F464019

General Info

Members Datasets Scaffolds Average Seq Length
563 246 1126 227

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100005750|Ga0070671_1000057506
Length 255
Sequence MIRLTNVCKDYPTRVGMRRVLDSINVTVQPGEHLGILGRNGAGKSTLVRLISGAEAPTLGTIERNMAVSWPLAFSGGFQGSLTGADNVRFICRIYGVDYQPRFEFVKDFSELGIYLNEPVATYSSGMRARLAFAISMTIDFDCYLIDEVMAVGDQRFRERCRVELFEKRRDKAMLIVSHSHRYLKNVCDRFLLIEGGRLEDHNDFDEVYFRYKQLIGEGFESREDMVAAMDASTPEAQLRRERKRLRRLAANAGE

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
219 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
220 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
221 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
222 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
223 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
224 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
225 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
226 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
227 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
228 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
229 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
230 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
231 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
232 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
233 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
234 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
235 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
236 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
237 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
238 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
239 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
240 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
241 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
242 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
243 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
244 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
245 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
246 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.03
Metatranscriptomes 0
Isolates 4.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.8
Nodule 0.89
Rhizoplane 1.95
Rhizosphere 87.74
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100005750 3300005355 Bacteria 9876
2 JGI24741J21665_1000463 3300001915 Bacteria 12346
3 JGI24740J21852_10000050 3300001979 Bacteria 37983
4 JGI24740J21852_10000323 3300001979 Bacteria 20340
5 JGI24739J22299_10010378 3300001989 Bacteria 3459
6 JGI24737J22298_10010456 3300001990 Bacteria 3061
7 JGI24737J22298_10033853 3300001990 Bacteria 1586
8 JGI24743J22301_10014021 3300001991 Bacteria 1475
9 JGI24735J21928_10016107 3300002067 Bacteria 2325
10 JGI24735J21928_10024697 3300002067 Bacteria 1816
11 JGI24738J21930_10003645 3300002075 Bacteria 3858
12 JGI24738J21930_10023772 3300002075 Bacteria 1261
13 JGI24744J21845_10004665 3300002077 Bacteria 2831
14 JGI25162J39368_1000119 3300002737 Bacteria 87157
15 JGI25162J39368_1003173 3300002737 Bacteria 5129
16 JGI25165J46597_1000211 3300003214 Bacteria 82463
17 JGI25165J46597_1002115 3300003214 Bacteria 7205
18 JGI25153J46596_10000007 3300003215 Bacteria 377573
19 rootH1_10041865 3300003316 Bacteria 6454
20 rootH2_10036567 3300003320 Bacteria 1410
21 rootH2_10049253 3300003320 Bacteria 4121
22 rootL2_10008491 3300003322 Bacteria 40034
23 rootH1_10073304 3300003323 Bacteria 3930
24 rootH1_10137120 3300003323 Bacteria 6037
25 rootH1_10154429 3300003323 Bacteria 9461
26 rootH1_10231694 3300003323 Bacteria 2738
27 Ga0055537_1001116 3300003773 Bacteria 11593
28 Ga0058692_1024898 3300003856 Bacteria 1195
29 Ga0070658_10000978 3300005327 Bacteria 24540
30 Ga0070658_10004748 3300005327 Bacteria 11057
31 Ga0070658_10020212 3300005327 Bacteria 5335
32 Ga0070658_10071779 3300005327 Bacteria 2836
33 Ga0070658_10395131 3300005327 Bacteria 1187
34 Ga0070676_10000445 3300005328 Bacteria 19700
35 Ga0070683_100001007 3300005329 Bacteria 21089
36 Ga0070683_100340538 3300005329 Bacteria 1428
37 Ga0070690_100147302 3300005330 Bacteria 1603
38 Ga0070670_100005738 3300005331 Bacteria 10484
39 Ga0070670_100029040 3300005331 Bacteria 4759
40 Ga0070670_100130730 3300005331 Bacteria 2168
41 Ga0068869_100000113 3300005334 Bacteria 38756
42 Ga0070680_100006544 3300005336 Bacteria 8861
43 Ga0068868_100000003 3300005338 Bacteria 155611
44 Ga0068868_100456763 3300005338 Bacteria 1112
45 Ga0070660_100002998 3300005339 Bacteria 11630
46 Ga0070660_100005757 3300005339 Bacteria 8586
47 Ga0070660_100006194 3300005339 Bacteria 8277
48 Ga0070660_100019547 3300005339 Bacteria 4965
49 Ga0070661_100000519 3300005344 Bacteria 29559
50 Ga0070661_100004462 3300005344 Bacteria 9649
51 Ga0070661_100019752 3300005344 Bacteria 4802
52 Ga0070661_100055345 3300005344 Bacteria 2905
53 Ga0070661_100366876 3300005344 Bacteria 1133
54 Ga0070668_100004680 3300005347 Bacteria 10143
55 Ga0070668_100091897 3300005347 Bacteria 2393
56 Ga0070669_100012471 3300005353 Bacteria 6030
57 Ga0070669_100030650 3300005353 Bacteria 3882
58 Ga0070669_100170105 3300005353 Bacteria 1698
59 Ga0070675_100009907 3300005354 Bacteria 7430
60 Ga0070671_100005239 3300005355 Bacteria 10332
61 Ga0070671_100007151 3300005355 Bacteria 8920
62 Ga0070671_100026391 3300005355 Bacteria 4773
63 Ga0070674_100444720 3300005356 Bacteria 1068
64 Ga0070673_100000012 3300005364 Bacteria 141279
65 Ga0070659_100008040 3300005366 Bacteria 7689
66 Ga0070659_100009952 3300005366 Bacteria 6995
67 Ga0070659_100011323 3300005366 Bacteria 6595
68 Ga0070659_100053956 3300005366 Bacteria 3165
69 Ga0070659_100329079 3300005366 Bacteria 1278
70 Ga0070659_100540071 3300005366 Unclassified 997
71 Ga0070667_100000024 3300005367 Bacteria 191216
72 Ga0070667_100004758 3300005367 Bacteria 11377
73 Ga0070708_100031159 3300005445 Bacteria 4613
74 Ga0070663_100000253 3300005455 Bacteria 26965
75 Ga0070663_100001203 3300005455 Bacteria 14224
76 Ga0070678_100025162 3300005456 Bacteria 3999
77 Ga0070662_100082969 3300005457 Bacteria 2391
78 Ga0070662_100267401 3300005457 Bacteria 1379
79 Ga0070662_100275303 3300005457 Bacteria 1360
80 Ga0068867_100000003 3300005459 Bacteria 217886
81 Ga0070679_100368702 3300005530 Bacteria 1383
82 Ga0070679_100453648 3300005530 Bacteria 1227
83 Ga0070684_100022141 3300005535 Bacteria 5297
84 Ga0070684_100276457 3300005535 Bacteria 1538
85 Ga0070684_100893289 3300005535 Bacteria 832
86 Ga0068853_100012330 3300005539 Bacteria 6954
87 Ga0068853_100013336 3300005539 Bacteria 6710
88 Ga0068853_100095057 3300005539 Bacteria 2627
89 Ga0068853_100149652 3300005539 Bacteria 2100
90 Ga0068853_100490306 3300005539 Bacteria 1159
91 Ga0070672_100043418 3300005543 Bacteria 3467
92 Ga0070672_100135203 3300005543 Bacteria 2030
93 Ga0070672_100255996 3300005543 Bacteria 1475
94 Ga0070672_100534854 3300005543 Bacteria 1016
95 Ga0070665_100067218 3300005548 Bacteria 3594
96 Ga0068855_100000213 3300005563 Bacteria 73664
97 Ga0068855_100000916 3300005563 Bacteria 36640
98 Ga0068855_100016410 3300005563 Bacteria 8903
99 Ga0068855_100031315 3300005563 Bacteria 6352
100 Ga0068855_100044942 3300005563 Bacteria 5225
101 Ga0068855_100045093 3300005563 Bacteria 5215
102 Ga0070664_100036196 3300005564 Unclassified 4147
103 Ga0070664_100127643 3300005564 Bacteria 2232
104 Ga0070664_100185895 3300005564 Bacteria 1849
105 Ga0070664_100187592 3300005564 Unclassified 1841
106 Ga0070664_100501949 3300005564 Bacteria 1118
107 Ga0068857_100017104 3300005577 Bacteria 6352
108 Ga0068857_100031885 3300005577 Bacteria 4657
109 Ga0068857_100076500 3300005577 Bacteria 2985
110 Ga0068854_100003016 3300005578 Bacteria 10458
111 Ga0068854_100003821 3300005578 Bacteria 9425
112 Ga0068854_100017262 3300005578 Plasmid 4827
113 Ga0068856_100001363 3300005614 Bacteria 25686
114 Ga0068856_100004335 3300005614 Bacteria 14150
115 Ga0068856_100006889 3300005614 Bacteria 11114
116 Ga0068856_100007588 3300005614 Bacteria 10586
117 Ga0068856_100009981 3300005614 Bacteria 9219
118 Ga0068856_100013961 3300005614 Bacteria 7767
119 Ga0068856_100021434 3300005614 Bacteria 6283
120 Ga0068856_100024263 3300005614 Bacteria 5901
121 Ga0068856_100035195 3300005614 Bacteria 4907
122 Ga0068856_100074319 3300005614 Bacteria 3365
123 Ga0068856_100266091 3300005614 Bacteria 1730
124 Ga0068852_100000226 3300005616 Bacteria 38233
125 Ga0068852_100003368 3300005616 Bacteria 11156
126 Ga0068852_100004455 3300005616 Bacteria 9900
127 Ga0068852_100006535 3300005616 Bacteria 8433
128 Ga0068852_100017513 3300005616 Bacteria 5623
129 Ga0068852_100456123 3300005616 Bacteria 1266
130 Ga0068859_100133504 3300005617 Bacteria 2554
131 Ga0068864_100001264 3300005618 Bacteria 21020
132 Ga0068864_100166577 3300005618 Bacteria 2007
133 Ga0068851_10001112 3300005834 Bacteria 11659
134 Ga0068851_10042003 3300005834 Bacteria 2301
135 Ga0068863_100001711 3300005841 Bacteria 21715
136 Ga0068863_100002921 3300005841 Bacteria 16925
137 Ga0068863_100081940 3300005841 Bacteria 3057
138 Ga0068860_100000719 3300005843 Bacteria 37763
139 Ga0081539_10027576 3300005985 Bacteria 3593
140 Ga0070717_10210095 3300006028 Bacteria 1708
141 Ga0075366_10005516 3300006195 Bacteria 6856
142 Ga0097621_100032494 3300006237 Bacteria 4149
143 Ga0075370_10025069 3300006353 Bacteria 3297
144 Ga0068871_100039556 3300006358 Bacteria 3774
145 Ga0068871_100271288 3300006358 Bacteria 1482
146 Ga0068865_100000002 3300006881 Bacteria 285745
147 Ga0097620_100133503 3300006931 Bacteria 2554
148 Ga0105240_10001585 3300009093 Bacteria 38598
149 Ga0105240_10001987 3300009093 Bacteria 33795
150 Ga0105240_10295381 3300009093 Bacteria 1855
151 Ga0105240_10326806 3300009093 Bacteria 1746
152 Ga0105240_10607184 3300009093 Bacteria 1204
153 Ga0111539_10209722 3300009094 Bacteria 2270
154 Ga0105245_10003064 3300009098 Bacteria 14966
155 Ga0105243_10000031 3300009148 Bacteria 185825
156 Ga0105241_10083202 3300009174 Plasmid 2510
157 Ga0105241_10211974 3300009174 Bacteria 1623
158 Ga0105242_10000044 3300009176 Bacteria 85651
159 Ga0105242_10107995 3300009176 Bacteria 2368
160 Ga0105248_10002807 3300009177 Bacteria 19354
161 Ga0105248_10006110 3300009177 Bacteria 13211
162 Ga0105248_10026893 3300009177 Bacteria 6398
163 Ga0105237_10001260 3300009545 Bacteria 33817
164 Ga0105238_10000628 3300009551 Bacteria 37060
165 Ga0105249_10000045 3300009553 Bacteria 182927
166 Ga0105249_10044089 3300009553 Bacteria 4057
167 Ga0105249_10900160 3300009553 Bacteria 952
168 Ga0105239_10002195 3300010375 Bacteria 25098
169 Ga0105239_10048930 3300010375 Bacteria 4635
170 Ga0105246_10004111 3300011119 Bacteria 8830
171 Ga0157373_10003064 3300013100 Bacteria 12616
172 Ga0157373_10011421 3300013100 Bacteria 6532
173 Ga0157373_10033429 3300013100 Bacteria 3700
174 Ga0157373_10058997 3300013100 Bacteria 2719
175 Ga0157373_10117418 3300013100 Bacteria 1870
176 Ga0157373_10174203 3300013100 Bacteria 1514
177 Ga0157371_10000857 3300013102 Bacteria 34684
178 Ga0157371_10007479 3300013102 Bacteria 8842
179 Ga0157371_10025127 3300013102 Bacteria 4345
180 Ga0157371_10067829 3300013102 Bacteria 2525
181 Ga0157371_10071207 3300013102 Bacteria 2461
182 Ga0157370_10000867 3300013104 Bacteria 38370
183 Ga0157370_10001375 3300013104 Bacteria 30111
184 Ga0157370_10001572 3300013104 Bacteria 28243
185 Ga0157370_10040009 3300013104 Plasmid 4528
186 Ga0157370_10096738 3300013104 Bacteria 2770
187 Ga0157370_10135132 3300013104 Bacteria 2299
188 Ga0157370_10197838 3300013104 Bacteria 1865
189 Ga0157370_10597336 3300013104 Unclassified 1011
190 Ga0157369_10000850 3300013105 Bacteria 38984
191 Ga0157369_10001070 3300013105 Bacteria 34356
192 Ga0157369_10001830 3300013105 Bacteria 25706
193 Ga0157369_10004751 3300013105 Bacteria 15966
194 Ga0157369_10008561 3300013105 Bacteria 11732
195 Ga0157369_10014361 3300013105 Bacteria 8942
196 Ga0157369_10034031 3300013105 Bacteria 5596
197 Ga0157369_10192142 3300013105 Bacteria 2145
198 Ga0157369_10339736 3300013105 Bacteria 1560
199 Ga0157374_10003136 3300013296 Bacteria 13891
200 Ga0157374_10018628 3300013296 Bacteria 6131
201 Ga0157378_10004709 3300013297 Bacteria 11961
202 Ga0163162_10031968 3300013306 Bacteria 5224
203 Ga0163162_10036799 3300013306 Bacteria 4881
204 Ga0163162_10084708 3300013306 Bacteria 3246
205 Ga0163162_10187155 3300013306 Bacteria 2197
206 Ga0163162_10226334 3300013306 Bacteria 2000
207 Ga0157372_10000448 3300013307 Bacteria 45389
208 Ga0157372_10002127 3300013307 Bacteria 21520
209 Ga0157372_10043055 3300013307 Bacteria 4997
210 Ga0157372_10081283 3300013307 Bacteria 3668
211 Ga0157372_10199047 3300013307 Bacteria 2320
212 Ga0157375_10017494 3300013308 Bacteria 6471
213 Ga0163163_10004055 3300014325 Bacteria 12491
214 Ga0163163_10942509 3300014325 Bacteria 927
215 Ga0157379_10000457 3300014968 Bacteria 33074
216 Ga0157376_10000107 3300014969 Bacteria 59840
217 Ga0163161_10190439 3300017792 Bacteria 1577
218 Ga0163161_10209647 3300017792 Bacteria 1505
219 Ga0213875_10004951 3300021388 Bacteria 7227
220 Ga0209437_100042 3300025233 Bacteria 444095
221 Ga0209437_100062 3300025233 Bacteria 336900
222 Ga0209148_1000889 3300025254 Bacteria 20382
223 Ga0209148_1002999 3300025254 Bacteria 5056
224 Ga0209233_1000082 3300025261 Bacteria 336320
225 Ga0209233_1000103 3300025261 Bacteria 284123
226 Ga0209233_1011790 3300025261 Bacteria 2564
227 Ga0209565_1000254 3300025263 Bacteria 56637
228 Ga0209455_1001285 3300025272 Bacteria 11719
229 Ga0209025_1056185 3300025294 Bacteria 1516
230 Ga0209564_1002455 3300025295 Bacteria 14590
231 Ga0209758_1000017 3300025297 Bacteria 754393
232 Ga0209050_1002462 3300025298 Bacteria 15776
233 Ga0207656_10000160 3300025321 Bacteria 25036
234 Ga0207656_10026981 3300025321 Bacteria 2346
235 Ga0207680_10159514 3300025903 Bacteria 1511
236 Ga0207647_10001065 3300025904 Bacteria 21115
237 Ga0207647_10013087 3300025904 Bacteria 5764
238 Ga0207647_10062172 3300025904 Bacteria 2275
239 Ga0207645_10000975 3300025907 Bacteria 23658
240 Ga0207645_10060070 3300025907 Bacteria 2428
241 Ga0207705_10000766 3300025909 Bacteria 26452
242 Ga0207705_10002693 3300025909 Bacteria 13599
243 Ga0207705_10003194 3300025909 Bacteria 12480
244 Ga0207705_10024701 3300025909 Bacteria 4288
245 Ga0207705_10037864 3300025909 Bacteria 3451
246 Ga0207705_10055888 3300025909 Bacteria 2846
247 Ga0207654_10044978 3300025911 Plasmid 2510
248 Ga0207654_10143449 3300025911 Bacteria 1525
249 Ga0207695_10001511 3300025913 Bacteria 38653
250 Ga0207695_10011802 3300025913 Bacteria 10542
251 Ga0207671_10000944 3300025914 Bacteria 36212
252 Ga0207660_10140323 3300025917 Bacteria 1847
253 Ga0207657_10000140 3300025919 Bacteria 74094
254 Ga0207657_10009488 3300025919 Bacteria 9776
255 Ga0207657_10023998 3300025919 Bacteria 5662
256 Ga0207657_10045710 3300025919 Bacteria 3840
257 Ga0207649_10000130 3300025920 Bacteria 64246
258 Ga0207649_10005297 3300025920 Bacteria 6979
259 Ga0207649_10026524 3300025920 Bacteria 3390
260 Ga0207649_10260289 3300025920 Bacteria 1253
261 Ga0207652_10030898 3300025921 Bacteria 4492
262 Ga0207652_10778059 3300025921 Bacteria 851
263 Ga0207681_10013223 3300025923 Bacteria 5103
264 Ga0207694_10002686 3300025924 Bacteria 14385
265 Ga0207694_10544450 3300025924 Bacteria 974
266 Ga0207650_10005442 3300025925 Bacteria 8693
267 Ga0207650_10057374 3300025925 Bacteria 2896
268 Ga0207659_10070678 3300025926 Bacteria 2546
269 Ga0207687_10001332 3300025927 Bacteria 16888
270 Ga0207644_10000141 3300025931 Bacteria 51791
271 Ga0207644_10017199 3300025931 Bacteria 4878
272 Ga0207644_10199749 3300025931 Bacteria 1577
273 Ga0207690_10000063 3300025932 Bacteria 95620
274 Ga0207690_10009586 3300025932 Bacteria 5750
275 Ga0207690_10138841 3300025932 Bacteria 1788
276 Ga0207690_10292566 3300025932 Bacteria 1272
277 Ga0207690_10476338 3300025932 Unclassified 1007
278 Ga0207690_10512973 3300025932 Bacteria 971
279 Ga0207706_10103202 3300025933 Bacteria 2508
280 Ga0207706_10565395 3300025933 Bacteria 978
281 Ga0207686_10000417 3300025934 Bacteria 29017
282 Ga0207709_10000122 3300025935 Bacteria 116068
283 Ga0207704_10000003 3300025938 Bacteria 285808
284 Ga0207691_10057076 3300025940 Bacteria 3555
285 Ga0207711_10001407 3300025941 Bacteria 22537
286 Ga0207711_10027099 3300025941 Bacteria 4812
287 Ga0207711_10040043 3300025941 Bacteria 3986
288 Ga0207689_10000335 3300025942 Bacteria 43825
289 Ga0207661_10000290 3300025944 Bacteria 31735
290 Ga0207679_10001655 3300025945 Bacteria 13900
291 Ga0207679_10075081 3300025945 Bacteria 2564
292 Ga0207679_10156946 3300025945 Unclassified 1859
293 Ga0207679_10202824 3300025945 Bacteria 1658
294 Ga0207679_10382032 3300025945 Bacteria 1235
295 Ga0207667_10000006 3300025949 Bacteria 679876
296 Ga0207667_10000007 3300025949 Bacteria 630590
297 Ga0207667_10000499 3300025949 Bacteria 51798
298 Ga0207667_10011292 3300025949 Bacteria 10387
299 Ga0207667_10027485 3300025949 Bacteria 6191
300 Ga0207667_10034048 3300025949 Bacteria 5473
301 Ga0207667_10094580 3300025949 Bacteria 3085
302 Ga0207651_10000003 3300025960 Bacteria 308050
303 Ga0207712_10023977 3300025961 Bacteria 4033
304 Ga0207668_10001756 3300025972 Bacteria 12691
305 Ga0207668_10010090 3300025972 Bacteria 5691
306 Ga0207668_10278806 3300025972 Bacteria 1370
307 Ga0207640_10000643 3300025981 Bacteria 20424
308 Ga0207640_10005178 3300025981 Bacteria 7092
309 Ga0207640_10005564 3300025981 Bacteria 6866
310 Ga0207640_10051391 3300025981 Bacteria 2679
311 Ga0207658_10000022 3300025986 Bacteria 191235
312 Ga0207677_10000233 3300026023 Bacteria 43366
313 Ga0207703_10000531 3300026035 Bacteria 39275
314 Ga0207703_10024750 3300026035 Bacteria 4723
315 Ga0207639_10000193 3300026041 Bacteria 47121
316 Ga0207639_10003552 3300026041 Bacteria 10476
317 Ga0207639_10133414 3300026041 Bacteria 2059
318 Ga0207639_10205131 3300026041 Bacteria 1693
319 Ga0207678_10000261 3300026067 Bacteria 47649
320 Ga0207678_10003245 3300026067 Bacteria 14693
321 Ga0207678_10006760 3300026067 Bacteria 10171
322 Ga0207678_10518270 3300026067 Bacteria 1040
323 Ga0207702_10001036 3300026078 Bacteria 28486
324 Ga0207702_10005387 3300026078 Bacteria 11206
325 Ga0207702_10006813 3300026078 Bacteria 9799
326 Ga0207702_10012552 3300026078 Bacteria 7045
327 Ga0207702_10014499 3300026078 Bacteria 6544
328 Ga0207702_10016916 3300026078 Bacteria 6035
329 Ga0207702_10023769 3300026078 Bacteria 5084
330 Ga0207702_10030443 3300026078 Bacteria 4498
331 Ga0207702_10052685 3300026078 Bacteria 3444
332 Ga0207702_10506107 3300026078 Bacteria 1178
333 Ga0207641_10004289 3300026088 Bacteria 12393
334 Ga0207641_10006387 3300026088 Bacteria 9944
335 Ga0207641_10039256 3300026088 Bacteria 3959
336 Ga0207648_10000007 3300026089 Bacteria 217865
337 Ga0207648_10205139 3300026089 Bacteria 1749
338 Ga0207676_10059270 3300026095 Bacteria 3022
339 Ga0207674_10001742 3300026116 Bacteria 27825
340 Ga0207674_10104220 3300026116 Bacteria 2815
341 Ga0207674_10171456 3300026116 Bacteria 2123
342 Ga0207683_10016559 3300026121 Bacteria 6276
343 Ga0207698_10000530 3300026142 Bacteria 22187
344 Ga0207698_10001130 3300026142 Bacteria 15528
345 Ga0207698_10002234 3300026142 Bacteria 11447
346 Ga0207698_10005513 3300026142 Bacteria 7828
347 Ga0207698_10009045 3300026142 Bacteria 6326
348 Ga0207698_10553425 3300026142 Bacteria 1128
349 Ga0209371_1005091 3300027312 Bacteria 5389
350 Ga0268266_10222882 3300028379 Unclassified 1734
351 Ga0268265_10005089 3300028380 Bacteria 9014
352 Ga0268264_10000524 3300028381 Bacteria 48665
353 Ga0268264_10136124 3300028381 Unclassified 2184
354 Ga0268256_1004923 3300030500 Bacteria 5389
355 Ga0307408_100015434 3300031548 Bacteria 5085
356 Ga0307408_100099250 3300031548 Unclassified 2215
357 Ga0307408_100120549 3300031548 Bacteria 2031
358 Ga0307408_100243307 3300031548 Unclassified 1480
359 Ga0307405_10000159 3300031731 Bacteria 25466
360 Ga0307405_10001660 3300031731 Bacteria 9481
361 Ga0307405_10015379 3300031731 Bacteria 4144
362 Ga0307405_10206021 3300031731 Bacteria 1432
363 Ga0307413_10003772 3300031824 Bacteria 6455
364 Ga0307413_10144669 3300031824 Bacteria 1648
365 Ga0307413_10148227 3300031824 Bacteria 1631
366 Ga0307410_10003346 3300031852 Bacteria 8026
367 Ga0307410_10005405 3300031852 Bacteria 6757
368 Ga0307410_10021097 3300031852 Bacteria 4001
369 Ga0307410_10023660 3300031852 Bacteria 3824
370 Ga0307410_10308364 3300031852 Bacteria 1251
371 Ga0307410_10402484 3300031852 Bacteria 1106
372 Ga0307406_10004791 3300031901 Bacteria 7372
373 Ga0307406_10012578 3300031901 Bacteria 4825
374 Ga0307406_10021074 3300031901 Bacteria 3850
375 Ga0307406_10063975 3300031901 Bacteria 2385
376 Ga0307406_10104300 3300031901 Bacteria 1938
377 Ga0307406_10233222 3300031901 Bacteria 1376
378 Ga0307407_10007375 3300031903 Bacteria 4976
379 Ga0307407_10015007 3300031903 Bacteria 3812
380 Ga0307407_10101166 3300031903 Bacteria 1789
381 Ga0307407_10346591 3300031903 Bacteria 1050
382 Ga0307407_10553034 3300031903 Bacteria 851
383 Ga0307412_10001872 3300031911 Bacteria 11641
384 Ga0307412_10006623 3300031911 Bacteria 6564
385 Ga0307412_10007975 3300031911 Bacteria 6036
386 Ga0307412_10029465 3300031911 Bacteria 3445
387 Ga0307412_10034224 3300031911 Bacteria 3237
388 Ga0307412_10066353 3300031911 Bacteria 2446
389 Ga0307412_10126196 3300031911 Bacteria 1851
390 Ga0307412_10941811 3300031911 Bacteria 759
391 Ga0307409_100018630 3300031995 Bacteria 4675
392 Ga0307409_100036109 3300031995 Bacteria 3628
393 Ga0307409_100151502 3300031995 Unclassified 2014
394 Ga0307409_100593943 3300031995 Bacteria 1093
395 Ga0307416_100011282 3300032002 Bacteria 5945
396 Ga0307416_100013702 3300032002 Bacteria 5520
397 Ga0307416_100021888 3300032002 Bacteria 4602
398 Ga0307416_100046977 3300032002 Bacteria 3413
399 Ga0307416_100082813 3300032002 Bacteria 2719
400 Ga0307416_100257844 3300032002 Bacteria 1702
401 Ga0307416_100873503 3300032002 Bacteria 998
402 Ga0307414_10025647 3300032004 Bacteria 3780
403 Ga0307414_10084045 3300032004 Bacteria 2340
404 Ga0307411_10011013 3300032005 Bacteria 4855
405 Ga0307411_10035995 3300032005 Bacteria 3097
406 Ga0307411_10053997 3300032005 Bacteria 2636
407 Ga0307411_10056090 3300032005 Bacteria 2595
408 Ga0307411_10066619 3300032005 Bacteria 2420
409 Ga0307411_10080632 3300032005 Bacteria 2238
410 Ga0307411_10584308 3300032005 Bacteria 958
411 Ga0307411_10864087 3300032005 Bacteria 801
412 Ga0307415_100005623 3300032126 Bacteria 6672
413 Ga0307415_100016410 3300032126 Bacteria 4414
414 Ga0307415_100019197 3300032126 Bacteria 4145
415 Ga0307415_100020466 3300032126 Bacteria 4041
416 Ga0307415_100400493 3300032126 Bacteria 1172
417 Ga0307415_100426780 3300032126 Bacteria 1139
418 Ga0373954_0000021 3300035118 Bacteria 58989
419 Ga0373924_0196951 3300035410 Bacteria 888
420 Ga0373935_0424133 3300035692 Bacteria 958
421 Ga0373933_0012672 3300035724 Bacteria 4660
422 Ga0373937_0000982 3300036401 Bacteria 24193
423 Ga0395899_0000850 3300037312 Bacteria 29402
424 Ga0395899_0000943 3300037312 Bacteria 27277
425 Ga0395899_0013653 3300037312 Bacteria 6209
426 Ga0395899_0036605 3300037312 Bacteria 3680
427 Ga0395899_0101433 3300037312 Bacteria 2077
428 Ga0395899_0127154 3300037312 Bacteria 1822
429 Ga0395899_0313699 3300037312 Bacteria 1058
430 Ga0395900_0000971 3300037418 Bacteria 37279
431 Ga0395900_0001252 3300037418 Bacteria 31121
432 Ga0395900_0002045 3300037418 Bacteria 22671
433 Ga0395900_0004357 3300037418 Bacteria 15015
434 Ga0395900_0005701 3300037418 Bacteria 13020
435 Ga0395900_0007138 3300037418 Bacteria 11576
436 Ga0395900_0013055 3300037418 Bacteria 8491
437 Ga0395900_0016657 3300037418 Bacteria 7497
438 Ga0395900_0023867 3300037418 Bacteria 6257
439 Ga0395900_0074830 3300037418 Bacteria 3481
440 Ga0395900_0141937 3300037418 Bacteria 2459
441 Ga0395900_0693733 3300037418 Bacteria 952
442 Ga0395900_0814748 3300037418 Bacteria 861
443 Ga0395898_0001771 3300037466 Bacteria 28186
444 Ga0395898_0002756 3300037466 Bacteria 20245
445 Ga0395898_0018061 3300037466 Bacteria 7195
446 Ga0395898_0029799 3300037466 Bacteria 5463
447 Ga0395898_0034080 3300037466 Bacteria 5077
448 Ga0395898_0087471 3300037466 Bacteria 3001
449 Ga0395898_0908972 3300037466 Bacteria 818
450 Ga0395905_0000915 3300037471 Bacteria 38141
451 Ga0395905_0000920 3300037471 Bacteria 38015
452 Ga0395905_0001250 3300037471 Bacteria 31475
453 Ga0395905_0004810 3300037471 Bacteria 13934
454 Ga0395905_0010244 3300037471 Bacteria 9135
455 Ga0395905_0012450 3300037471 Bacteria 8188
456 Ga0395905_0023018 3300037471 Bacteria 5888
457 Ga0395905_0028486 3300037471 Bacteria 5266
458 Ga0395905_0030212 3300037471 Bacteria 5107
459 Ga0395905_0032395 3300037471 Unclassified 4916
460 Ga0395905_0051284 3300037471 Bacteria 3864
461 Ga0395905_0172556 3300037471 Bacteria 2031
462 Ga0395905_0191306 3300037471 Bacteria 1919
463 Ga0395905_0276404 3300037471 Unclassified 1565
464 Ga0436364_0885024 3300037853 Bacteria 20666
465 Ga0395901_0000810 3300038443 Bacteria 34637
466 Ga0395901_0001847 3300038443 Bacteria 21890
467 Ga0395901_0001911 3300038443 Bacteria 21451
468 Ga0395901_0002995 3300038443 Bacteria 17032
469 Ga0395901_0005384 3300038443 Bacteria 12948
470 Ga0395901_0021665 3300038443 Bacteria 6583
471 Ga0395901_0021784 3300038443 Bacteria 6568
472 Ga0395901_0116632 3300038443 Unclassified 2805
473 Ga0395901_0168524 3300038443 Bacteria 2298
474 Ga0395901_0205825 3300038443 Bacteria 2061
475 Ga0395901_0236940 3300038443 Bacteria 1904
476 Ga0395901_0277760 3300038443 Bacteria 1741
477 Ga0395901_0658839 3300038443 Bacteria 1049
478 Ga0436361_0798855 3300039447 Bacteria 1117
479 Ga0466966_0013578 3300044684 Bacteria 5389
480 Ga0466966_0153390 3300044684 Bacteria 1404
481 Ga0466961_0008433 3300044693 Bacteria 6562
482 Ga0466963_0058690 3300044694 Bacteria 2566
483 Ga0466963_0078534 3300044694 Bacteria 2232
484 Ga0453684_0126490 3300044712 Bacteria 3075
485 Ga0453684_0203978 3300044712 Unclassified 2303
486 Ga0466970_0103212 3300044765 Bacteria 1554
487 Ga0466970_0325833 3300044765 Bacteria 869
488 Ga0466957_0140424 3300044842 Bacteria 1556
489 Ga0466957_0265506 3300044842 Bacteria 1145
490 Ga0466960_0254455 3300044901 Bacteria 976
491 Ga0466960_0387707 3300044901 Bacteria 803
492 Ga0495585_0001441 3300046492 Bacteria 18647
493 Ga0495596_0000037 3300046500 Bacteria 95549
494 Ga0495583_0000120 3300046506 Bacteria 133285
495 Ga0495583_0000122 3300046506 Bacteria 132255
496 Ga0495583_0086231 3300046506 Bacteria 1358
497 Ga0495606_0041049 3300046507 Bacteria 3105
498 Ga0495610_0007663 3300046512 Bacteria 7131
499 Ga0495637_0051131 3300046520 Bacteria 1731
500 Ga0495643_0000126 3300046522 Bacteria 123807
501 Ga0495609_0026462 3300046538 Bacteria 2656
502 Ga0495668_0000013 3300046616 Bacteria 452938
503 Ga0495625_0025886 3300046660 Bacteria 4440
504 Ga0495681_0084321 3300047470 Bacteria 1413
505 Ga0495686_0000072 3300047472 Bacteria 216371
506 Ga0495686_0021978 3300047472 Bacteria 4225
507 Ga0495602_0040472 3300048088 Bacteria 4273
508 Ga0496101_0680776 3300048904 Bacteria 812
509 Ga0496102_0113955 3300048905 Bacteria 2523
510 Ga0496107_0511023 3300048910 Bacteria 891
511 Ga0496108_0002824 3300048911 Bacteria 13936
512 Ga0496110_0435326 3300048913 Bacteria 1195
513 Ga0496111_0071011 3300048914 Bacteria 2534
514 Ga0496112_0002939 3300048915 Bacteria 13887
515 Ga0496112_0147535 3300048915 Bacteria 2320
516 Ga0496113_0048526 3300048916 Bacteria 3159
517 Ga0496113_0167759 3300048916 Bacteria 1738
518 Ga0496117_0103524 3300048920 Bacteria 1794
519 Ga0496119_0012929 3300048922 Bacteria 6716
520 Ga0496120_0026303 3300048923 Bacteria 3595
521 Ga0496121_0003242 3300048924 Bacteria 23388
522 Ga0496121_0004012 3300048924 Bacteria 20280
523 Ga0496122_0014110 3300048925 Bacteria 7750
524 Ga0496123_0103073 3300048926 Bacteria 1654
525 Ga0496126_0005195 3300048929 Bacteria 15033
526 Ga0501034_0142143 3300049571 Bacteria 2379
527 Ga0501042_0335682 3300049578 Bacteria 1093
528 Ga0501047_0317337 3300049581 Bacteria 1399
529 nmdc:mga0k408_11907_c1 3300050493 Plasmid 4745
530 Ga0500592_000272 3300053116 Bacteria 9181
531 Ga0500595_001170 3300053119 Bacteria 14517
532 Ga0500618_000378 3300053125 Bacteria 30686
533 Ga0500616_0028973 3300053153 Bacteria 3049
534 Ga0500645_000003 3300053730 Bacteria 305887
535 Ga0530510_0377356 3300061734 Bacteria 1067
536 2511135616 2510917022 Bacteria 6504556
537 2511388573 2511231027 Bacteria 5013807
538 2585272691 2582581307 Bacteria 6597605
539 2585327324 2582581315 Bacteria 7318924
540 2585335290 2582581316 Bacteria 7774528
541 2585562359 2585427531 Bacteria 6992870
542 2585896800 2585427608 Bacteria 6544331
543 2585906474 2585427609 Bacteria 6667127
544 2587981896 2585428125 Bacteria 6662905
545 2616551904 2615840698 Bacteria 7319877
546 2671114412 2667528174 Bacteria 6435400
547 2753767789 2751185897 Bacteria 5322941
548 2792463237 2791355048 Bacteria 5832535
549 2819607538 2818991448 Bacteria 6772224
550 2838032036 2838029111 Bacteria 6603031
551 2842478768 2842475841 Bacteria 6603183
552 2842505913 2842502639 Bacteria 6604161
553 2842876022 2842871566 Bacteria 4827117
554 2843748175 2843744320 Bacteria 5659202
555 2848299276 2848297114 Bacteria 3608511
556 2883579146 2883577096 Bacteria 4709178
557 2919413134 2919408235 Bacteria 6149349
558 2928525768 2928521798 Bacteria 4960112
559 2954012144 2954011201 Bacteria 4762601
560 3002146424 3002141150 Bacteria 5254435
561 8005490015 8005484373 Bacteria 6297373
562 8005650896 8005645114 Bacteria 6950293
563 8005688450 8005682033 Bacteria 6726518
564 Ga0070671_100005750
565 JGI24741J21665_1000463
566 JGI24740J21852_10000050
567 JGI24740J21852_10000323
568 JGI24739J22299_10010378
569 JGI24737J22298_10010456
570 JGI24737J22298_10033853
571 JGI24743J22301_10014021
572 JGI24735J21928_10016107
573 JGI24735J21928_10024697
574 JGI24738J21930_10003645
575 JGI24738J21930_10023772
576 JGI24744J21845_10004665
577 JGI25162J39368_1000119
578 JGI25162J39368_1003173
579 JGI25165J46597_1000211
580 JGI25165J46597_1002115
581 JGI25153J46596_10000007
582 rootH1_10041865
583 rootH2_10036567
584 rootH2_10049253
585 rootL2_10008491
586 rootH1_10073304
587 rootH1_10137120
588 rootH1_10154429
589 rootH1_10231694
590 Ga0055537_1001116
591 Ga0058692_1024898
592 Ga0070658_10000978
593 Ga0070658_10004748
594 Ga0070658_10020212
595 Ga0070658_10071779
596 Ga0070658_10395131
597 Ga0070676_10000445
598 Ga0070683_100001007
599 Ga0070683_100340538
600 Ga0070690_100147302
601 Ga0070670_100005738
602 Ga0070670_100029040
603 Ga0070670_100130730
604 Ga0068869_100000113
605 Ga0070680_100006544
606 Ga0068868_100000003
607 Ga0068868_100456763
608 Ga0070660_100002998
609 Ga0070660_100005757
610 Ga0070660_100006194
611 Ga0070660_100019547
612 Ga0070661_100000519
613 Ga0070661_100004462
614 Ga0070661_100019752
615 Ga0070661_100055345
616 Ga0070661_100366876
617 Ga0070668_100004680
618 Ga0070668_100091897
619 Ga0070669_100012471
620 Ga0070669_100030650
621 Ga0070669_100170105
622 Ga0070675_100009907
623 Ga0070671_100005239
624 Ga0070671_100007151
625 Ga0070671_100026391
626 Ga0070674_100444720
627 Ga0070673_100000012
628 Ga0070659_100008040
629 Ga0070659_100009952
630 Ga0070659_100011323
631 Ga0070659_100053956
632 Ga0070659_100329079
633 Ga0070659_100540071
634 Ga0070667_100000024
635 Ga0070667_100004758
636 Ga0070708_100031159
637 Ga0070663_100000253
638 Ga0070663_100001203
639 Ga0070678_100025162
640 Ga0070662_100082969
641 Ga0070662_100267401
642 Ga0070662_100275303
643 Ga0068867_100000003
644 Ga0070679_100368702
645 Ga0070679_100453648
646 Ga0070684_100022141
647 Ga0070684_100276457
648 Ga0070684_100893289
649 Ga0068853_100012330
650 Ga0068853_100013336
651 Ga0068853_100095057
652 Ga0068853_100149652
653 Ga0068853_100490306
654 Ga0070672_100043418
655 Ga0070672_100135203
656 Ga0070672_100255996
657 Ga0070672_100534854
658 Ga0070665_100067218
659 Ga0068855_100000213
660 Ga0068855_100000916
661 Ga0068855_100016410
662 Ga0068855_100031315
663 Ga0068855_100044942
664 Ga0068855_100045093
665 Ga0070664_100036196
666 Ga0070664_100127643
667 Ga0070664_100185895
668 Ga0070664_100187592
669 Ga0070664_100501949
670 Ga0068857_100017104
671 Ga0068857_100031885
672 Ga0068857_100076500
673 Ga0068854_100003016
674 Ga0068854_100003821
675 Ga0068854_100017262
676 Ga0068856_100001363
677 Ga0068856_100004335
678 Ga0068856_100006889
679 Ga0068856_100007588
680 Ga0068856_100009981
681 Ga0068856_100013961
682 Ga0068856_100021434
683 Ga0068856_100024263
684 Ga0068856_100035195
685 Ga0068856_100074319
686 Ga0068856_100266091
687 Ga0068852_100000226
688 Ga0068852_100003368
689 Ga0068852_100004455
690 Ga0068852_100006535
691 Ga0068852_100017513
692 Ga0068852_100456123
693 Ga0068859_100133504
694 Ga0068864_100001264
695 Ga0068864_100166577
696 Ga0068851_10001112
697 Ga0068851_10042003
698 Ga0068863_100001711
699 Ga0068863_100002921
700 Ga0068863_100081940
701 Ga0068860_100000719
702 Ga0081539_10027576
703 Ga0070717_10210095
704 Ga0075366_10005516
705 Ga0097621_100032494
706 Ga0075370_10025069
707 Ga0068871_100039556
708 Ga0068871_100271288
709 Ga0068865_100000002
710 Ga0097620_100133503
711 Ga0105240_10001585
712 Ga0105240_10001987
713 Ga0105240_10295381
714 Ga0105240_10326806
715 Ga0105240_10607184
716 Ga0111539_10209722
717 Ga0105245_10003064
718 Ga0105243_10000031
719 Ga0105241_10083202
720 Ga0105241_10211974
721 Ga0105242_10000044
722 Ga0105242_10107995
723 Ga0105248_10002807
724 Ga0105248_10006110
725 Ga0105248_10026893
726 Ga0105237_10001260
727 Ga0105238_10000628
728 Ga0105249_10000045
729 Ga0105249_10044089
730 Ga0105249_10900160
731 Ga0105239_10002195
732 Ga0105239_10048930
733 Ga0105246_10004111
734 Ga0157373_10003064
735 Ga0157373_10011421
736 Ga0157373_10033429
737 Ga0157373_10058997
738 Ga0157373_10117418
739 Ga0157373_10174203
740 Ga0157371_10000857
741 Ga0157371_10007479
742 Ga0157371_10025127
743 Ga0157371_10067829
744 Ga0157371_10071207
745 Ga0157370_10000867
746 Ga0157370_10001375
747 Ga0157370_10001572
748 Ga0157370_10040009
749 Ga0157370_10096738
750 Ga0157370_10135132
751 Ga0157370_10197838
752 Ga0157370_10597336
753 Ga0157369_10000850
754 Ga0157369_10001070
755 Ga0157369_10001830
756 Ga0157369_10004751
757 Ga0157369_10008561
758 Ga0157369_10014361
759 Ga0157369_10034031
760 Ga0157369_10192142
761 Ga0157369_10339736
762 Ga0157374_10003136
763 Ga0157374_10018628
764 Ga0157378_10004709
765 Ga0163162_10031968
766 Ga0163162_10036799
767 Ga0163162_10084708
768 Ga0163162_10187155
769 Ga0163162_10226334
770 Ga0157372_10000448
771 Ga0157372_10002127
772 Ga0157372_10043055
773 Ga0157372_10081283
774 Ga0157372_10199047
775 Ga0157375_10017494
776 Ga0163163_10004055
777 Ga0163163_10942509
778 Ga0157379_10000457
779 Ga0157376_10000107
780 Ga0163161_10190439
781 Ga0163161_10209647
782 Ga0213875_10004951
783 Ga0209437_100042
784 Ga0209437_100062
785 Ga0209148_1000889
786 Ga0209148_1002999
787 Ga0209233_1000082
788 Ga0209233_1000103
789 Ga0209233_1011790
790 Ga0209565_1000254
791 Ga0209455_1001285
792 Ga0209025_1056185
793 Ga0209564_1002455
794 Ga0209758_1000017
795 Ga0209050_1002462
796 Ga0207656_10000160
797 Ga0207656_10026981
798 Ga0207680_10159514
799 Ga0207647_10001065
800 Ga0207647_10013087
801 Ga0207647_10062172
802 Ga0207645_10000975
803 Ga0207645_10060070
804 Ga0207705_10000766
805 Ga0207705_10002693
806 Ga0207705_10003194
807 Ga0207705_10024701
808 Ga0207705_10037864
809 Ga0207705_10055888
810 Ga0207654_10044978
811 Ga0207654_10143449
812 Ga0207695_10001511
813 Ga0207695_10011802
814 Ga0207671_10000944
815 Ga0207660_10140323
816 Ga0207657_10000140
817 Ga0207657_10009488
818 Ga0207657_10023998
819 Ga0207657_10045710
820 Ga0207649_10000130
821 Ga0207649_10005297
822 Ga0207649_10026524
823 Ga0207649_10260289
824 Ga0207652_10030898
825 Ga0207652_10778059
826 Ga0207681_10013223
827 Ga0207694_10002686
828 Ga0207694_10544450
829 Ga0207650_10005442
830 Ga0207650_10057374
831 Ga0207659_10070678
832 Ga0207687_10001332
833 Ga0207644_10000141
834 Ga0207644_10017199
835 Ga0207644_10199749
836 Ga0207690_10000063
837 Ga0207690_10009586
838 Ga0207690_10138841
839 Ga0207690_10292566
840 Ga0207690_10476338
841 Ga0207690_10512973
842 Ga0207706_10103202
843 Ga0207706_10565395
844 Ga0207686_10000417
845 Ga0207709_10000122
846 Ga0207704_10000003
847 Ga0207691_10057076
848 Ga0207711_10001407
849 Ga0207711_10027099
850 Ga0207711_10040043
851 Ga0207689_10000335
852 Ga0207661_10000290
853 Ga0207679_10001655
854 Ga0207679_10075081
855 Ga0207679_10156946
856 Ga0207679_10202824
857 Ga0207679_10382032
858 Ga0207667_10000006
859 Ga0207667_10000007
860 Ga0207667_10000499
861 Ga0207667_10011292
862 Ga0207667_10027485
863 Ga0207667_10034048
864 Ga0207667_10094580
865 Ga0207651_10000003
866 Ga0207712_10023977
867 Ga0207668_10001756
868 Ga0207668_10010090
869 Ga0207668_10278806
870 Ga0207640_10000643
871 Ga0207640_10005178
872 Ga0207640_10005564
873 Ga0207640_10051391
874 Ga0207658_10000022
875 Ga0207677_10000233
876 Ga0207703_10000531
877 Ga0207703_10024750
878 Ga0207639_10000193
879 Ga0207639_10003552
880 Ga0207639_10133414
881 Ga0207639_10205131
882 Ga0207678_10000261
883 Ga0207678_10003245
884 Ga0207678_10006760
885 Ga0207678_10518270
886 Ga0207702_10001036
887 Ga0207702_10005387
888 Ga0207702_10006813
889 Ga0207702_10012552
890 Ga0207702_10014499
891 Ga0207702_10016916
892 Ga0207702_10023769
893 Ga0207702_10030443
894 Ga0207702_10052685
895 Ga0207702_10506107
896 Ga0207641_10004289
897 Ga0207641_10006387
898 Ga0207641_10039256
899 Ga0207648_10000007
900 Ga0207648_10205139
901 Ga0207676_10059270
902 Ga0207674_10001742
903 Ga0207674_10104220
904 Ga0207674_10171456
905 Ga0207683_10016559
906 Ga0207698_10000530
907 Ga0207698_10001130
908 Ga0207698_10002234
909 Ga0207698_10005513
910 Ga0207698_10009045
911 Ga0207698_10553425
912 Ga0209371_1005091
913 Ga0268266_10222882
914 Ga0268265_10005089
915 Ga0268264_10000524
916 Ga0268264_10136124
917 Ga0268256_1004923
918 Ga0307408_100015434
919 Ga0307408_100099250
920 Ga0307408_100120549
921 Ga0307408_100243307
922 Ga0307405_10000159
923 Ga0307405_10001660
924 Ga0307405_10015379
925 Ga0307405_10206021
926 Ga0307413_10003772
927 Ga0307413_10144669
928 Ga0307413_10148227
929 Ga0307410_10003346
930 Ga0307410_10005405
931 Ga0307410_10021097
932 Ga0307410_10023660
933 Ga0307410_10308364
934 Ga0307410_10402484
935 Ga0307406_10004791
936 Ga0307406_10012578
937 Ga0307406_10021074
938 Ga0307406_10063975
939 Ga0307406_10104300
940 Ga0307406_10233222
941 Ga0307407_10007375
942 Ga0307407_10015007
943 Ga0307407_10101166
944 Ga0307407_10346591
945 Ga0307407_10553034
946 Ga0307412_10001872
947 Ga0307412_10006623
948 Ga0307412_10007975
949 Ga0307412_10029465
950 Ga0307412_10034224
951 Ga0307412_10066353
952 Ga0307412_10126196
953 Ga0307412_10941811
954 Ga0307409_100018630
955 Ga0307409_100036109
956 Ga0307409_100151502
957 Ga0307409_100593943
958 Ga0307416_100011282
959 Ga0307416_100013702
960 Ga0307416_100021888
961 Ga0307416_100046977
962 Ga0307416_100082813
963 Ga0307416_100257844
964 Ga0307416_100873503
965 Ga0307414_10025647
966 Ga0307414_10084045
967 Ga0307411_10011013
968 Ga0307411_10035995
969 Ga0307411_10053997
970 Ga0307411_10056090
971 Ga0307411_10066619
972 Ga0307411_10080632
973 Ga0307411_10584308
974 Ga0307411_10864087
975 Ga0307415_100005623
976 Ga0307415_100016410
977 Ga0307415_100019197
978 Ga0307415_100020466
979 Ga0307415_100400493
980 Ga0307415_100426780
981 Ga0373954_0000021
982 Ga0373924_0196951
983 Ga0373935_0424133
984 Ga0373933_0012672
985 Ga0373937_0000982
986 Ga0395899_0000850
987 Ga0395899_0000943
988 Ga0395899_0013653
989 Ga0395899_0036605
990 Ga0395899_0101433
991 Ga0395899_0127154
992 Ga0395899_0313699
993 Ga0395900_0000971
994 Ga0395900_0001252
995 Ga0395900_0002045
996 Ga0395900_0004357
997 Ga0395900_0005701
998 Ga0395900_0007138
999 Ga0395900_0013055
1000 Ga0395900_0016657
1001 Ga0395900_0023867
1002 Ga0395900_0074830
1003 Ga0395900_0141937
1004 Ga0395900_0693733
1005 Ga0395900_0814748
1006 Ga0395898_0001771
1007 Ga0395898_0002756
1008 Ga0395898_0018061
1009 Ga0395898_0029799
1010 Ga0395898_0034080
1011 Ga0395898_0087471
1012 Ga0395898_0908972
1013 Ga0395905_0000915
1014 Ga0395905_0000920
1015 Ga0395905_0001250
1016 Ga0395905_0004810
1017 Ga0395905_0010244
1018 Ga0395905_0012450
1019 Ga0395905_0023018
1020 Ga0395905_0028486
1021 Ga0395905_0030212
1022 Ga0395905_0032395
1023 Ga0395905_0051284
1024 Ga0395905_0172556
1025 Ga0395905_0191306
1026 Ga0395905_0276404
1027 Ga0436364_0885024
1028 Ga0395901_0000810
1029 Ga0395901_0001847
1030 Ga0395901_0001911
1031 Ga0395901_0002995
1032 Ga0395901_0005384
1033 Ga0395901_0021665
1034 Ga0395901_0021784
1035 Ga0395901_0116632
1036 Ga0395901_0168524
1037 Ga0395901_0205825
1038 Ga0395901_0236940
1039 Ga0395901_0277760
1040 Ga0395901_0658839
1041 Ga0436361_0798855
1042 Ga0466966_0013578
1043 Ga0466966_0153390
1044 Ga0466961_0008433
1045 Ga0466963_0058690
1046 Ga0466963_0078534
1047 Ga0453684_0126490
1048 Ga0453684_0203978
1049 Ga0466970_0103212
1050 Ga0466970_0325833
1051 Ga0466957_0140424
1052 Ga0466957_0265506
1053 Ga0466960_0254455
1054 Ga0466960_0387707
1055 Ga0495585_0001441
1056 Ga0495596_0000037
1057 Ga0495583_0000120
1058 Ga0495583_0000122
1059 Ga0495583_0086231
1060 Ga0495606_0041049
1061 Ga0495610_0007663
1062 Ga0495637_0051131
1063 Ga0495643_0000126
1064 Ga0495609_0026462
1065 Ga0495668_0000013
1066 Ga0495625_0025886
1067 Ga0495681_0084321
1068 Ga0495686_0000072
1069 Ga0495686_0021978
1070 Ga0495602_0040472
1071 Ga0496101_0680776
1072 Ga0496102_0113955
1073 Ga0496107_0511023
1074 Ga0496108_0002824
1075 Ga0496110_0435326
1076 Ga0496111_0071011
1077 Ga0496112_0002939
1078 Ga0496112_0147535
1079 Ga0496113_0048526
1080 Ga0496113_0167759
1081 Ga0496117_0103524
1082 Ga0496119_0012929
1083 Ga0496120_0026303
1084 Ga0496121_0003242
1085 Ga0496121_0004012
1086 Ga0496122_0014110
1087 Ga0496123_0103073
1088 Ga0496126_0005195
1089 Ga0501034_0142143
1090 Ga0501042_0335682
1091 Ga0501047_0317337
1092 nmdc:mga0k408_11907_c1
1093 Ga0500592_000272
1094 Ga0500595_001170
1095 Ga0500618_000378
1096 Ga0500616_0028973
1097 Ga0500645_000003
1098 Ga0530510_0377356
1099 2511135616
1100 2511388573
1101 2585272691
1102 2585327324
1103 2585335290
1104 2585562359
1105 2585896800
1106 2585906474
1107 2587981896
1108 2616551904
1109 2671114412
1110 2753767789
1111 2792463237
1112 2819607538
1113 2838032036
1114 2842478768
1115 2842505913
1116 2842876022
1117 2843748175
1118 2848299276
1119 2883579146
1120 2919413134
1121 2928525768
1122 2954012144
1123 3002146424
1124 8005490015
1125 8005650896
1126 8005688450

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

151

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m96-assembly1.cif.gz_A-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8903 2 194
7dd0-assembly2.cif.gz_B crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8846 2 203
7p48-assembly1.cif.gz_6 staphylococcus aureus ribosome in complex with sal(b) 0.8779 1 196
7dd0-assembly2.cif.gz_D crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8767 2 203
8dne-assembly1.cif.gz_C cryoem structure of the a.aeolicus wzmwzt transporter bound to atp 0.8712 1 205
ID Description Score Start End Superfamily
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9143 1 194 3.40.50.300
af_A0A0P0VBQ7_902_1031_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8881 2 63 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.885 2 63 3.40.50.300
af_A0A1D6JBW9_1150_1300_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8811 2 65 3.40.50.300
af_A0A0R0IY12_408_566_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8787 2 63 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X4K8Y7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9549 1 205 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7G4RK67-F1-model_v4 ABC transporter domain-containing protein 0.9515 1 204 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7X4K8Y7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9459 1 205 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-Q93UJ9-F1-model_v4 Wzt2 0.943 5 204 GO:0005524
GO:0005886
GO:0016887
GO:0140359
AF-A0A382UWD2-F1-model_v4 ABC transporter domain-containing protein 0.9423 71 188 GO:0005524

Map