 214 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 215 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 218 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 219 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 220 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 221 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 222 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 223 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 224 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 225 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 226 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 227 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 228 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 229 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 230 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 231 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 232 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 233 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 234 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 235 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 236 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 237 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 238 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 239 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 240 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 241 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 242 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 243 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 244 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 245 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 246 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.03 |
| Metatranscriptomes | 0 |
| Isolates | 4.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.8 |
| Nodule | 0.89 |
| Rhizoplane | 1.95 |
| Rhizosphere | 87.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070671_100005750 | 3300005355 | Bacteria | 9876 |
| 2 | JGI24741J21665_1000463 | 3300001915 | Bacteria | 12346 |
| 3 | JGI24740J21852_10000050 | 3300001979 | Bacteria | 37983 |
| 4 | JGI24740J21852_10000323 | 3300001979 | Bacteria | 20340 |
| 5 | JGI24739J22299_10010378 | 3300001989 | Bacteria | 3459 |
| 6 | JGI24737J22298_10010456 | 3300001990 | Bacteria | 3061 |
| 7 | JGI24737J22298_10033853 | 3300001990 | Bacteria | 1586 |
| 8 | JGI24743J22301_10014021 | 3300001991 | Bacteria | 1475 |
| 9 | JGI24735J21928_10016107 | 3300002067 | Bacteria | 2325 |
| 10 | JGI24735J21928_10024697 | 3300002067 | Bacteria | 1816 |
| 11 | JGI24738J21930_10003645 | 3300002075 | Bacteria | 3858 |
| 12 | JGI24738J21930_10023772 | 3300002075 | Bacteria | 1261 |
| 13 | JGI24744J21845_10004665 | 3300002077 | Bacteria | 2831 |
| 14 | JGI25162J39368_1000119 | 3300002737 | Bacteria | 87157 |
| 15 | JGI25162J39368_1003173 | 3300002737 | Bacteria | 5129 |
| 16 | JGI25165J46597_1000211 | 3300003214 | Bacteria | 82463 |
| 17 | JGI25165J46597_1002115 | 3300003214 | Bacteria | 7205 |
| 18 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 19 | rootH1_10041865 | 3300003316 | Bacteria | 6454 |
| 20 | rootH2_10036567 | 3300003320 | Bacteria | 1410 |
| 21 | rootH2_10049253 | 3300003320 | Bacteria | 4121 |
| 22 | rootL2_10008491 | 3300003322 | Bacteria | 40034 |
| 23 | rootH1_10073304 | 3300003323 | Bacteria | 3930 |
| 24 | rootH1_10137120 | 3300003323 | Bacteria | 6037 |
| 25 | rootH1_10154429 | 3300003323 | Bacteria | 9461 |
| 26 | rootH1_10231694 | 3300003323 | Bacteria | 2738 |
| 27 | Ga0055537_1001116 | 3300003773 | Bacteria | 11593 |
| 28 | Ga0058692_1024898 | 3300003856 | Bacteria | 1195 |
| 29 | Ga0070658_10000978 | 3300005327 | Bacteria | 24540 |
| 30 | Ga0070658_10004748 | 3300005327 | Bacteria | 11057 |
| 31 | Ga0070658_10020212 | 3300005327 | Bacteria | 5335 |
| 32 | Ga0070658_10071779 | 3300005327 | Bacteria | 2836 |
| 33 | Ga0070658_10395131 | 3300005327 | Bacteria | 1187 |
| 34 | Ga0070676_10000445 | 3300005328 | Bacteria | 19700 |
| 35 | Ga0070683_100001007 | 3300005329 | Bacteria | 21089 |
| 36 | Ga0070683_100340538 | 3300005329 | Bacteria | 1428 |
| 37 | Ga0070690_100147302 | 3300005330 | Bacteria | 1603 |
| 38 | Ga0070670_100005738 | 3300005331 | Bacteria | 10484 |
| 39 | Ga0070670_100029040 | 3300005331 | Bacteria | 4759 |
| 40 | Ga0070670_100130730 | 3300005331 | Bacteria | 2168 |
| 41 | Ga0068869_100000113 | 3300005334 | Bacteria | 38756 |
| 42 | Ga0070680_100006544 | 3300005336 | Bacteria | 8861 |
| 43 | Ga0068868_100000003 | 3300005338 | Bacteria | 155611 |
| 44 | Ga0068868_100456763 | 3300005338 | Bacteria | 1112 |
| 45 | Ga0070660_100002998 | 3300005339 | Bacteria | 11630 |
| 46 | Ga0070660_100005757 | 3300005339 | Bacteria | 8586 |
| 47 | Ga0070660_100006194 | 3300005339 | Bacteria | 8277 |
| 48 | Ga0070660_100019547 | 3300005339 | Bacteria | 4965 |
| 49 | Ga0070661_100000519 | 3300005344 | Bacteria | 29559 |
| 50 | Ga0070661_100004462 | 3300005344 | Bacteria | 9649 |
| 51 | Ga0070661_100019752 | 3300005344 | Bacteria | 4802 |
| 52 | Ga0070661_100055345 | 3300005344 | Bacteria | 2905 |
| 53 | Ga0070661_100366876 | 3300005344 | Bacteria | 1133 |
| 54 | Ga0070668_100004680 | 3300005347 | Bacteria | 10143 |
| 55 | Ga0070668_100091897 | 3300005347 | Bacteria | 2393 |
| 56 | Ga0070669_100012471 | 3300005353 | Bacteria | 6030 |
| 57 | Ga0070669_100030650 | 3300005353 | Bacteria | 3882 |
| 58 | Ga0070669_100170105 | 3300005353 | Bacteria | 1698 |
| 59 | Ga0070675_100009907 | 3300005354 | Bacteria | 7430 |
| 60 | Ga0070671_100005239 | 3300005355 | Bacteria | 10332 |
| 61 | Ga0070671_100007151 | 3300005355 | Bacteria | 8920 |
| 62 | Ga0070671_100026391 | 3300005355 | Bacteria | 4773 |
| 63 | Ga0070674_100444720 | 3300005356 | Bacteria | 1068 |
| 64 | Ga0070673_100000012 | 3300005364 | Bacteria | 141279 |
| 65 | Ga0070659_100008040 | 3300005366 | Bacteria | 7689 |
| 66 | Ga0070659_100009952 | 3300005366 | Bacteria | 6995 |
| 67 | Ga0070659_100011323 | 3300005366 | Bacteria | 6595 |
| 68 | Ga0070659_100053956 | 3300005366 | Bacteria | 3165 |
| 69 | Ga0070659_100329079 | 3300005366 | Bacteria | 1278 |
| 70 | Ga0070659_100540071 | 3300005366 | Unclassified | 997 |
| 71 | Ga0070667_100000024 | 3300005367 | Bacteria | 191216 |
| 72 | Ga0070667_100004758 | 3300005367 | Bacteria | 11377 |
| 73 | Ga0070708_100031159 | 3300005445 | Bacteria | 4613 |
| 74 | Ga0070663_100000253 | 3300005455 | Bacteria | 26965 |
| 75 | Ga0070663_100001203 | 3300005455 | Bacteria | 14224 |
| 76 | Ga0070678_100025162 | 3300005456 | Bacteria | 3999 |
| 77 | Ga0070662_100082969 | 3300005457 | Bacteria | 2391 |
| 78 | Ga0070662_100267401 | 3300005457 | Bacteria | 1379 |
| 79 | Ga0070662_100275303 | 3300005457 | Bacteria | 1360 |
| 80 | Ga0068867_100000003 | 3300005459 | Bacteria | 217886 |
| 81 | Ga0070679_100368702 | 3300005530 | Bacteria | 1383 |
| 82 | Ga0070679_100453648 | 3300005530 | Bacteria | 1227 |
| 83 | Ga0070684_100022141 | 3300005535 | Bacteria | 5297 |
| 84 | Ga0070684_100276457 | 3300005535 | Bacteria | 1538 |
| 85 | Ga0070684_100893289 | 3300005535 | Bacteria | 832 |
| 86 | Ga0068853_100012330 | 3300005539 | Bacteria | 6954 |
| 87 | Ga0068853_100013336 | 3300005539 | Bacteria | 6710 |
| 88 | Ga0068853_100095057 | 3300005539 | Bacteria | 2627 |
| 89 | Ga0068853_100149652 | 3300005539 | Bacteria | 2100 |
| 90 | Ga0068853_100490306 | 3300005539 | Bacteria | 1159 |
| 91 | Ga0070672_100043418 | 3300005543 | Bacteria | 3467 |
| 92 | Ga0070672_100135203 | 3300005543 | Bacteria | 2030 |
| 93 | Ga0070672_100255996 | 3300005543 | Bacteria | 1475 |
| 94 | Ga0070672_100534854 | 3300005543 | Bacteria | 1016 |
| 95 | Ga0070665_100067218 | 3300005548 | Bacteria | 3594 |
| 96 | Ga0068855_100000213 | 3300005563 | Bacteria | 73664 |
| 97 | Ga0068855_100000916 | 3300005563 | Bacteria | 36640 |
| 98 | Ga0068855_100016410 | 3300005563 | Bacteria | 8903 |
| 99 | Ga0068855_100031315 | 3300005563 | Bacteria | 6352 |
| 100 | Ga0068855_100044942 | 3300005563 | Bacteria | 5225 |
| 101 | Ga0068855_100045093 | 3300005563 | Bacteria | 5215 |
| 102 | Ga0070664_100036196 | 3300005564 | Unclassified | 4147 |
| 103 | Ga0070664_100127643 | 3300005564 | Bacteria | 2232 |
| 104 | Ga0070664_100185895 | 3300005564 | Bacteria | 1849 |
| 105 | Ga0070664_100187592 | 3300005564 | Unclassified | 1841 |
| 106 | Ga0070664_100501949 | 3300005564 | Bacteria | 1118 |
| 107 | Ga0068857_100017104 | 3300005577 | Bacteria | 6352 |
| 108 | Ga0068857_100031885 | 3300005577 | Bacteria | 4657 |
| 109 | Ga0068857_100076500 | 3300005577 | Bacteria | 2985 |
| 110 | Ga0068854_100003016 | 3300005578 | Bacteria | 10458 |
| 111 | Ga0068854_100003821 | 3300005578 | Bacteria | 9425 |
| 112 | Ga0068854_100017262 | 3300005578 | Plasmid | 4827 |
| 113 | Ga0068856_100001363 | 3300005614 | Bacteria | 25686 |
| 114 | Ga0068856_100004335 | 3300005614 | Bacteria | 14150 |
| 115 | Ga0068856_100006889 | 3300005614 | Bacteria | 11114 |
| 116 | Ga0068856_100007588 | 3300005614 | Bacteria | 10586 |
| 117 | Ga0068856_100009981 | 3300005614 | Bacteria | 9219 |
| 118 | Ga0068856_100013961 | 3300005614 | Bacteria | 7767 |
| 119 | Ga0068856_100021434 | 3300005614 | Bacteria | 6283 |
| 120 | Ga0068856_100024263 | 3300005614 | Bacteria | 5901 |
| 121 | Ga0068856_100035195 | 3300005614 | Bacteria | 4907 |
| 122 | Ga0068856_100074319 | 3300005614 | Bacteria | 3365 |
| 123 | Ga0068856_100266091 | 3300005614 | Bacteria | 1730 |
| 124 | Ga0068852_100000226 | 3300005616 | Bacteria | 38233 |
| 125 | Ga0068852_100003368 | 3300005616 | Bacteria | 11156 |
| 126 | Ga0068852_100004455 | 3300005616 | Bacteria | 9900 |
| 127 | Ga0068852_100006535 | 3300005616 | Bacteria | 8433 |
| 128 | Ga0068852_100017513 | 3300005616 | Bacteria | 5623 |
| 129 | Ga0068852_100456123 | 3300005616 | Bacteria | 1266 |
| 130 | Ga0068859_100133504 | 3300005617 | Bacteria | 2554 |
| 131 | Ga0068864_100001264 | 3300005618 | Bacteria | 21020 |
| 132 | Ga0068864_100166577 | 3300005618 | Bacteria | 2007 |
| 133 | Ga0068851_10001112 | 3300005834 | Bacteria | 11659 |
| 134 | Ga0068851_10042003 | 3300005834 | Bacteria | 2301 |
| 135 | Ga0068863_100001711 | 3300005841 | Bacteria | 21715 |
| 136 | Ga0068863_100002921 | 3300005841 | Bacteria | 16925 |
| 137 | Ga0068863_100081940 | 3300005841 | Bacteria | 3057 |
| 138 | Ga0068860_100000719 | 3300005843 | Bacteria | 37763 |
| 139 | Ga0081539_10027576 | 3300005985 | Bacteria | 3593 |
| 140 | Ga0070717_10210095 | 3300006028 | Bacteria | 1708 |
| 141 | Ga0075366_10005516 | 3300006195 | Bacteria | 6856 |
| 142 | Ga0097621_100032494 | 3300006237 | Bacteria | 4149 |
| 143 | Ga0075370_10025069 | 3300006353 | Bacteria | 3297 |
| 144 | Ga0068871_100039556 | 3300006358 | Bacteria | 3774 |
| 145 | Ga0068871_100271288 | 3300006358 | Bacteria | 1482 |
| 146 | Ga0068865_100000002 | 3300006881 | Bacteria | 285745 |
| 147 | Ga0097620_100133503 | 3300006931 | Bacteria | 2554 |
| 148 | Ga0105240_10001585 | 3300009093 | Bacteria | 38598 |
| 149 | Ga0105240_10001987 | 3300009093 | Bacteria | 33795 |
| 150 | Ga0105240_10295381 | 3300009093 | Bacteria | 1855 |
| 151 | Ga0105240_10326806 | 3300009093 | Bacteria | 1746 |
| 152 | Ga0105240_10607184 | 3300009093 | Bacteria | 1204 |
| 153 | Ga0111539_10209722 | 3300009094 | Bacteria | 2270 |
| 154 | Ga0105245_10003064 | 3300009098 | Bacteria | 14966 |
| 155 | Ga0105243_10000031 | 3300009148 | Bacteria | 185825 |
| 156 | Ga0105241_10083202 | 3300009174 | Plasmid | 2510 |
| 157 | Ga0105241_10211974 | 3300009174 | Bacteria | 1623 |
| 158 | Ga0105242_10000044 | 3300009176 | Bacteria | 85651 |
| 159 | Ga0105242_10107995 | 3300009176 | Bacteria | 2368 |
| 160 | Ga0105248_10002807 | 3300009177 | Bacteria | 19354 |
| 161 | Ga0105248_10006110 | 3300009177 | Bacteria | 13211 |
| 162 | Ga0105248_10026893 | 3300009177 | Bacteria | 6398 |
| 163 | Ga0105237_10001260 | 3300009545 | Bacteria | 33817 |
| 164 | Ga0105238_10000628 | 3300009551 | Bacteria | 37060 |
| 165 | Ga0105249_10000045 | 3300009553 | Bacteria | 182927 |
| 166 | Ga0105249_10044089 | 3300009553 | Bacteria | 4057 |
| 167 | Ga0105249_10900160 | 3300009553 | Bacteria | 952 |
| 168 | Ga0105239_10002195 | 3300010375 | Bacteria | 25098 |
| 169 | Ga0105239_10048930 | 3300010375 | Bacteria | 4635 |
| 170 | Ga0105246_10004111 | 3300011119 | Bacteria | 8830 |
| 171 | Ga0157373_10003064 | 3300013100 | Bacteria | 12616 |
| 172 | Ga0157373_10011421 | 3300013100 | Bacteria | 6532 |
| 173 | Ga0157373_10033429 | 3300013100 | Bacteria | 3700 |
| 174 | Ga0157373_10058997 | 3300013100 | Bacteria | 2719 |
| 175 | Ga0157373_10117418 | 3300013100 | Bacteria | 1870 |
| 176 | Ga0157373_10174203 | 3300013100 | Bacteria | 1514 |
| 177 | Ga0157371_10000857 | 3300013102 | Bacteria | 34684 |
| 178 | Ga0157371_10007479 | 3300013102 | Bacteria | 8842 |
| 179 | Ga0157371_10025127 | 3300013102 | Bacteria | 4345 |
| 180 | Ga0157371_10067829 | 3300013102 | Bacteria | 2525 |
| 181 | Ga0157371_10071207 | 3300013102 | Bacteria | 2461 |
| 182 | Ga0157370_10000867 | 3300013104 | Bacteria | 38370 |
| 183 | Ga0157370_10001375 | 3300013104 | Bacteria | 30111 |
| 184 | Ga0157370_10001572 | 3300013104 | Bacteria | 28243 |
| 185 | Ga0157370_10040009 | 3300013104 | Plasmid | 4528 |
| 186 | Ga0157370_10096738 | 3300013104 | Bacteria | 2770 |
| 187 | Ga0157370_10135132 | 3300013104 | Bacteria | 2299 |
| 188 | Ga0157370_10197838 | 3300013104 | Bacteria | 1865 |
| 189 | Ga0157370_10597336 | 3300013104 | Unclassified | 1011 |
| 190 | Ga0157369_10000850 | 3300013105 | Bacteria | 38984 |
| 191 | Ga0157369_10001070 | 3300013105 | Bacteria | 34356 |
| 192 | Ga0157369_10001830 | 3300013105 | Bacteria | 25706 |
| 193 | Ga0157369_10004751 | 3300013105 | Bacteria | 15966 |
| 194 | Ga0157369_10008561 | 3300013105 | Bacteria | 11732 |
| 195 | Ga0157369_10014361 | 3300013105 | Bacteria | 8942 |
| 196 | Ga0157369_10034031 | 3300013105 | Bacteria | 5596 |
| 197 | Ga0157369_10192142 | 3300013105 | Bacteria | 2145 |
| 198 | Ga0157369_10339736 | 3300013105 | Bacteria | 1560 |
| 199 | Ga0157374_10003136 | 3300013296 | Bacteria | 13891 |
| 200 | Ga0157374_10018628 | 3300013296 | Bacteria | 6131 |
| 201 | Ga0157378_10004709 | 3300013297 | Bacteria | 11961 |
| 202 | Ga0163162_10031968 | 3300013306 | Bacteria | 5224 |
| 203 | Ga0163162_10036799 | 3300013306 | Bacteria | 4881 |
| 204 | Ga0163162_10084708 | 3300013306 | Bacteria | 3246 |
| 205 | Ga0163162_10187155 | 3300013306 | Bacteria | 2197 |
| 206 | Ga0163162_10226334 | 3300013306 | Bacteria | 2000 |
| 207 | Ga0157372_10000448 | 3300013307 | Bacteria | 45389 |
| 208 | Ga0157372_10002127 | 3300013307 | Bacteria | 21520 |
| 209 | Ga0157372_10043055 | 3300013307 | Bacteria | 4997 |
| 210 | Ga0157372_10081283 | 3300013307 | Bacteria | 3668 |
| 211 | Ga0157372_10199047 | 3300013307 | Bacteria | 2320 |
| 212 | Ga0157375_10017494 | 3300013308 | Bacteria | 6471 |
| 213 | Ga0163163_10004055 | 3300014325 | Bacteria | 12491 |
| 214 | Ga0163163_10942509 | 3300014325 | Bacteria | 927 |
| 215 | Ga0157379_10000457 | 3300014968 | Bacteria | 33074 |
| 216 | Ga0157376_10000107 | 3300014969 | Bacteria | 59840 |
| 217 | Ga0163161_10190439 | 3300017792 | Bacteria | 1577 |
| 218 | Ga0163161_10209647 | 3300017792 | Bacteria | 1505 |
| 219 | Ga0213875_10004951 | 3300021388 | Bacteria | 7227 |
| 220 | Ga0209437_100042 | 3300025233 | Bacteria | 444095 |
| 221 | Ga0209437_100062 | 3300025233 | Bacteria | 336900 |
| 222 | Ga0209148_1000889 | 3300025254 | Bacteria | 20382 |
| 223 | Ga0209148_1002999 | 3300025254 | Bacteria | 5056 |
| 224 | Ga0209233_1000082 | 3300025261 | Bacteria | 336320 |
| 225 | Ga0209233_1000103 | 3300025261 | Bacteria | 284123 |
| 226 | Ga0209233_1011790 | 3300025261 | Bacteria | 2564 |
| 227 | Ga0209565_1000254 | 3300025263 | Bacteria | 56637 |
| 228 | Ga0209455_1001285 | 3300025272 | Bacteria | 11719 |
| 229 | Ga0209025_1056185 | 3300025294 | Bacteria | 1516 |
| 230 | Ga0209564_1002455 | 3300025295 | Bacteria | 14590 |
| 231 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 232 | Ga0209050_1002462 | 3300025298 | Bacteria | 15776 |
| 233 | Ga0207656_10000160 | 3300025321 | Bacteria | 25036 |
| 234 | Ga0207656_10026981 | 3300025321 | Bacteria | 2346 |
| 235 | Ga0207680_10159514 | 3300025903 | Bacteria | 1511 |
| 236 | Ga0207647_10001065 | 3300025904 | Bacteria | 21115 |
| 237 | Ga0207647_10013087 | 3300025904 | Bacteria | 5764 |
| 238 | Ga0207647_10062172 | 3300025904 | Bacteria | 2275 |
| 239 | Ga0207645_10000975 | 3300025907 | Bacteria | 23658 |
| 240 | Ga0207645_10060070 | 3300025907 | Bacteria | 2428 |
| 241 | Ga0207705_10000766 | 3300025909 | Bacteria | 26452 |
| 242 | Ga0207705_10002693 | 3300025909 | Bacteria | 13599 |
| 243 | Ga0207705_10003194 | 3300025909 | Bacteria | 12480 |
| 244 | Ga0207705_10024701 | 3300025909 | Bacteria | 4288 |
| 245 | Ga0207705_10037864 | 3300025909 | Bacteria | 3451 |
| 246 | Ga0207705_10055888 | 3300025909 | Bacteria | 2846 |
| 247 | Ga0207654_10044978 | 3300025911 | Plasmid | 2510 |
| 248 | Ga0207654_10143449 | 3300025911 | Bacteria | 1525 |
| 249 | Ga0207695_10001511 | 3300025913 | Bacteria | 38653 |
| 250 | Ga0207695_10011802 | 3300025913 | Bacteria | 10542 |
| 251 | Ga0207671_10000944 | 3300025914 | Bacteria | 36212 |
| 252 | Ga0207660_10140323 | 3300025917 | Bacteria | 1847 |
| 253 | Ga0207657_10000140 | 3300025919 | Bacteria | 74094 |
| 254 | Ga0207657_10009488 | 3300025919 | Bacteria | 9776 |
| 255 | Ga0207657_10023998 | 3300025919 | Bacteria | 5662 |
| 256 | Ga0207657_10045710 | 3300025919 | Bacteria | 3840 |
| 257 | Ga0207649_10000130 | 3300025920 | Bacteria | 64246 |
| 258 | Ga0207649_10005297 | 3300025920 | Bacteria | 6979 |
| 259 | Ga0207649_10026524 | 3300025920 | Bacteria | 3390 |
| 260 | Ga0207649_10260289 | 3300025920 | Bacteria | 1253 |
| 261 | Ga0207652_10030898 | 3300025921 | Bacteria | 4492 |
| 262 | Ga0207652_10778059 | 3300025921 | Bacteria | 851 |
| 263 | Ga0207681_10013223 | 3300025923 | Bacteria | 5103 |
| 264 | Ga0207694_10002686 | 3300025924 | Bacteria | 14385 |
| 265 | Ga0207694_10544450 | 3300025924 | Bacteria | 974 |
| 266 | Ga0207650_10005442 | 3300025925 | Bacteria | 8693 |
| 267 | Ga0207650_10057374 | 3300025925 | Bacteria | 2896 |
| 268 | Ga0207659_10070678 | 3300025926 | Bacteria | 2546 |
| 269 | Ga0207687_10001332 | 3300025927 | Bacteria | 16888 |
| 270 | Ga0207644_10000141 | 3300025931 | Bacteria | 51791 |
| 271 | Ga0207644_10017199 | 3300025931 | Bacteria | 4878 |
| 272 | Ga0207644_10199749 | 3300025931 | Bacteria | 1577 |
| 273 | Ga0207690_10000063 | 3300025932 | Bacteria | 95620 |
| 274 | Ga0207690_10009586 | 3300025932 | Bacteria | 5750 |
| 275 | Ga0207690_10138841 | 3300025932 | Bacteria | 1788 |
| 276 | Ga0207690_10292566 | 3300025932 | Bacteria | 1272 |
| 277 | Ga0207690_10476338 | 3300025932 | Unclassified | 1007 |
| 278 | Ga0207690_10512973 | 3300025932 | Bacteria | 971 |
| 279 | Ga0207706_10103202 | 3300025933 | Bacteria | 2508 |
| 280 | Ga0207706_10565395 | 3300025933 | Bacteria | 978 |
| 281 | Ga0207686_10000417 | 3300025934 | Bacteria | 29017 |
| 282 | Ga0207709_10000122 | 3300025935 | Bacteria | 116068 |
| 283 | Ga0207704_10000003 | 3300025938 | Bacteria | 285808 |
| 284 | Ga0207691_10057076 | 3300025940 | Bacteria | 3555 |
| 285 | Ga0207711_10001407 | 3300025941 | Bacteria | 22537 |
| 286 | Ga0207711_10027099 | 3300025941 | Bacteria | 4812 |
| 287 | Ga0207711_10040043 | 3300025941 | Bacteria | 3986 |
| 288 | Ga0207689_10000335 | 3300025942 | Bacteria | 43825 |
| 289 | Ga0207661_10000290 | 3300025944 | Bacteria | 31735 |
| 290 | Ga0207679_10001655 | 3300025945 | Bacteria | 13900 |
| 291 | Ga0207679_10075081 | 3300025945 | Bacteria | 2564 |
| 292 | Ga0207679_10156946 | 3300025945 | Unclassified | 1859 |
| 293 | Ga0207679_10202824 | 3300025945 | Bacteria | 1658 |
| 294 | Ga0207679_10382032 | 3300025945 | Bacteria | 1235 |
| 295 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 296 | Ga0207667_10000007 | 3300025949 | Bacteria | 630590 |
| 297 | Ga0207667_10000499 | 3300025949 | Bacteria | 51798 |
| 298 | Ga0207667_10011292 | 3300025949 | Bacteria | 10387 |
| 299 | Ga0207667_10027485 | 3300025949 | Bacteria | 6191 |
| 300 | Ga0207667_10034048 | 3300025949 | Bacteria | 5473 |
| 301 | Ga0207667_10094580 | 3300025949 | Bacteria | 3085 |
| 302 | Ga0207651_10000003 | 3300025960 | Bacteria | 308050 |
| 303 | Ga0207712_10023977 | 3300025961 | Bacteria | 4033 |
| 304 | Ga0207668_10001756 | 3300025972 | Bacteria | 12691 |
| 305 | Ga0207668_10010090 | 3300025972 | Bacteria | 5691 |
| 306 | Ga0207668_10278806 | 3300025972 | Bacteria | 1370 |
| 307 | Ga0207640_10000643 | 3300025981 | Bacteria | 20424 |
| 308 | Ga0207640_10005178 | 3300025981 | Bacteria | 7092 |
| 309 | Ga0207640_10005564 | 3300025981 | Bacteria | 6866 |
| 310 | Ga0207640_10051391 | 3300025981 | Bacteria | 2679 |
| 311 | Ga0207658_10000022 | 3300025986 | Bacteria | 191235 |
| 312 | Ga0207677_10000233 | 3300026023 | Bacteria | 43366 |
| 313 | Ga0207703_10000531 | 3300026035 | Bacteria | 39275 |
| 314 | Ga0207703_10024750 | 3300026035 | Bacteria | 4723 |
| 315 | Ga0207639_10000193 | 3300026041 | Bacteria | 47121 |
| 316 | Ga0207639_10003552 | 3300026041 | Bacteria | 10476 |
| 317 | Ga0207639_10133414 | 3300026041 | Bacteria | 2059 |
| 318 | Ga0207639_10205131 | 3300026041 | Bacteria | 1693 |
| 319 | Ga0207678_10000261 | 3300026067 | Bacteria | 47649 |
| 320 | Ga0207678_10003245 | 3300026067 | Bacteria | 14693 |
| 321 | Ga0207678_10006760 | 3300026067 | Bacteria | 10171 |
| 322 | Ga0207678_10518270 | 3300026067 | Bacteria | 1040 |
| 323 | Ga0207702_10001036 | 3300026078 | Bacteria | 28486 |
| 324 | Ga0207702_10005387 | 3300026078 | Bacteria | 11206 |
| 325 | Ga0207702_10006813 | 3300026078 | Bacteria | 9799 |
| 326 | Ga0207702_10012552 | 3300026078 | Bacteria | 7045 |
| 327 | Ga0207702_10014499 | 3300026078 | Bacteria | 6544 |
| 328 | Ga0207702_10016916 | 3300026078 | Bacteria | 6035 |
| 329 | Ga0207702_10023769 | 3300026078 | Bacteria | 5084 |
| 330 | Ga0207702_10030443 | 3300026078 | Bacteria | 4498 |
| 331 | Ga0207702_10052685 | 3300026078 | Bacteria | 3444 |
| 332 | Ga0207702_10506107 | 3300026078 | Bacteria | 1178 |
| 333 | Ga0207641_10004289 | 3300026088 | Bacteria | 12393 |
| 334 | Ga0207641_10006387 | 3300026088 | Bacteria | 9944 |
| 335 | Ga0207641_10039256 | 3300026088 | Bacteria | 3959 |
| 336 | Ga0207648_10000007 | 3300026089 | Bacteria | 217865 |
| 337 | Ga0207648_10205139 | 3300026089 | Bacteria | 1749 |
| 338 | Ga0207676_10059270 | 3300026095 | Bacteria | 3022 |
| 339 | Ga0207674_10001742 | 3300026116 | Bacteria | 27825 |
| 340 | Ga0207674_10104220 | 3300026116 | Bacteria | 2815 |
| 341 | Ga0207674_10171456 | 3300026116 | Bacteria | 2123 |
| 342 | Ga0207683_10016559 | 3300026121 | Bacteria | 6276 |
| 343 | Ga0207698_10000530 | 3300026142 | Bacteria | 22187 |
| 344 | Ga0207698_10001130 | 3300026142 | Bacteria | 15528 |
| 345 | Ga0207698_10002234 | 3300026142 | Bacteria | 11447 |
| 346 | Ga0207698_10005513 | 3300026142 | Bacteria | 7828 |
| 347 | Ga0207698_10009045 | 3300026142 | Bacteria | 6326 |
| 348 | Ga0207698_10553425 | 3300026142 | Bacteria | 1128 |
| 349 | Ga0209371_1005091 | 3300027312 | Bacteria | 5389 |
| 350 | Ga0268266_10222882 | 3300028379 | Unclassified | 1734 |
| 351 | Ga0268265_10005089 | 3300028380 | Bacteria | 9014 |
| 352 | Ga0268264_10000524 | 3300028381 | Bacteria | 48665 |
| 353 | Ga0268264_10136124 | 3300028381 | Unclassified | 2184 |
| 354 | Ga0268256_1004923 | 3300030500 | Bacteria | 5389 |
| 355 | Ga0307408_100015434 | 3300031548 | Bacteria | 5085 |
| 356 | Ga0307408_100099250 | 3300031548 | Unclassified | 2215 |
| 357 | Ga0307408_100120549 | 3300031548 | Bacteria | 2031 |
| 358 | Ga0307408_100243307 | 3300031548 | Unclassified | 1480 |
| 359 | Ga0307405_10000159 | 3300031731 | Bacteria | 25466 |
| 360 | Ga0307405_10001660 | 3300031731 | Bacteria | 9481 |
| 361 | Ga0307405_10015379 | 3300031731 | Bacteria | 4144 |
| 362 | Ga0307405_10206021 | 3300031731 | Bacteria | 1432 |
| 363 | Ga0307413_10003772 | 3300031824 | Bacteria | 6455 |
| 364 | Ga0307413_10144669 | 3300031824 | Bacteria | 1648 |
| 365 | Ga0307413_10148227 | 3300031824 | Bacteria | 1631 |
| 366 | Ga0307410_10003346 | 3300031852 | Bacteria | 8026 |
| 367 | Ga0307410_10005405 | 3300031852 | Bacteria | 6757 |
| 368 | Ga0307410_10021097 | 3300031852 | Bacteria | 4001 |
| 369 | Ga0307410_10023660 | 3300031852 | Bacteria | 3824 |
| 370 | Ga0307410_10308364 | 3300031852 | Bacteria | 1251 |
| 371 | Ga0307410_10402484 | 3300031852 | Bacteria | 1106 |
| 372 | Ga0307406_10004791 | 3300031901 | Bacteria | 7372 |
| 373 | Ga0307406_10012578 | 3300031901 | Bacteria | 4825 |
| 374 | Ga0307406_10021074 | 3300031901 | Bacteria | 3850 |
| 375 | Ga0307406_10063975 | 3300031901 | Bacteria | 2385 |
| 376 | Ga0307406_10104300 | 3300031901 | Bacteria | 1938 |
| 377 | Ga0307406_10233222 | 3300031901 | Bacteria | 1376 |
| 378 | Ga0307407_10007375 | 3300031903 | Bacteria | 4976 |
| 379 | Ga0307407_10015007 | 3300031903 | Bacteria | 3812 |
| 380 | Ga0307407_10101166 | 3300031903 | Bacteria | 1789 |
| 381 | Ga0307407_10346591 | 3300031903 | Bacteria | 1050 |
| 382 | Ga0307407_10553034 | 3300031903 | Bacteria | 851 |
| 383 | Ga0307412_10001872 | 3300031911 | Bacteria | 11641 |
| 384 | Ga0307412_10006623 | 3300031911 | Bacteria | 6564 |
| 385 | Ga0307412_10007975 | 3300031911 | Bacteria | 6036 |
| 386 | Ga0307412_10029465 | 3300031911 | Bacteria | 3445 |
| 387 | Ga0307412_10034224 | 3300031911 | Bacteria | 3237 |
| 388 | Ga0307412_10066353 | 3300031911 | Bacteria | 2446 |
| 389 | Ga0307412_10126196 | 3300031911 | Bacteria | 1851 |
| 390 | Ga0307412_10941811 | 3300031911 | Bacteria | 759 |
| 391 | Ga0307409_100018630 | 3300031995 | Bacteria | 4675 |
| 392 | Ga0307409_100036109 | 3300031995 | Bacteria | 3628 |
| 393 | Ga0307409_100151502 | 3300031995 | Unclassified | 2014 |
| 394 | Ga0307409_100593943 | 3300031995 | Bacteria | 1093 |
| 395 | Ga0307416_100011282 | 3300032002 | Bacteria | 5945 |
| 396 | Ga0307416_100013702 | 3300032002 | Bacteria | 5520 |
| 397 | Ga0307416_100021888 | 3300032002 | Bacteria | 4602 |
| 398 | Ga0307416_100046977 | 3300032002 | Bacteria | 3413 |
| 399 | Ga0307416_100082813 | 3300032002 | Bacteria | 2719 |
| 400 | Ga0307416_100257844 | 3300032002 | Bacteria | 1702 |
| 401 | Ga0307416_100873503 | 3300032002 | Bacteria | 998 |
| 402 | Ga0307414_10025647 | 3300032004 | Bacteria | 3780 |
| 403 | Ga0307414_10084045 | 3300032004 | Bacteria | 2340 |
| 404 | Ga0307411_10011013 | 3300032005 | Bacteria | 4855 |
| 405 | Ga0307411_10035995 | 3300032005 | Bacteria | 3097 |
| 406 | Ga0307411_10053997 | 3300032005 | Bacteria | 2636 |
| 407 | Ga0307411_10056090 | 3300032005 | Bacteria | 2595 |
| 408 | Ga0307411_10066619 | 3300032005 | Bacteria | 2420 |
| 409 | Ga0307411_10080632 | 3300032005 | Bacteria | 2238 |
| 410 | Ga0307411_10584308 | 3300032005 | Bacteria | 958 |
| 411 | Ga0307411_10864087 | 3300032005 | Bacteria | 801 |
| 412 | Ga0307415_100005623 | 3300032126 | Bacteria | 6672 |
| 413 | Ga0307415_100016410 | 3300032126 | Bacteria | 4414 |
| 414 | Ga0307415_100019197 | 3300032126 | Bacteria | 4145 |
| 415 | Ga0307415_100020466 | 3300032126 | Bacteria | 4041 |
| 416 | Ga0307415_100400493 | 3300032126 | Bacteria | 1172 |
| 417 | Ga0307415_100426780 | 3300032126 | Bacteria | 1139 |
| 418 | Ga0373954_0000021 | 3300035118 | Bacteria | 58989 |
| 419 | Ga0373924_0196951 | 3300035410 | Bacteria | 888 |
| 420 | Ga0373935_0424133 | 3300035692 | Bacteria | 958 |
| 421 | Ga0373933_0012672 | 3300035724 | Bacteria | 4660 |
| 422 | Ga0373937_0000982 | 3300036401 | Bacteria | 24193 |
| 423 | Ga0395899_0000850 | 3300037312 | Bacteria | 29402 |
| 424 | Ga0395899_0000943 | 3300037312 | Bacteria | 27277 |
| 425 | Ga0395899_0013653 | 3300037312 | Bacteria | 6209 |
| 426 | Ga0395899_0036605 | 3300037312 | Bacteria | 3680 |
| 427 | Ga0395899_0101433 | 3300037312 | Bacteria | 2077 |
| 428 | Ga0395899_0127154 | 3300037312 | Bacteria | 1822 |
| 429 | Ga0395899_0313699 | 3300037312 | Bacteria | 1058 |
| 430 | Ga0395900_0000971 | 3300037418 | Bacteria | 37279 |
| 431 | Ga0395900_0001252 | 3300037418 | Bacteria | 31121 |
| 432 | Ga0395900_0002045 | 3300037418 | Bacteria | 22671 |
| 433 | Ga0395900_0004357 | 3300037418 | Bacteria | 15015 |
| 434 | Ga0395900_0005701 | 3300037418 | Bacteria | 13020 |
| 435 | Ga0395900_0007138 | 3300037418 | Bacteria | 11576 |
| 436 | Ga0395900_0013055 | 3300037418 | Bacteria | 8491 |
| 437 | Ga0395900_0016657 | 3300037418 | Bacteria | 7497 |
| 438 | Ga0395900_0023867 | 3300037418 | Bacteria | 6257 |
| 439 | Ga0395900_0074830 | 3300037418 | Bacteria | 3481 |
| 440 | Ga0395900_0141937 | 3300037418 | Bacteria | 2459 |
| 441 | Ga0395900_0693733 | 3300037418 | Bacteria | 952 |
| 442 | Ga0395900_0814748 | 3300037418 | Bacteria | 861 |
| 443 | Ga0395898_0001771 | 3300037466 | Bacteria | 28186 |
| 444 | Ga0395898_0002756 | 3300037466 | Bacteria | 20245 |
| 445 | Ga0395898_0018061 | 3300037466 | Bacteria | 7195 |
| 446 | Ga0395898_0029799 | 3300037466 | Bacteria | 5463 |
| 447 | Ga0395898_0034080 | 3300037466 | Bacteria | 5077 |
| 448 | Ga0395898_0087471 | 3300037466 | Bacteria | 3001 |
| 449 | Ga0395898_0908972 | 3300037466 | Bacteria | 818 |
| 450 | Ga0395905_0000915 | 3300037471 | Bacteria | 38141 |
| 451 | Ga0395905_0000920 | 3300037471 | Bacteria | 38015 |
| 452 | Ga0395905_0001250 | 3300037471 | Bacteria | 31475 |
| 453 | Ga0395905_0004810 | 3300037471 | Bacteria | 13934 |
| 454 | Ga0395905_0010244 | 3300037471 | Bacteria | 9135 |
| 455 | Ga0395905_0012450 | 3300037471 | Bacteria | 8188 |
| 456 | Ga0395905_0023018 | 3300037471 | Bacteria | 5888 |
| 457 | Ga0395905_0028486 | 3300037471 | Bacteria | 5266 |
| 458 | Ga0395905_0030212 | 3300037471 | Bacteria | 5107 |
| 459 | Ga0395905_0032395 | 3300037471 | Unclassified | 4916 |
| 460 | Ga0395905_0051284 | 3300037471 | Bacteria | 3864 |
| 461 | Ga0395905_0172556 | 3300037471 | Bacteria | 2031 |
| 462 | Ga0395905_0191306 | 3300037471 | Bacteria | 1919 |
| 463 | Ga0395905_0276404 | 3300037471 | Unclassified | 1565 |
| 464 | Ga0436364_0885024 | 3300037853 | Bacteria | 20666 |
| 465 | Ga0395901_0000810 | 3300038443 | Bacteria | 34637 |
| 466 | Ga0395901_0001847 | 3300038443 | Bacteria | 21890 |
| 467 | Ga0395901_0001911 | 3300038443 | Bacteria | 21451 |
| 468 | Ga0395901_0002995 | 3300038443 | Bacteria | 17032 |
| 469 | Ga0395901_0005384 | 3300038443 | Bacteria | 12948 |
| 470 | Ga0395901_0021665 | 3300038443 | Bacteria | 6583 |
| 471 | Ga0395901_0021784 | 3300038443 | Bacteria | 6568 |
| 472 | Ga0395901_0116632 | 3300038443 | Unclassified | 2805 |
| 473 | Ga0395901_0168524 | 3300038443 | Bacteria | 2298 |
| 474 | Ga0395901_0205825 | 3300038443 | Bacteria | 2061 |
| 475 | Ga0395901_0236940 | 3300038443 | Bacteria | 1904 |
| 476 | Ga0395901_0277760 | 3300038443 | Bacteria | 1741 |
| 477 | Ga0395901_0658839 | 3300038443 | Bacteria | 1049 |
| 478 | Ga0436361_0798855 | 3300039447 | Bacteria | 1117 |
| 479 | Ga0466966_0013578 | 3300044684 | Bacteria | 5389 |
| 480 | Ga0466966_0153390 | 3300044684 | Bacteria | 1404 |
| 481 | Ga0466961_0008433 | 3300044693 | Bacteria | 6562 |
| 482 | Ga0466963_0058690 | 3300044694 | Bacteria | 2566 |
| 483 | Ga0466963_0078534 | 3300044694 | Bacteria | 2232 |
| 484 | Ga0453684_0126490 | 3300044712 | Bacteria | 3075 |
| 485 | Ga0453684_0203978 | 3300044712 | Unclassified | 2303 |
| 486 | Ga0466970_0103212 | 3300044765 | Bacteria | 1554 |
| 487 | Ga0466970_0325833 | 3300044765 | Bacteria | 869 |
| 488 | Ga0466957_0140424 | 3300044842 | Bacteria | 1556 |
| 489 | Ga0466957_0265506 | 3300044842 | Bacteria | 1145 |
| 490 | Ga0466960_0254455 | 3300044901 | Bacteria | 976 |
| 491 | Ga0466960_0387707 | 3300044901 | Bacteria | 803 |
| 492 | Ga0495585_0001441 | 3300046492 | Bacteria | 18647 |
| 493 | Ga0495596_0000037 | 3300046500 | Bacteria | 95549 |
| 494 | Ga0495583_0000120 | 3300046506 | Bacteria | 133285 |
| 495 | Ga0495583_0000122 | 3300046506 | Bacteria | 132255 |
| 496 | Ga0495583_0086231 | 3300046506 | Bacteria | 1358 |
| 497 | Ga0495606_0041049 | 3300046507 | Bacteria | 3105 |
| 498 | Ga0495610_0007663 | 3300046512 | Bacteria | 7131 |
| 499 | Ga0495637_0051131 | 3300046520 | Bacteria | 1731 |
| 500 | Ga0495643_0000126 | 3300046522 | Bacteria | 123807 |
| 501 | Ga0495609_0026462 | 3300046538 | Bacteria | 2656 |
| 502 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 503 | Ga0495625_0025886 | 3300046660 | Bacteria | 4440 |
| 504 | Ga0495681_0084321 | 3300047470 | Bacteria | 1413 |
| 505 | Ga0495686_0000072 | 3300047472 | Bacteria | 216371 |
| 506 | Ga0495686_0021978 | 3300047472 | Bacteria | 4225 |
| 507 | Ga0495602_0040472 | 3300048088 | Bacteria | 4273 |
| 508 | Ga0496101_0680776 | 3300048904 | Bacteria | 812 |
| 509 | Ga0496102_0113955 | 3300048905 | Bacteria | 2523 |
| 510 | Ga0496107_0511023 | 3300048910 | Bacteria | 891 |
| 511 | Ga0496108_0002824 | 3300048911 | Bacteria | 13936 |
| 512 | Ga0496110_0435326 | 3300048913 | Bacteria | 1195 |
| 513 | Ga0496111_0071011 | 3300048914 | Bacteria | 2534 |
| 514 | Ga0496112_0002939 | 3300048915 | Bacteria | 13887 |
| 515 | Ga0496112_0147535 | 3300048915 | Bacteria | 2320 |
| 516 | Ga0496113_0048526 | 3300048916 | Bacteria | 3159 |
| 517 | Ga0496113_0167759 | 3300048916 | Bacteria | 1738 |
| 518 | Ga0496117_0103524 | 3300048920 | Bacteria | 1794 |
| 519 | Ga0496119_0012929 | 3300048922 | Bacteria | 6716 |
| 520 | Ga0496120_0026303 | 3300048923 | Bacteria | 3595 |
| 521 | Ga0496121_0003242 | 3300048924 | Bacteria | 23388 |
| 522 | Ga0496121_0004012 | 3300048924 | Bacteria | 20280 |
| 523 | Ga0496122_0014110 | 3300048925 | Bacteria | 7750 |
| 524 | Ga0496123_0103073 | 3300048926 | Bacteria | 1654 |
| 525 | Ga0496126_0005195 | 3300048929 | Bacteria | 15033 |
| 526 | Ga0501034_0142143 | 3300049571 | Bacteria | 2379 |
| 527 | Ga0501042_0335682 | 3300049578 | Bacteria | 1093 |
| 528 | Ga0501047_0317337 | 3300049581 | Bacteria | 1399 |
| 529 | nmdc:mga0k408_11907_c1 | 3300050493 | Plasmid | 4745 |
| 530 | Ga0500592_000272 | 3300053116 | Bacteria | 9181 |
| 531 | Ga0500595_001170 | 3300053119 | Bacteria | 14517 |
| 532 | Ga0500618_000378 | 3300053125 | Bacteria | 30686 |
| 533 | Ga0500616_0028973 | 3300053153 | Bacteria | 3049 |
| 534 | Ga0500645_000003 | 3300053730 | Bacteria | 305887 |
| 535 | Ga0530510_0377356 | 3300061734 | Bacteria | 1067 |
| 536 | 2511135616 | 2510917022 | Bacteria | 6504556 |
| 537 | 2511388573 | 2511231027 | Bacteria | 5013807 |
| 538 | 2585272691 | 2582581307 | Bacteria | 6597605 |
| 539 | 2585327324 | 2582581315 | Bacteria | 7318924 |
| 540 | 2585335290 | 2582581316 | Bacteria | 7774528 |
| 541 | 2585562359 | 2585427531 | Bacteria | 6992870 |
| 542 | 2585896800 | 2585427608 | Bacteria | 6544331 |
| 543 | 2585906474 | 2585427609 | Bacteria | 6667127 |
| 544 | 2587981896 | 2585428125 | Bacteria | 6662905 |
| 545 | 2616551904 | 2615840698 | Bacteria | 7319877 |
| 546 | 2671114412 | 2667528174 | Bacteria | 6435400 |
| 547 | 2753767789 | 2751185897 | Bacteria | 5322941 |
| 548 | 2792463237 | 2791355048 | Bacteria | 5832535 |
| 549 | 2819607538 | 2818991448 | Bacteria | 6772224 |
| 550 | 2838032036 | 2838029111 | Bacteria | 6603031 |
| 551 | 2842478768 | 2842475841 | Bacteria | 6603183 |
| 552 | 2842505913 | 2842502639 | Bacteria | 6604161 |
| 553 | 2842876022 | 2842871566 | Bacteria | 4827117 |
| 554 | 2843748175 | 2843744320 | Bacteria | 5659202 |
| 555 | 2848299276 | 2848297114 | Bacteria | 3608511 |
| 556 | 2883579146 | 2883577096 | Bacteria | 4709178 |
| 557 | 2919413134 | 2919408235 | Bacteria | 6149349 |
| 558 | 2928525768 | 2928521798 | Bacteria | 4960112 |
| 559 | 2954012144 | 2954011201 | Bacteria | 4762601 |
| 560 | 3002146424 | 3002141150 | Bacteria | 5254435 |
| 561 | 8005490015 | 8005484373 | Bacteria | 6297373 |
| 562 | 8005650896 | 8005645114 | Bacteria | 6950293 |
| 563 | 8005688450 | 8005682033 | Bacteria | 6726518 |
| 564 | Ga0070671_100005750 | |||
| 565 | JGI24741J21665_1000463 | |||
| 566 | JGI24740J21852_10000050 | |||
| 567 | JGI24740J21852_10000323 | |||
| 568 | JGI24739J22299_10010378 | |||
| 569 | JGI24737J22298_10010456 | |||
| 570 | JGI24737J22298_10033853 | |||
| 571 | JGI24743J22301_10014021 | |||
| 572 | JGI24735J21928_10016107 | |||
| 573 | JGI24735J21928_10024697 | |||
| 574 | JGI24738J21930_10003645 | |||
| 575 | JGI24738J21930_10023772 | |||
| 576 | JGI24744J21845_10004665 | |||
| 577 | JGI25162J39368_1000119 | |||
| 578 | JGI25162J39368_1003173 | |||
| 579 | JGI25165J46597_1000211 | |||
| 580 | JGI25165J46597_1002115 | |||
| 581 | JGI25153J46596_10000007 | |||
| 582 | rootH1_10041865 | |||
| 583 | rootH2_10036567 | |||
| 584 | rootH2_10049253 | |||
| 585 | rootL2_10008491 | |||
| 586 | rootH1_10073304 | |||
| 587 | rootH1_10137120 | |||
| 588 | rootH1_10154429 | |||
| 589 | rootH1_10231694 | |||
| 590 | Ga0055537_1001116 | |||
| 591 | Ga0058692_1024898 | |||
| 592 | Ga0070658_10000978 | |||
| 593 | Ga0070658_10004748 | |||
| 594 | Ga0070658_10020212 | |||
| 595 | Ga0070658_10071779 | |||
| 596 | Ga0070658_10395131 | |||
| 597 | Ga0070676_10000445 | |||
| 598 | Ga0070683_100001007 | |||
| 599 | Ga0070683_100340538 | |||
| 600 | Ga0070690_100147302 | |||
| 601 | Ga0070670_100005738 | |||
| 602 | Ga0070670_100029040 | |||
| 603 | Ga0070670_100130730 | |||
| 604 | Ga0068869_100000113 | |||
| 605 | Ga0070680_100006544 | |||
| 606 | Ga0068868_100000003 | |||
| 607 | Ga0068868_100456763 | |||
| 608 | Ga0070660_100002998 | |||
| 609 | Ga0070660_100005757 | |||
| 610 | Ga0070660_100006194 | |||
| 611 | Ga0070660_100019547 | |||
| 612 | Ga0070661_100000519 | |||
| 613 | Ga0070661_100004462 | |||
| 614 | Ga0070661_100019752 | |||
| 615 | Ga0070661_100055345 | |||
| 616 | Ga0070661_100366876 | |||
| 617 | Ga0070668_100004680 | |||
| 618 | Ga0070668_100091897 | |||
| 619 | Ga0070669_100012471 | |||
| 620 | Ga0070669_100030650 | |||
| 621 | Ga0070669_100170105 | |||
| 622 | Ga0070675_100009907 | |||
| 623 | Ga0070671_100005239 | |||
| 624 | Ga0070671_100007151 | |||
| 625 | Ga0070671_100026391 | |||
| 626 | Ga0070674_100444720 | |||
| 627 | Ga0070673_100000012 | |||
| 628 | Ga0070659_100008040 | |||
| 629 | Ga0070659_100009952 | |||
| 630 | Ga0070659_100011323 | |||
| 631 | Ga0070659_100053956 | |||
| 632 | Ga0070659_100329079 | |||
| 633 | Ga0070659_100540071 | |||
| 634 | Ga0070667_100000024 | |||
| 635 | Ga0070667_100004758 | |||
| 636 | Ga0070708_100031159 | |||
| 637 | Ga0070663_100000253 | |||
| 638 | Ga0070663_100001203 | |||
| 639 | Ga0070678_100025162 | |||
| 640 | Ga0070662_100082969 | |||
| 641 | Ga0070662_100267401 | |||
| 642 | Ga0070662_100275303 | |||
| 643 | Ga0068867_100000003 | |||
| 644 | Ga0070679_100368702 | |||
| 645 | Ga0070679_100453648 | |||
| 646 | Ga0070684_100022141 | |||
| 647 | Ga0070684_100276457 | |||
| 648 | Ga0070684_100893289 | |||
| 649 | Ga0068853_100012330 | |||
| 650 | Ga0068853_100013336 | |||
| 651 | Ga0068853_100095057 | |||
| 652 | Ga0068853_100149652 | |||
| 653 | Ga0068853_100490306 | |||
| 654 | Ga0070672_100043418 | |||
| 655 | Ga0070672_100135203 | |||
| 656 | Ga0070672_100255996 | |||
| 657 | Ga0070672_100534854 | |||
| 658 | Ga0070665_100067218 | |||
| 659 | Ga0068855_100000213 | |||
| 660 | Ga0068855_100000916 | |||
| 661 | Ga0068855_100016410 | |||
| 662 | Ga0068855_100031315 | |||
| 663 | Ga0068855_100044942 | |||
| 664 | Ga0068855_100045093 | |||
| 665 | Ga0070664_100036196 | |||
| 666 | Ga0070664_100127643 | |||
| 667 | Ga0070664_100185895 | |||
| 668 | Ga0070664_100187592 | |||
| 669 | Ga0070664_100501949 | |||
| 670 | Ga0068857_100017104 | |||
| 671 | Ga0068857_100031885 | |||
| 672 | Ga0068857_100076500 | |||
| 673 | Ga0068854_100003016 | |||
| 674 | Ga0068854_100003821 | |||
| 675 | Ga0068854_100017262 | |||
| 676 | Ga0068856_100001363 | |||
| 677 | Ga0068856_100004335 | |||
| 678 | Ga0068856_100006889 | |||
| 679 | Ga0068856_100007588 | |||
| 680 | Ga0068856_100009981 | |||
| 681 | Ga0068856_100013961 | |||
| 682 | Ga0068856_100021434 | |||
| 683 | Ga0068856_100024263 | |||
| 684 | Ga0068856_100035195 | |||
| 685 | Ga0068856_100074319 | |||
| 686 | Ga0068856_100266091 | |||
| 687 | Ga0068852_100000226 | |||
| 688 | Ga0068852_100003368 | |||
| 689 | Ga0068852_100004455 | |||
| 690 | Ga0068852_100006535 | |||
| 691 | Ga0068852_100017513 | |||
| 692 | Ga0068852_100456123 | |||
| 693 | Ga0068859_100133504 | |||
| 694 | Ga0068864_100001264 | |||
| 695 | Ga0068864_100166577 | |||
| 696 | Ga0068851_10001112 | |||
| 697 | Ga0068851_10042003 | |||
| 698 | Ga0068863_100001711 | |||
| 699 | Ga0068863_100002921 | |||
| 700 | Ga0068863_100081940 | |||
| 701 | Ga0068860_100000719 | |||
| 702 | Ga0081539_10027576 | |||
| 703 | Ga0070717_10210095 | |||
| 704 | Ga0075366_10005516 | |||
| 705 | Ga0097621_100032494 | |||
| 706 | Ga0075370_10025069 | |||
| 707 | Ga0068871_100039556 | |||
| 708 | Ga0068871_100271288 | |||
| 709 | Ga0068865_100000002 | |||
| 710 | Ga0097620_100133503 | |||
| 711 | Ga0105240_10001585 | |||
| 712 | Ga0105240_10001987 | |||
| 713 | Ga0105240_10295381 | |||
| 714 | Ga0105240_10326806 | |||
| 715 | Ga0105240_10607184 | |||
| 716 | Ga0111539_10209722 | |||
| 717 | Ga0105245_10003064 | |||
| 718 | Ga0105243_10000031 | |||
| 719 | Ga0105241_10083202 | |||
| 720 | Ga0105241_10211974 | |||
| 721 | Ga0105242_10000044 | |||
| 722 | Ga0105242_10107995 | |||
| 723 | Ga0105248_10002807 | |||
| 724 | Ga0105248_10006110 | |||
| 725 | Ga0105248_10026893 | |||
| 726 | Ga0105237_10001260 | |||
| 727 | Ga0105238_10000628 | |||
| 728 | Ga0105249_10000045 | |||
| 729 | Ga0105249_10044089 | |||
| 730 | Ga0105249_10900160 | |||
| 731 | Ga0105239_10002195 | |||
| 732 | Ga0105239_10048930 | |||
| 733 | Ga0105246_10004111 | |||
| 734 | Ga0157373_10003064 | |||
| 735 | Ga0157373_10011421 | |||
| 736 | Ga0157373_10033429 | |||
| 737 | Ga0157373_10058997 | |||
| 738 | Ga0157373_10117418 | |||
| 739 | Ga0157373_10174203 | |||
| 740 | Ga0157371_10000857 | |||
| 741 | Ga0157371_10007479 | |||
| 742 | Ga0157371_10025127 | |||
| 743 | Ga0157371_10067829 | |||
| 744 | Ga0157371_10071207 | |||
| 745 | Ga0157370_10000867 | |||
| 746 | Ga0157370_10001375 | |||
| 747 | Ga0157370_10001572 | |||
| 748 | Ga0157370_10040009 | |||
| 749 | Ga0157370_10096738 | |||
| 750 | Ga0157370_10135132 | |||
| 751 | Ga0157370_10197838 | |||
| 752 | Ga0157370_10597336 | |||
| 753 | Ga0157369_10000850 | |||
| 754 | Ga0157369_10001070 | |||
| 755 | Ga0157369_10001830 | |||
| 756 | Ga0157369_10004751 | |||
| 757 | Ga0157369_10008561 | |||
| 758 | Ga0157369_10014361 | |||
| 759 | Ga0157369_10034031 | |||
| 760 | Ga0157369_10192142 | |||
| 761 | Ga0157369_10339736 | |||
| 762 | Ga0157374_10003136 | |||
| 763 | Ga0157374_10018628 | |||
| 764 | Ga0157378_10004709 | |||
| 765 | Ga0163162_10031968 | |||
| 766 | Ga0163162_10036799 | |||
| 767 | Ga0163162_10084708 | |||
| 768 | Ga0163162_10187155 | |||
| 769 | Ga0163162_10226334 | |||
| 770 | Ga0157372_10000448 | |||
| 771 | Ga0157372_10002127 | |||
| 772 | Ga0157372_10043055 | |||
| 773 | Ga0157372_10081283 | |||
| 774 | Ga0157372_10199047 | |||
| 775 | Ga0157375_10017494 | |||
| 776 | Ga0163163_10004055 | |||
| 777 | Ga0163163_10942509 | |||
| 778 | Ga0157379_10000457 | |||
| 779 | Ga0157376_10000107 | |||
| 780 | Ga0163161_10190439 | |||
| 781 | Ga0163161_10209647 | |||
| 782 | Ga0213875_10004951 | |||
| 783 | Ga0209437_100042 | |||
| 784 | Ga0209437_100062 | |||
| 785 | Ga0209148_1000889 | |||
| 786 | Ga0209148_1002999 | |||
| 787 | Ga0209233_1000082 | |||
| 788 | Ga0209233_1000103 | |||
| 789 | Ga0209233_1011790 | |||
| 790 | Ga0209565_1000254 | |||
| 791 | Ga0209455_1001285 | |||
| 792 | Ga0209025_1056185 | |||
| 793 | Ga0209564_1002455 | |||
| 794 | Ga0209758_1000017 | |||
| 795 | Ga0209050_1002462 | |||
| 796 | Ga0207656_10000160 | |||
| 797 | Ga0207656_10026981 | |||
| 798 | Ga0207680_10159514 | |||
| 799 | Ga0207647_10001065 | |||
| 800 | Ga0207647_10013087 | |||
| 801 | Ga0207647_10062172 | |||
| 802 | Ga0207645_10000975 | |||
| 803 | Ga0207645_10060070 | |||
| 804 | Ga0207705_10000766 | |||
| 805 | Ga0207705_10002693 | |||
| 806 | Ga0207705_10003194 | |||
| 807 | Ga0207705_10024701 | |||
| 808 | Ga0207705_10037864 | |||
| 809 | Ga0207705_10055888 | |||
| 810 | Ga0207654_10044978 | |||
| 811 | Ga0207654_10143449 | |||
| 812 | Ga0207695_10001511 | |||
| 813 | Ga0207695_10011802 | |||
| 814 | Ga0207671_10000944 | |||
| 815 | Ga0207660_10140323 | |||
| 816 | Ga0207657_10000140 | |||
| 817 | Ga0207657_10009488 | |||
| 818 | Ga0207657_10023998 | |||
| 819 | Ga0207657_10045710 | |||
| 820 | Ga0207649_10000130 | |||
| 821 | Ga0207649_10005297 | |||
| 822 | Ga0207649_10026524 | |||
| 823 | Ga0207649_10260289 | |||
| 824 | Ga0207652_10030898 | |||
| 825 | Ga0207652_10778059 | |||
| 826 | Ga0207681_10013223 | |||
| 827 | Ga0207694_10002686 | |||
| 828 | Ga0207694_10544450 | |||
| 829 | Ga0207650_10005442 | |||
| 830 | Ga0207650_10057374 | |||
| 831 | Ga0207659_10070678 | |||
| 832 | Ga0207687_10001332 | |||
| 833 | Ga0207644_10000141 | |||
| 834 | Ga0207644_10017199 | |||
| 835 | Ga0207644_10199749 | |||
| 836 | Ga0207690_10000063 | |||
| 837 | Ga0207690_10009586 | |||
| 838 | Ga0207690_10138841 | |||
| 839 | Ga0207690_10292566 | |||
| 840 | Ga0207690_10476338 | |||
| 841 | Ga0207690_10512973 | |||
| 842 | Ga0207706_10103202 | |||
| 843 | Ga0207706_10565395 | |||
| 844 | Ga0207686_10000417 | |||
| 845 | Ga0207709_10000122 | |||
| 846 | Ga0207704_10000003 | |||
| 847 | Ga0207691_10057076 | |||
| 848 | Ga0207711_10001407 | |||
| 849 | Ga0207711_10027099 | |||
| 850 | Ga0207711_10040043 | |||
| 851 | Ga0207689_10000335 | |||
| 852 | Ga0207661_10000290 | |||
| 853 | Ga0207679_10001655 | |||
| 854 | Ga0207679_10075081 | |||
| 855 | Ga0207679_10156946 | |||
| 856 | Ga0207679_10202824 | |||
| 857 | Ga0207679_10382032 | |||
| 858 | Ga0207667_10000006 | |||
| 859 | Ga0207667_10000007 | |||
| 860 | Ga0207667_10000499 | |||
| 861 | Ga0207667_10011292 | |||
| 862 | Ga0207667_10027485 | |||
| 863 | Ga0207667_10034048 | |||
| 864 | Ga0207667_10094580 | |||
| 865 | Ga0207651_10000003 | |||
| 866 | Ga0207712_10023977 | |||
| 867 | Ga0207668_10001756 | |||
| 868 | Ga0207668_10010090 | |||
| 869 | Ga0207668_10278806 | |||
| 870 | Ga0207640_10000643 | |||
| 871 | Ga0207640_10005178 | |||
| 872 | Ga0207640_10005564 | |||
| 873 | Ga0207640_10051391 | |||
| 874 | Ga0207658_10000022 | |||
| 875 | Ga0207677_10000233 | |||
| 876 | Ga0207703_10000531 | |||
| 877 | Ga0207703_10024750 | |||
| 878 | Ga0207639_10000193 | |||
| 879 | Ga0207639_10003552 | |||
| 880 | Ga0207639_10133414 | |||
| 881 | Ga0207639_10205131 | |||
| 882 | Ga0207678_10000261 | |||
| 883 | Ga0207678_10003245 | |||
| 884 | Ga0207678_10006760 | |||
| 885 | Ga0207678_10518270 | |||
| 886 | Ga0207702_10001036 | |||
| 887 | Ga0207702_10005387 | |||
| 888 | Ga0207702_10006813 | |||
| 889 | Ga0207702_10012552 | |||
| 890 | Ga0207702_10014499 | |||
| 891 | Ga0207702_10016916 | |||
| 892 | Ga0207702_10023769 | |||
| 893 | Ga0207702_10030443 | |||
| 894 | Ga0207702_10052685 | |||
| 895 | Ga0207702_10506107 | |||
| 896 | Ga0207641_10004289 | |||
| 897 | Ga0207641_10006387 | |||
| 898 | Ga0207641_10039256 | |||
| 899 | Ga0207648_10000007 | |||
| 900 | Ga0207648_10205139 | |||
| 901 | Ga0207676_10059270 | |||
| 902 | Ga0207674_10001742 | |||
| 903 | Ga0207674_10104220 | |||
| 904 | Ga0207674_10171456 | |||
| 905 | Ga0207683_10016559 | |||
| 906 | Ga0207698_10000530 | |||
| 907 | Ga0207698_10001130 | |||
| 908 | Ga0207698_10002234 | |||
| 909 | Ga0207698_10005513 | |||
| 910 | Ga0207698_10009045 | |||
| 911 | Ga0207698_10553425 | |||
| 912 | Ga0209371_1005091 | |||
| 913 | Ga0268266_10222882 | |||
| 914 | Ga0268265_10005089 | |||
| 915 | Ga0268264_10000524 | |||
| 916 | Ga0268264_10136124 | |||
| 917 | Ga0268256_1004923 | |||
| 918 | Ga0307408_100015434 | |||
| 919 | Ga0307408_100099250 | |||
| 920 | Ga0307408_100120549 | |||
| 921 | Ga0307408_100243307 | |||
| 922 | Ga0307405_10000159 | |||
| 923 | Ga0307405_10001660 | |||
| 924 | Ga0307405_10015379 | |||
| 925 | Ga0307405_10206021 | |||
| 926 | Ga0307413_10003772 | |||
| 927 | Ga0307413_10144669 | |||
| 928 | Ga0307413_10148227 | |||
| 929 | Ga0307410_10003346 | |||
| 930 | Ga0307410_10005405 | |||
| 931 | Ga0307410_10021097 | |||
| 932 | Ga0307410_10023660 | |||
| 933 | Ga0307410_10308364 | |||
| 934 | Ga0307410_10402484 | |||
| 935 | Ga0307406_10004791 | |||
| 936 | Ga0307406_10012578 | |||
| 937 | Ga0307406_10021074 | |||
| 938 | Ga0307406_10063975 | |||
| 939 | Ga0307406_10104300 | |||
| 940 | Ga0307406_10233222 | |||
| 941 | Ga0307407_10007375 | |||
| 942 | Ga0307407_10015007 | |||
| 943 | Ga0307407_10101166 | |||
| 944 | Ga0307407_10346591 | |||
| 945 | Ga0307407_10553034 | |||
| 946 | Ga0307412_10001872 | |||
| 947 | Ga0307412_10006623 | |||
| 948 | Ga0307412_10007975 | |||
| 949 | Ga0307412_10029465 | |||
| 950 | Ga0307412_10034224 | |||
| 951 | Ga0307412_10066353 | |||
| 952 | Ga0307412_10126196 | |||
| 953 | Ga0307412_10941811 | |||
| 954 | Ga0307409_100018630 | |||
| 955 | Ga0307409_100036109 | |||
| 956 | Ga0307409_100151502 | |||
| 957 | Ga0307409_100593943 | |||
| 958 | Ga0307416_100011282 | |||
| 959 | Ga0307416_100013702 | |||
| 960 | Ga0307416_100021888 | |||
| 961 | Ga0307416_100046977 | |||
| 962 | Ga0307416_100082813 | |||
| 963 | Ga0307416_100257844 | |||
| 964 | Ga0307416_100873503 | |||
| 965 | Ga0307414_10025647 | |||
| 966 | Ga0307414_10084045 | |||
| 967 | Ga0307411_10011013 | |||
| 968 | Ga0307411_10035995 | |||
| 969 | Ga0307411_10053997 | |||
| 970 | Ga0307411_10056090 | |||
| 971 | Ga0307411_10066619 | |||
| 972 | Ga0307411_10080632 | |||
| 973 | Ga0307411_10584308 | |||
| 974 | Ga0307411_10864087 | |||
| 975 | Ga0307415_100005623 | |||
| 976 | Ga0307415_100016410 | |||
| 977 | Ga0307415_100019197 | |||
| 978 | Ga0307415_100020466 | |||
| 979 | Ga0307415_100400493 | |||
| 980 | Ga0307415_100426780 | |||
| 981 | Ga0373954_0000021 | |||
| 982 | Ga0373924_0196951 | |||
| 983 | Ga0373935_0424133 | |||
| 984 | Ga0373933_0012672 | |||
| 985 | Ga0373937_0000982 | |||
| 986 | Ga0395899_0000850 | |||
| 987 | Ga0395899_0000943 | |||
| 988 | Ga0395899_0013653 | |||
| 989 | Ga0395899_0036605 | |||
| 990 | Ga0395899_0101433 | |||
| 991 | Ga0395899_0127154 | |||
| 992 | Ga0395899_0313699 | |||
| 993 | Ga0395900_0000971 | |||
| 994 | Ga0395900_0001252 | |||
| 995 | Ga0395900_0002045 | |||
| 996 | Ga0395900_0004357 | |||
| 997 | Ga0395900_0005701 | |||
| 998 | Ga0395900_0007138 | |||
| 999 | Ga0395900_0013055 | |||
| 1000 | Ga0395900_0016657 | |||
| 1001 | Ga0395900_0023867 | |||
| 1002 | Ga0395900_0074830 | |||
| 1003 | Ga0395900_0141937 | |||
| 1004 | Ga0395900_0693733 | |||
| 1005 | Ga0395900_0814748 | |||
| 1006 | Ga0395898_0001771 | |||
| 1007 | Ga0395898_0002756 | |||
| 1008 | Ga0395898_0018061 | |||
| 1009 | Ga0395898_0029799 | |||
| 1010 | Ga0395898_0034080 | |||
| 1011 | Ga0395898_0087471 | |||
| 1012 | Ga0395898_0908972 | |||
| 1013 | Ga0395905_0000915 | |||
| 1014 | Ga0395905_0000920 | |||
| 1015 | Ga0395905_0001250 | |||
| 1016 | Ga0395905_0004810 | |||
| 1017 | Ga0395905_0010244 | |||
| 1018 | Ga0395905_0012450 | |||
| 1019 | Ga0395905_0023018 | |||
| 1020 | Ga0395905_0028486 | |||
| 1021 | Ga0395905_0030212 | |||
| 1022 | Ga0395905_0032395 | |||
| 1023 | Ga0395905_0051284 | |||
| 1024 | Ga0395905_0172556 | |||
| 1025 | Ga0395905_0191306 | |||
| 1026 | Ga0395905_0276404 | |||
| 1027 | Ga0436364_0885024 | |||
| 1028 | Ga0395901_0000810 | |||
| 1029 | Ga0395901_0001847 | |||
| 1030 | Ga0395901_0001911 | |||
| 1031 | Ga0395901_0002995 | |||
| 1032 | Ga0395901_0005384 | |||
| 1033 | Ga0395901_0021665 | |||
| 1034 | Ga0395901_0021784 | |||
| 1035 | Ga0395901_0116632 | |||
| 1036 | Ga0395901_0168524 | |||
| 1037 | Ga0395901_0205825 | |||
| 1038 | Ga0395901_0236940 | |||
| 1039 | Ga0395901_0277760 | |||
| 1040 | Ga0395901_0658839 | |||
| 1041 | Ga0436361_0798855 | |||
| 1042 | Ga0466966_0013578 | |||
| 1043 | Ga0466966_0153390 | |||
| 1044 | Ga0466961_0008433 | |||
| 1045 | Ga0466963_0058690 | |||
| 1046 | Ga0466963_0078534 | |||
| 1047 | Ga0453684_0126490 | |||
| 1048 | Ga0453684_0203978 | |||
| 1049 | Ga0466970_0103212 | |||
| 1050 | Ga0466970_0325833 | |||
| 1051 | Ga0466957_0140424 | |||
| 1052 | Ga0466957_0265506 | |||
| 1053 | Ga0466960_0254455 | |||
| 1054 | Ga0466960_0387707 | |||
| 1055 | Ga0495585_0001441 | |||
| 1056 | Ga0495596_0000037 | |||
| 1057 | Ga0495583_0000120 | |||
| 1058 | Ga0495583_0000122 | |||
| 1059 | Ga0495583_0086231 | |||
| 1060 | Ga0495606_0041049 | |||
| 1061 | Ga0495610_0007663 | |||
| 1062 | Ga0495637_0051131 | |||
| 1063 | Ga0495643_0000126 | |||
| 1064 | Ga0495609_0026462 | |||
| 1065 | Ga0495668_0000013 | |||
| 1066 | Ga0495625_0025886 | |||
| 1067 | Ga0495681_0084321 | |||
| 1068 | Ga0495686_0000072 | |||
| 1069 | Ga0495686_0021978 | |||
| 1070 | Ga0495602_0040472 | |||
| 1071 | Ga0496101_0680776 | |||
| 1072 | Ga0496102_0113955 | |||
| 1073 | Ga0496107_0511023 | |||
| 1074 | Ga0496108_0002824 | |||
| 1075 | Ga0496110_0435326 | |||
| 1076 | Ga0496111_0071011 | |||
| 1077 | Ga0496112_0002939 | |||
| 1078 | Ga0496112_0147535 | |||
| 1079 | Ga0496113_0048526 | |||
| 1080 | Ga0496113_0167759 | |||
| 1081 | Ga0496117_0103524 | |||
| 1082 | Ga0496119_0012929 | |||
| 1083 | Ga0496120_0026303 | |||
| 1084 | Ga0496121_0003242 | |||
| 1085 | Ga0496121_0004012 | |||
| 1086 | Ga0496122_0014110 | |||
| 1087 | Ga0496123_0103073 | |||
| 1088 | Ga0496126_0005195 | |||
| 1089 | Ga0501034_0142143 | |||
| 1090 | Ga0501042_0335682 | |||
| 1091 | Ga0501047_0317337 | |||
| 1092 | nmdc:mga0k408_11907_c1 | |||
| 1093 | Ga0500592_000272 | |||
| 1094 | Ga0500595_001170 | |||
| 1095 | Ga0500618_000378 | |||
| 1096 | Ga0500616_0028973 | |||
| 1097 | Ga0500645_000003 | |||
| 1098 | Ga0530510_0377356 | |||
| 1099 | 2511135616 | |||
| 1100 | 2511388573 | |||
| 1101 | 2585272691 | |||
| 1102 | 2585327324 | |||
| 1103 | 2585335290 | |||
| 1104 | 2585562359 | |||
| 1105 | 2585896800 | |||
| 1106 | 2585906474 | |||
| 1107 | 2587981896 | |||
| 1108 | 2616551904 | |||
| 1109 | 2671114412 | |||
| 1110 | 2753767789 | |||
| 1111 | 2792463237 | |||
| 1112 | 2819607538 | |||
| 1113 | 2838032036 | |||
| 1114 | 2842478768 | |||
| 1115 | 2842505913 | |||
| 1116 | 2842876022 | |||
| 1117 | 2843748175 | |||
| 1118 | 2848299276 | |||
| 1119 | 2883579146 | |||
| 1120 | 2919413134 | |||
| 1121 | 2928525768 | |||
| 1122 | 2954012144 | |||
| 1123 | 3002146424 | |||
| 1124 | 8005490015 | |||
| 1125 | 8005650896 | |||
| 1126 | 8005688450 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m96-assembly1.cif.gz_A-2 | atp-bound conformation of the wzmwzt o antigen abc transporter | 0.8903 | 2 | 194 |
| 7dd0-assembly2.cif.gz_B | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.8846 | 2 | 203 |
| 7p48-assembly1.cif.gz_6 | staphylococcus aureus ribosome in complex with sal(b) | 0.8779 | 1 | 196 |
| 7dd0-assembly2.cif.gz_D | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.8767 | 2 | 203 |
| 8dne-assembly1.cif.gz_C | cryoem structure of the a.aeolicus wzmwzt transporter bound to atp | 0.8712 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2L1_4_262_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9143 | 1 | 194 | 3.40.50.300 |
| af_A0A0P0VBQ7_902_1031_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8881 | 2 | 63 | 3.40.50.300 |
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.885 | 2 | 63 | 3.40.50.300 |
| af_A0A1D6JBW9_1150_1300_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8811 | 2 | 65 | 3.40.50.300 |
| af_A0A0R0IY12_408_566_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8787 | 2 | 63 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X4K8Y7-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9549 | 1 | 205 |
GO:0005524
GO:0016020 GO:0016887 GO:0140359 |
| AF-A0A7G4RK67-F1-model_v4 | ABC transporter domain-containing protein | 0.9515 | 1 | 204 |
GO:0005524
GO:0016020 GO:0016887 GO:0140359 |
| AF-A0A7X4K8Y7-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9459 | 1 | 205 |
GO:0005524
GO:0016020 GO:0016887 GO:0140359 |
| AF-Q93UJ9-F1-model_v4 | Wzt2 | 0.943 | 5 | 204 |
GO:0005524
GO:0005886 GO:0016887 GO:0140359 |
| AF-A0A382UWD2-F1-model_v4 | ABC transporter domain-containing protein | 0.9423 | 71 | 188 |
GO:0005524
|