F464029

General Info

Members Datasets Scaffolds Average Seq Length
563 192 1126 138

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100223327|Ga0068858_1002233273
Length 157
Sequence MYAAQAAQAVSCDRLNPDGSDMSEEEKIGAVIEEMYSMISGPAGPRDWSRQDNCFLPEALQVRTWVDEQGRPQKLSMTLDEYRENTTPFFAANPFYEIETSRRVDVFGNIAHVWSGYEARRSADDETPERRGINSIQLFNHPEHGWRIISMIWDNER

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
190 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 0.89
Rhizosphere 98.22
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100223327 3300005842 Bacteria 1785
2 JGI24740J21852_10002219 3300001979 Bacteria 8877
3 JGI24740J21852_10069092 3300001979 Bacteria 951
4 JGI24739J22299_10000035 3300001989 Bacteria 37844
5 JGI24737J22298_10000020 3300001990 Bacteria 46324
6 JGI24737J22298_10032808 3300001990 Bacteria 1616
7 JGI24735J21928_10076961 3300002067 Bacteria 956
8 JGI24738J21930_10000048 3300002075 Bacteria 24246
9 JGI24738J21930_10014852 3300002075 Bacteria 1666
10 JGI24749J21850_1045592 3300002076 Unclassified 647
11 JGI24749J21850_1052663 3300002076 Bacteria 609
12 JGI24742J22300_10008574 3300002244 Bacteria 1687
13 Ga0065712_10073329 3300005290 Bacteria 4429
14 Ga0065712_10321658 3300005290 Unclassified 827
15 Ga0065715_10122647 3300005293 Bacteria 2199
16 Ga0065715_10160295 3300005293 Unclassified 1636
17 Ga0070658_10049940 3300005327 Bacteria 3390
18 Ga0070658_10084656 3300005327 Bacteria 2607
19 Ga0070658_10841263 3300005327 Bacteria 797
20 Ga0070676_10008339 3300005328 Bacteria 5583
21 Ga0070676_10097367 3300005328 Bacteria 1812
22 Ga0070676_10394796 3300005328 Bacteria 961
23 Ga0070683_100565154 3300005329 Bacteria 1088
24 Ga0070690_100002148 3300005330 Bacteria 10523
25 Ga0070670_100007872 3300005331 Bacteria 9066
26 Ga0070670_100009146 3300005331 Bacteria 8467
27 Ga0070670_100040522 3300005331 Bacteria 4004
28 Ga0070670_100045987 3300005331 Bacteria 3753
29 Ga0070670_100066709 3300005331 Bacteria 3088
30 Ga0070670_100146371 3300005331 Bacteria 2044
31 Ga0070677_10027456 3300005333 Bacteria 2143
32 Ga0070677_10057858 3300005333 Bacteria 1590
33 Ga0070677_10141302 3300005333 Bacteria 1111
34 Ga0068869_100000043 3300005334 Bacteria 52392
35 Ga0070666_10006595 3300005335 Bacteria 7136
36 Ga0070666_10061690 3300005335 Bacteria 2539
37 Ga0070666_10246877 3300005335 Bacteria 1263
38 Ga0070680_100597895 3300005336 Bacteria 947
39 Ga0070680_101482302 3300005336 Bacteria 588
40 Ga0070682_100063843 3300005337 Bacteria 2336
41 Ga0068868_100000957 3300005338 Bacteria 19654
42 Ga0070660_100000415 3300005339 Bacteria 28402
43 Ga0070660_100018258 3300005339 Bacteria 5123
44 Ga0070660_100027021 3300005339 Bacteria 4280
45 Ga0070660_100098708 3300005339 Bacteria 2312
46 Ga0070660_100223214 3300005339 Bacteria 1532
47 Ga0070660_100227508 3300005339 Bacteria 1517
48 Ga0070660_100327822 3300005339 Bacteria 1259
49 Ga0070660_101057365 3300005339 Bacteria 686
50 Ga0070689_100024220 3300005340 Bacteria 4551
51 Ga0070687_100355659 3300005343 Bacteria 947
52 Ga0070661_100049721 3300005344 Bacteria 3069
53 Ga0070661_100053920 3300005344 Bacteria 2944
54 Ga0070661_100125603 3300005344 Bacteria 1924
55 Ga0070692_10000681 3300005345 Bacteria 10878
56 Ga0070692_10022157 3300005345 Bacteria 3101
57 Ga0070692_10066114 3300005345 Bacteria 1916
58 Ga0070668_100005171 3300005347 Bacteria 9675
59 Ga0070668_100108154 3300005347 Unclassified 2211
60 Ga0070668_100161401 3300005347 Bacteria 1819
61 Ga0070668_100383100 3300005347 Bacteria 1197
62 Ga0070668_100613676 3300005347 Bacteria 953
63 Ga0070669_100000209 3300005353 Bacteria 48982
64 Ga0070669_100017103 3300005353 Bacteria 5174
65 Ga0070669_100034364 3300005353 Bacteria 3670
66 Ga0070669_100173960 3300005353 Bacteria 1680
67 Ga0070669_100339378 3300005353 Bacteria 1217
68 Ga0070675_100004947 3300005354 Bacteria 10166
69 Ga0070675_100053098 3300005354 Bacteria 3333
70 Ga0070675_101027331 3300005354 Bacteria 757
71 Ga0070675_101475903 3300005354 Unclassified 627
72 Ga0070671_100000946 3300005355 Bacteria 21265
73 Ga0070671_100002968 3300005355 Bacteria 13201
74 Ga0070671_100011924 3300005355 Bacteria 6991
75 Ga0070671_100259227 3300005355 Bacteria 1477
76 Ga0070671_100572062 3300005355 Bacteria 975
77 Ga0070671_101028895 3300005355 Bacteria 722
78 Ga0070674_100095457 3300005356 Bacteria 2156
79 Ga0070674_100248082 3300005356 Bacteria 1397
80 Ga0070674_100567009 3300005356 Bacteria 955
81 Ga0070673_100000354 3300005364 Bacteria 24130
82 Ga0070673_100001479 3300005364 Bacteria 13757
83 Ga0070673_100861499 3300005364 Bacteria 839
84 Ga0070659_100000184 3300005366 Bacteria 47693
85 Ga0070659_100000463 3300005366 Bacteria 29968
86 Ga0070659_100001102 3300005366 Bacteria 19726
87 Ga0070659_100101129 3300005366 Bacteria 2320
88 Ga0070659_100109929 3300005366 Bacteria 2225
89 Ga0070659_100146131 3300005366 Bacteria 1926
90 Ga0070659_100210950 3300005366 Bacteria 1600
91 Ga0070659_100619753 3300005366 Bacteria 931
92 Ga0070659_101090348 3300005366 Bacteria 703
93 Ga0070659_101572877 3300005366 Bacteria 587
94 Ga0070667_100020452 3300005367 Bacteria 5494
95 Ga0070667_100106555 3300005367 Bacteria 2426
96 Ga0070667_100208498 3300005367 Bacteria 1736
97 Ga0070667_100223839 3300005367 Bacteria 1675
98 Ga0070667_100735283 3300005367 Bacteria 914
99 Ga0070701_10918783 3300005438 Bacteria 605
100 Ga0070694_100053280 3300005444 Bacteria 2737
101 Ga0070663_100005191 3300005455 Bacteria 7713
102 Ga0070663_100268125 3300005455 Bacteria 1356
103 Ga0070663_100447315 3300005455 Bacteria 1064
104 Ga0070663_100543226 3300005455 Bacteria 970
105 Ga0070678_100065030 3300005456 Bacteria 2706
106 Ga0070678_100114619 3300005456 Bacteria 2114
107 Ga0070678_100119808 3300005456 Bacteria 2073
108 Ga0070662_100000754 3300005457 Bacteria 19853
109 Ga0070662_100002965 3300005457 Bacteria 10548
110 Ga0070662_100036442 3300005457 Bacteria 3480
111 Ga0070662_100090378 3300005457 Bacteria 2298
112 Ga0070662_101474820 3300005457 Bacteria 586
113 Ga0070681_10272930 3300005458 Bacteria 1602
114 Ga0068867_100029006 3300005459 Bacteria 3986
115 Ga0068867_100069438 3300005459 Bacteria 2631
116 Ga0068867_100269895 3300005459 Bacteria 1390
117 Ga0068867_101309577 3300005459 Bacteria 669
118 Ga0070679_100100066 3300005530 Bacteria 2886
119 Ga0070679_100295725 3300005530 Bacteria 1570
120 Ga0070679_101078934 3300005530 Bacteria 747
121 Ga0070679_101459384 3300005530 Bacteria 631
122 Ga0068853_100001421 3300005539 Bacteria 17280
123 Ga0068853_100124216 3300005539 Bacteria 2305
124 Ga0068853_100397271 3300005539 Bacteria 1290
125 Ga0068853_100623112 3300005539 Bacteria 1025
126 Ga0068853_101151290 3300005539 Bacteria 748
127 Ga0070672_100000380 3300005543 Bacteria 25710
128 Ga0070672_100027862 3300005543 Bacteria 4218
129 Ga0070672_100191997 3300005543 Bacteria 1705
130 Ga0070672_100230804 3300005543 Bacteria 1555
131 Ga0070672_100578829 3300005543 Bacteria 976
132 Ga0070686_100949947 3300005544 Unclassified 702
133 Ga0070695_100083417 3300005545 Bacteria 2117
134 Ga0070696_100499163 3300005546 Bacteria 968
135 Ga0070693_100051268 3300005547 Bacteria 2363
136 Ga0070693_100308131 3300005547 Bacteria 1070
137 Ga0070665_100018452 3300005548 Bacteria 6992
138 Ga0070665_100037535 3300005548 Bacteria 4872
139 Ga0070665_100541106 3300005548 Bacteria 1177
140 Ga0070704_100364252 3300005549 Bacteria 1224
141 Ga0068855_100000780 3300005563 Bacteria 39315
142 Ga0068855_100035037 3300005563 Bacteria 5980
143 Ga0068855_100059044 3300005563 Bacteria 4489
144 Ga0070664_100003721 3300005564 Bacteria 12292
145 Ga0070664_100008854 3300005564 Bacteria 8156
146 Ga0070664_100012056 3300005564 Bacteria 7023
147 Ga0070664_100136657 3300005564 Bacteria 2156
148 Ga0070664_100285081 3300005564 Bacteria 1490
149 Ga0070664_100435210 3300005564 Bacteria 1202
150 Ga0070664_100599443 3300005564 Bacteria 1021
151 Ga0068857_100003128 3300005577 Bacteria 13693
152 Ga0068857_100011668 3300005577 Bacteria 7642
153 Ga0068857_100055655 3300005577 Bacteria 3510
154 Ga0068857_100121144 3300005577 Bacteria 2355
155 Ga0068857_100314791 3300005577 Bacteria 1444
156 Ga0068857_100795979 3300005577 Bacteria 902
157 Ga0068854_100000414 3300005578 Bacteria 26795
158 Ga0068854_100042391 3300005578 Bacteria 3221
159 Ga0068854_100051055 3300005578 Bacteria 2962
160 Ga0068854_100146039 3300005578 Bacteria 1820
161 Ga0068856_100584981 3300005614 Bacteria 1138
162 Ga0068852_100000798 3300005616 Bacteria 20761
163 Ga0068852_100070179 3300005616 Bacteria 3073
164 Ga0068852_100290648 3300005616 Bacteria 1579
165 Ga0068852_100772269 3300005616 Bacteria 974
166 Ga0068859_100008232 3300005617 Bacteria 10577
167 Ga0068859_100150902 3300005617 Bacteria 2399
168 Ga0068864_100000181 3300005618 Bacteria 58221
169 Ga0068864_100008287 3300005618 Bacteria 8572
170 Ga0068864_100029454 3300005618 Bacteria 4651
171 Ga0068864_100184117 3300005618 Bacteria 1911
172 Ga0068866_10258143 3300005718 Bacteria 1070
173 Ga0068861_100077323 3300005719 Bacteria 2595
174 Ga0068861_100992281 3300005719 Bacteria 801
175 Ga0068861_101006976 3300005719 Bacteria 796
176 Ga0068851_10008266 3300005834 Bacteria 4806
177 Ga0068851_10029820 3300005834 Bacteria 2703
178 Ga0068851_10341861 3300005834 Bacteria 869
179 Ga0068863_100004126 3300005841 Bacteria 14361
180 Ga0068863_100338811 3300005841 Bacteria 1463
181 Ga0068863_100357289 3300005841 Bacteria 1424
182 Ga0068863_100531670 3300005841 Bacteria 1160
183 Ga0068863_100561626 3300005841 Bacteria 1127
184 Ga0068858_100005075 3300005842 Bacteria 12907
185 Ga0068858_100200751 3300005842 Bacteria 1886
186 Ga0068860_100002079 3300005843 Bacteria 21111
187 Ga0068860_100071163 3300005843 Bacteria 3306
188 Ga0068860_100071286 3300005843 Bacteria 3302
189 Ga0068860_100105234 3300005843 Bacteria 2695
190 Ga0068860_100293400 3300005843 Bacteria 1592
191 Ga0068862_100036302 3300005844 Bacteria 4178
192 Ga0068862_100052181 3300005844 Bacteria 3498
193 Ga0068862_100215697 3300005844 Bacteria 1736
194 Ga0068862_100265035 3300005844 Bacteria 1570
195 Ga0068862_100462743 3300005844 Bacteria 1197
196 Ga0070717_10288697 3300006028 Bacteria 1456
197 Ga0075365_10526119 3300006038 Unclassified 836
198 Ga0097621_100484186 3300006237 Bacteria 1119
199 Ga0068871_100200840 3300006358 Bacteria 1721
200 Ga0068871_100223848 3300006358 Bacteria 1631
201 Ga0068871_101147328 3300006358 Bacteria 728
202 Ga0068865_100002737 3300006881 Bacteria 10470
203 Ga0068865_100141311 3300006881 Bacteria 1816
204 Ga0068865_100158997 3300006881 Bacteria 1721
205 Ga0068865_100931055 3300006881 Unclassified 757
206 Ga0097620_100008232 3300006931 Bacteria 10577
207 Ga0097620_100029350 3300006931 Bacteria 5519
208 Ga0097620_100150888 3300006931 Bacteria 2399
209 Ga0097620_101168901 3300006931 Bacteria 847
210 Ga0105245_10003294 3300009098 Bacteria 14501
211 Ga0105245_10473152 3300009098 Bacteria 1265
212 Ga0105247_10156286 3300009101 Bacteria 1507
213 Ga0105243_10027026 3300009148 Bacteria 4395
214 Ga0105243_10057528 3300009148 Bacteria 3096
215 Ga0105243_10432370 3300009148 Bacteria 1231
216 Ga0105241_10013892 3300009174 Bacteria 5899
217 Ga0105241_10079271 3300009174 Bacteria 2567
218 Ga0105241_10734971 3300009174 Bacteria 904
219 Ga0105242_10075412 3300009176 Bacteria 2808
220 Ga0105248_10000256 3300009177 Bacteria 62138
221 Ga0105248_10016393 3300009177 Bacteria 8154
222 Ga0105248_10100250 3300009177 Bacteria 3264
223 Ga0105248_10126326 3300009177 Bacteria 2885
224 Ga0105237_10297555 3300009545 Bacteria 1617
225 Ga0105237_12339839 3300009545 Bacteria 544
226 Ga0105238_10316977 3300009551 Bacteria 1545
227 Ga0105249_10278714 3300009553 Bacteria 1669
228 Ga0105249_10435783 3300009553 Bacteria 1347
229 Ga0105239_10049371 3300010375 Bacteria 4614
230 Ga0105239_10095834 3300010375 Bacteria 3278
231 Ga0105246_10002855 3300011119 Bacteria 10456
232 Ga0157373_10026824 3300013100 Bacteria 4158
233 Ga0157371_10002108 3300013102 Bacteria 19391
234 Ga0157371_10031413 3300013102 Bacteria 3826
235 Ga0157371_10138073 3300013102 Bacteria 1736
236 Ga0157374_10521991 3300013296 Bacteria 1193
237 Ga0157378_10009565 3300013297 Bacteria 8441
238 Ga0157378_10103811 3300013297 Bacteria 2598
239 Ga0163162_10483497 3300013306 Bacteria 1370
240 Ga0163162_10789428 3300013306 Bacteria 1067
241 Ga0157372_10107953 3300013307 Bacteria 3185
242 Ga0157372_10328574 3300013307 Bacteria 1780
243 Ga0157372_10532911 3300013307 Bacteria 1369
244 Ga0157375_10611899 3300013308 Bacteria 1248
245 Ga0163163_10720565 3300014325 Bacteria 1061
246 Ga0157380_10083803 3300014326 Bacteria 2612
247 Ga0157380_10800470 3300014326 Bacteria 959
248 Ga0157379_10072080 3300014968 Bacteria 3090
249 Ga0157379_10367750 3300014968 Bacteria 1318
250 Ga0163161_10035407 3300017792 Bacteria 3573
251 Ga0163161_10691755 3300017792 Bacteria 848
252 Ga0163161_10977378 3300017792 Bacteria 721
253 Ga0213876_10357148 3300021384 Bacteria 777
254 Ga0207697_10000007 3300025315 Bacteria 81785
255 Ga0207656_10002541 3300025321 Bacteria 6169
256 Ga0207656_10223069 3300025321 Bacteria 917
257 Ga0207682_10009791 3300025893 Bacteria 3773
258 Ga0207682_10021935 3300025893 Bacteria 2513
259 Ga0207682_10062749 3300025893 Bacteria 1559
260 Ga0207682_10072996 3300025893 Bacteria 1457
261 Ga0207642_10557330 3300025899 Bacteria 708
262 Ga0207688_10000318 3300025901 Bacteria 22194
263 Ga0207688_10046161 3300025901 Bacteria 2432
264 Ga0207688_10424043 3300025901 Bacteria 827
265 Ga0207680_10198084 3300025903 Bacteria 1367
266 Ga0207680_10260773 3300025903 Bacteria 1200
267 Ga0207680_10313805 3300025903 Bacteria 1095
268 Ga0207647_10000052 3300025904 Bacteria 87651
269 Ga0207647_10001246 3300025904 Bacteria 19572
270 Ga0207645_10011287 3300025907 Bacteria 6106
271 Ga0207645_10016045 3300025907 Bacteria 4962
272 Ga0207645_10067976 3300025907 Bacteria 2278
273 Ga0207645_10134948 3300025907 Bacteria 1607
274 Ga0207705_10005213 3300025909 Bacteria 9747
275 Ga0207705_10013658 3300025909 Bacteria 5858
276 Ga0207705_10050288 3300025909 Bacteria 3000
277 Ga0207705_10222131 3300025909 Bacteria 1435
278 Ga0207705_10411581 3300025909 Bacteria 1046
279 Ga0207705_10539856 3300025909 Bacteria 906
280 Ga0207654_10052743 3300025911 Bacteria 2345
281 Ga0207707_10041718 3300025912 Bacteria 4007
282 Ga0207660_10003720 3300025917 Bacteria 9940
283 Ga0207662_10148402 3300025918 Bacteria 1490
284 Ga0207657_10007007 3300025919 Bacteria 11600
285 Ga0207657_10025279 3300025919 Bacteria 5479
286 Ga0207657_10028702 3300025919 Bacteria 5071
287 Ga0207657_10143674 3300025919 Bacteria 1948
288 Ga0207657_10182324 3300025919 Bacteria 1697
289 Ga0207657_10212089 3300025919 Bacteria 1554
290 Ga0207657_10306114 3300025919 Bacteria 1258
291 Ga0207649_10051842 3300025920 Bacteria 2543
292 Ga0207649_10093348 3300025920 Bacteria 1975
293 Ga0207649_10110359 3300025920 Bacteria 1836
294 Ga0207649_10603160 3300025920 Bacteria 845
295 Ga0207652_10004132 3300025921 Bacteria 11846
296 Ga0207681_10001637 3300025923 Bacteria 14424
297 Ga0207681_10022463 3300025923 Bacteria 4024
298 Ga0207681_10048071 3300025923 Bacteria 2878
299 Ga0207681_10143782 3300025923 Bacteria 1779
300 Ga0207681_10295385 3300025923 Bacteria 1280
301 Ga0207650_10010177 3300025925 Bacteria 6445
302 Ga0207650_10013470 3300025925 Bacteria 5663
303 Ga0207650_10021149 3300025925 Bacteria 4598
304 Ga0207650_10026898 3300025925 Bacteria 4110
305 Ga0207650_10113541 3300025925 Bacteria 2100
306 Ga0207650_10151922 3300025925 Bacteria 1828
307 Ga0207659_10004495 3300025926 Bacteria 8438
308 Ga0207687_10001182 3300025927 Bacteria 17845
309 Ga0207644_10000960 3300025931 Bacteria 18405
310 Ga0207644_10004259 3300025931 Bacteria 9283
311 Ga0207644_10008095 3300025931 Bacteria 6883
312 Ga0207644_10384514 3300025931 Bacteria 1145
313 Ga0207644_10573893 3300025931 Bacteria 935
314 Ga0207644_10917207 3300025931 Bacteria 734
315 Ga0207644_11213604 3300025931 Unclassified 634
316 Ga0207690_10000112 3300025932 Bacteria 66622
317 Ga0207690_10000463 3300025932 Bacteria 26092
318 Ga0207690_10067085 3300025932 Bacteria 2460
319 Ga0207690_10117089 3300025932 Bacteria 1928
320 Ga0207690_10120823 3300025932 Bacteria 1903
321 Ga0207690_10282886 3300025932 Bacteria 1292
322 Ga0207690_10296353 3300025932 Bacteria 1264
323 Ga0207690_10361536 3300025932 Bacteria 1150
324 Ga0207690_10437270 3300025932 Bacteria 1049
325 Ga0207706_10000705 3300025933 Bacteria 34845
326 Ga0207706_10002562 3300025933 Bacteria 17727
327 Ga0207706_10016933 3300025933 Bacteria 6575
328 Ga0207706_10023901 3300025933 Bacteria 5483
329 Ga0207706_10063584 3300025933 Bacteria 3249
330 Ga0207706_10076453 3300025933 Bacteria 2945
331 Ga0207706_10201246 3300025933 Bacteria 1747
332 Ga0207709_10034750 3300025935 Bacteria 2974
333 Ga0207670_10026192 3300025936 Bacteria 3673
334 Ga0207670_10407838 3300025936 Bacteria 1088
335 Ga0207669_10166106 3300025937 Bacteria 1565
336 Ga0207669_10292759 3300025937 Bacteria 1233
337 Ga0207704_10007674 3300025938 Bacteria 5111
338 Ga0207704_10030575 3300025938 Bacteria 3020
339 Ga0207704_10132954 3300025938 Bacteria 1727
340 Ga0207691_10001179 3300025940 Bacteria 25979
341 Ga0207691_10003343 3300025940 Bacteria 15608
342 Ga0207691_10110951 3300025940 Bacteria 2439
343 Ga0207691_10246901 3300025940 Bacteria 1542
344 Ga0207711_10007771 3300025941 Bacteria 8959
345 Ga0207711_10013929 3300025941 Bacteria 6678
346 Ga0207711_10021847 3300025941 Bacteria 5345
347 Ga0207711_10022743 3300025941 Bacteria 5244
348 Ga0207711_10267400 3300025941 Bacteria 1573
349 Ga0207689_10000014 3300025942 Bacteria 122534
350 Ga0207661_10111881 3300025944 Bacteria 2311
351 Ga0207679_10007531 3300025945 Bacteria 6909
352 Ga0207679_10010964 3300025945 Bacteria 5848
353 Ga0207679_10013031 3300025945 Bacteria 5441
354 Ga0207679_10075155 3300025945 Bacteria 2562
355 Ga0207679_10307623 3300025945 Bacteria 1368
356 Ga0207667_10003943 3300025949 Bacteria 18261
357 Ga0207667_10013929 3300025949 Bacteria 9188
358 Ga0207667_10059579 3300025949 Bacteria 3998
359 Ga0207667_11187208 3300025949 Bacteria 743
360 Ga0207651_10002150 3300025960 Bacteria 9314
361 Ga0207651_10069092 3300025960 Bacteria 2493
362 Ga0207651_10297899 3300025960 Bacteria 1340
363 Ga0207651_12102960 3300025960 Unclassified 507
364 Ga0207712_10001817 3300025961 Bacteria 14093
365 Ga0207668_10010841 3300025972 Bacteria 5521
366 Ga0207668_10037322 3300025972 Bacteria 3251
367 Ga0207668_10163837 3300025972 Bacteria 1736
368 Ga0207668_10204710 3300025972 Bacteria 1574
369 Ga0207668_10239823 3300025972 Bacteria 1466
370 Ga0207668_10794818 3300025972 Bacteria 837
371 Ga0207640_10000404 3300025981 Bacteria 27391
372 Ga0207640_10185095 3300025981 Bacteria 1565
373 Ga0207640_10201226 3300025981 Bacteria 1509
374 Ga0207640_10453004 3300025981 Bacteria 1058
375 Ga0207658_10024917 3300025986 Bacteria 4186
376 Ga0207658_10057701 3300025986 Bacteria 2886
377 Ga0207658_10123906 3300025986 Unclassified 2065
378 Ga0207658_10174549 3300025986 Bacteria 1774
379 Ga0207658_10299245 3300025986 Bacteria 1385
380 Ga0207658_10600451 3300025986 Bacteria 989
381 Ga0207658_10739457 3300025986 Unclassified 890
382 Ga0207658_10811102 3300025986 Bacteria 850
383 Ga0207677_10000905 3300026023 Bacteria 16619
384 Ga0207677_10326781 3300026023 Bacteria 1277
385 Ga0207677_10712898 3300026023 Bacteria 891
386 Ga0207703_10000933 3300026035 Bacteria 28397
387 Ga0207703_10233752 3300026035 Bacteria 1649
388 Ga0207703_10275200 3300026035 Bacteria 1527
389 Ga0207639_10001273 3300026041 Bacteria 17019
390 Ga0207639_10092416 3300026041 Bacteria 2425
391 Ga0207639_10336637 3300026041 Bacteria 1344
392 Ga0207639_10349390 3300026041 Bacteria 1320
393 Ga0207639_10606927 3300026041 Bacteria 1009
394 Ga0207678_10006202 3300026067 Bacteria 10620
395 Ga0207678_10013162 3300026067 Bacteria 7258
396 Ga0207678_10018886 3300026067 Bacteria 6056
397 Ga0207678_10309368 3300026067 Bacteria 1358
398 Ga0207702_10210849 3300026078 Bacteria 1806
399 Ga0207641_10001015 3300026088 Bacteria 28538
400 Ga0207641_10199185 3300026088 Bacteria 1845
401 Ga0207641_10866350 3300026088 Bacteria 896
402 Ga0207648_10002058 3300026089 Bacteria 21922
403 Ga0207648_10074905 3300026089 Bacteria 2951
404 Ga0207648_10095419 3300026089 Bacteria 2602
405 Ga0207676_10000666 3300026095 Bacteria 27542
406 Ga0207676_10019771 3300026095 Bacteria 4918
407 Ga0207676_10046019 3300026095 Bacteria 3374
408 Ga0207676_10770200 3300026095 Bacteria 937
409 Ga0207674_10000244 3300026116 Bacteria 67590
410 Ga0207674_10000308 3300026116 Bacteria 62120
411 Ga0207674_10754184 3300026116 Bacteria 939
412 Ga0207674_11006176 3300026116 Bacteria 803
413 Ga0207675_100080348 3300026118 Bacteria 3056
414 Ga0207675_100269835 3300026118 Bacteria 1651
415 Ga0207675_101260848 3300026118 Bacteria 759
416 Ga0207683_10022964 3300026121 Bacteria 5362
417 Ga0207683_10083906 3300026121 Bacteria 2832
418 Ga0207683_10174132 3300026121 Bacteria 1950
419 Ga0207698_10000394 3300026142 Bacteria 25237
420 Ga0207698_10053558 3300026142 Bacteria 3098
421 Ga0207698_10169794 3300026142 Bacteria 1919
422 Ga0268266_10018395 3300028379 Bacteria 5954
423 Ga0268266_10032411 3300028379 Bacteria 4440
424 Ga0268265_10017318 3300028380 Bacteria 4969
425 Ga0268265_10043656 3300028380 Bacteria 3334
426 Ga0268265_10128544 3300028380 Bacteria 2101
427 Ga0268265_10180798 3300028380 Bacteria 1812
428 Ga0268265_10213135 3300028380 Bacteria 1684
429 Ga0268265_10340667 3300028380 Bacteria 1365
430 Ga0268264_10007446 3300028381 Bacteria 9134
431 Ga0268264_10016183 3300028381 Bacteria 6108
432 Ga0268264_10032942 3300028381 Bacteria 4253
433 Ga0268264_10174506 3300028381 Bacteria 1947
434 Ga0268264_10206901 3300028381 Bacteria 1799
435 Ga0265327_10003197 3300031251 Bacteria 15967
436 Ga0307513_10396652 3300031456 Bacteria 1115
437 Ga0307408_100022859 3300031548 Bacteria 4254
438 Ga0307408_100326558 3300031548 Bacteria 1294
439 Ga0307408_100444399 3300031548 Bacteria 1123
440 Ga0307408_101190250 3300031548 Bacteria 710
441 Ga0307408_101300451 3300031548 Bacteria 681
442 Ga0307405_10048084 3300031731 Bacteria 2629
443 Ga0307405_10147343 3300031731 Bacteria 1651
444 Ga0307405_10164633 3300031731 Bacteria 1575
445 Ga0307405_10201937 3300031731 Bacteria 1444
446 Ga0307413_10016807 3300031824 Bacteria 3793
447 Ga0307413_10160903 3300031824 Bacteria 1577
448 Ga0307413_10242589 3300031824 Bacteria 1331
449 Ga0307413_10784678 3300031824 Bacteria 799
450 Ga0307413_10806556 3300031824 Bacteria 789
451 Ga0307413_11563297 3300031824 Bacteria 585
452 Ga0307410_10000411 3300031852 Bacteria 16975
453 Ga0307410_10007304 3300031852 Bacteria 6037
454 Ga0307410_10053664 3300031852 Bacteria 2729
455 Ga0307410_10060046 3300031852 Bacteria 2597
456 Ga0307410_10148183 3300031852 Bacteria 1744
457 Ga0307410_10171746 3300031852 Bacteria 1634
458 Ga0307410_11632810 3300031852 Bacteria 570
459 Ga0307410_11901688 3300031852 Unclassified 530
460 Ga0307406_10048403 3300031901 Bacteria 2685
461 Ga0307406_10069459 3300031901 Bacteria 2303
462 Ga0307406_11039076 3300031901 Bacteria 705
463 Ga0307407_10136059 3300031903 Bacteria 1579
464 Ga0307407_10140064 3300031903 Bacteria 1559
465 Ga0307407_10195226 3300031903 Bacteria 1352
466 Ga0307407_10374198 3300031903 Bacteria 1015
467 Ga0307412_10004709 3300031911 Bacteria 7613
468 Ga0307412_10031879 3300031911 Bacteria 3333
469 Ga0307412_10044839 3300031911 Bacteria 2887
470 Ga0307412_10194321 3300031911 Bacteria 1536
471 Ga0307412_10219557 3300031911 Bacteria 1456
472 Ga0307412_10445837 3300031911 Bacteria 1065
473 Ga0307412_10494982 3300031911 Bacteria 1017
474 Ga0307409_100000126 3300031995 Bacteria 28589
475 Ga0307409_100068897 3300031995 Bacteria 2800
476 Ga0307409_100071577 3300031995 Bacteria 2757
477 Ga0307409_100248608 3300031995 Bacteria 1624
478 Ga0307409_100577570 3300031995 Bacteria 1107
479 Ga0307409_102759867 3300031995 Bacteria 519
480 Ga0307416_100034230 3300032002 Bacteria 3863
481 Ga0307416_100039255 3300032002 Bacteria 3663
482 Ga0307416_100522761 3300032002 Bacteria 1255
483 Ga0307416_100799833 3300032002 Bacteria 1038
484 Ga0307416_102058034 3300032002 Bacteria 673
485 Ga0307414_10005163 3300032004 Bacteria 7165
486 Ga0307414_10010604 3300032004 Bacteria 5358
487 Ga0307414_10097015 3300032004 Bacteria 2207
488 Ga0307414_10270070 3300032004 Bacteria 1424
489 Ga0307414_10378636 3300032004 Bacteria 1223
490 Ga0307414_10436109 3300032004 Bacteria 1146
491 Ga0307414_11136084 3300032004 Bacteria 722
492 Ga0307411_10000168 3300032005 Bacteria 21123
493 Ga0307411_10000751 3300032005 Bacteria 11970
494 Ga0307411_10015385 3300032005 Bacteria 4295
495 Ga0307411_10051596 3300032005 Bacteria 2684
496 Ga0307411_10085804 3300032005 Bacteria 2182
497 Ga0307411_10094719 3300032005 Bacteria 2094
498 Ga0307411_10177286 3300032005 Bacteria 1614
499 Ga0307411_10966869 3300032005 Bacteria 760
500 Ga0307415_100007831 3300032126 Bacteria 5873
501 Ga0307415_100017023 3300032126 Bacteria 4350
502 Ga0307415_100017492 3300032126 Bacteria 4301
503 Ga0307415_100171309 3300032126 Bacteria 1693
504 Ga0307415_100240735 3300032126 Bacteria 1463
505 Ga0307415_100620223 3300032126 Bacteria 965
506 Ga0307415_101618382 3300032126 Bacteria 623
507 Ga0395899_0010243 3300037312 Bacteria 7185
508 Ga0395899_0025857 3300037312 Bacteria 4431
509 Ga0395900_0089179 3300037418 Bacteria 3170
510 Ga0395900_0109703 3300037418 Bacteria 2835
511 Ga0395900_0244646 3300037418 Bacteria 1798
512 Ga0395900_0300305 3300037418 Bacteria 1592
513 Ga0395898_0012082 3300037466 Bacteria 8940
514 Ga0395898_0571770 3300037466 Bacteria 1073
515 Ga0395905_0017849 3300037471 Bacteria 6741
516 Ga0395905_0047457 3300037471 Bacteria 4025
517 Ga0395905_0062943 3300037471 Bacteria 3470
518 Ga0395905_0073577 3300037471 Bacteria 3203
519 Ga0395905_0074185 3300037471 Bacteria 3188
520 Ga0395905_0151536 3300037471 Bacteria 2181
521 Ga0395905_0222130 3300037471 Bacteria 1768
522 Ga0395905_0237918 3300037471 Bacteria 1702
523 Ga0395905_0419240 3300037471 Unclassified 1235
524 Ga0395905_0554161 3300037471 Bacteria 1051
525 Ga0395905_1059103 3300037471 Unclassified 714
526 Ga0395901_0035145 3300038443 Bacteria 5178
527 Ga0395901_0087173 3300038443 Bacteria 3264
528 Ga0395901_0100034 3300038443 Bacteria 3041
529 Ga0395901_0122210 3300038443 Bacteria 2736
530 Ga0395901_0632103 3300038443 Bacteria 1076
531 Ga0436365_1523673 3300039437 Bacteria 3050
532 Ga0439432_022083 3300042006 Bacteria 2103
533 Ga0439449_0075973 3300042007 Bacteria 1238
534 Ga0439462_0029655 3300042015 Bacteria 1447
535 Ga0450912_016212 3300042116 Unclassified 689
536 Ga0439458_0000005 3300042157 Bacteria 32418
537 Ga0439460_0029334 3300042461 Bacteria 1557
538 Ga0466966_0403687 3300044684 Bacteria 821
539 Ga0466964_0082904 3300044706 Bacteria 1380
540 Ga0466967_0005262 3300045976 Bacteria 8921
541 Ga0495663_0222815 3300046525 Bacteria 663
542 Ga0495598_0180856 3300046537 Unclassified 752
543 Ga0495621_0013738 3300046539 Bacteria 2549
544 Ga0495621_0161347 3300046539 Bacteria 887
545 Ga0495668_0005101 3300046616 Bacteria 9031
546 Ga0495669_0013901 3300046684 Bacteria 3436
547 Ga0495669_0021033 3300046684 Bacteria 2828
548 Ga0495669_0027230 3300046684 Bacteria 2500
549 Ga0495669_0032061 3300046684 Bacteria 2308
550 Ga0495670_0440750 3300046691 Unclassified 705
551 Ga0495677_0020657 3300047445 Bacteria 2387
552 Ga0495677_0138621 3300047445 Bacteria 933
553 Ga0495677_0309410 3300047445 Bacteria 622
554 Ga0495685_138087 3300047447 Bacteria 795
555 Ga0496101_1306476 3300048904 Bacteria 567
556 Ga0496107_1028350 3300048910 Bacteria 597
557 Ga0496108_0018850 3300048911 Bacteria 5658
558 Ga0496112_0055180 3300048915 Bacteria 3906
559 Ga0496114_0000029 3300048917 Bacteria 175132
560 Ga0501223_080362 3300049663 Bacteria 652
561 Ga0501242_080167 3300049674 Bacteria 523
562 Ga0501079_0663557 3300049741 Bacteria 821
563 Ga0500658_0019399 3300053134 Bacteria 2558
564 Ga0068858_100223327
565 JGI24740J21852_10002219
566 JGI24740J21852_10069092
567 JGI24739J22299_10000035
568 JGI24737J22298_10000020
569 JGI24737J22298_10032808
570 JGI24735J21928_10076961
571 JGI24738J21930_10000048
572 JGI24738J21930_10014852
573 JGI24749J21850_1045592
574 JGI24749J21850_1052663
575 JGI24742J22300_10008574
576 Ga0065712_10073329
577 Ga0065712_10321658
578 Ga0065715_10122647
579 Ga0065715_10160295
580 Ga0070658_10049940
581 Ga0070658_10084656
582 Ga0070658_10841263
583 Ga0070676_10008339
584 Ga0070676_10097367
585 Ga0070676_10394796
586 Ga0070683_100565154
587 Ga0070690_100002148
588 Ga0070670_100007872
589 Ga0070670_100009146
590 Ga0070670_100040522
591 Ga0070670_100045987
592 Ga0070670_100066709
593 Ga0070670_100146371
594 Ga0070677_10027456
595 Ga0070677_10057858
596 Ga0070677_10141302
597 Ga0068869_100000043
598 Ga0070666_10006595
599 Ga0070666_10061690
600 Ga0070666_10246877
601 Ga0070680_100597895
602 Ga0070680_101482302
603 Ga0070682_100063843
604 Ga0068868_100000957
605 Ga0070660_100000415
606 Ga0070660_100018258
607 Ga0070660_100027021
608 Ga0070660_100098708
609 Ga0070660_100223214
610 Ga0070660_100227508
611 Ga0070660_100327822
612 Ga0070660_101057365
613 Ga0070689_100024220
614 Ga0070687_100355659
615 Ga0070661_100049721
616 Ga0070661_100053920
617 Ga0070661_100125603
618 Ga0070692_10000681
619 Ga0070692_10022157
620 Ga0070692_10066114
621 Ga0070668_100005171
622 Ga0070668_100108154
623 Ga0070668_100161401
624 Ga0070668_100383100
625 Ga0070668_100613676
626 Ga0070669_100000209
627 Ga0070669_100017103
628 Ga0070669_100034364
629 Ga0070669_100173960
630 Ga0070669_100339378
631 Ga0070675_100004947
632 Ga0070675_100053098
633 Ga0070675_101027331
634 Ga0070675_101475903
635 Ga0070671_100000946
636 Ga0070671_100002968
637 Ga0070671_100011924
638 Ga0070671_100259227
639 Ga0070671_100572062
640 Ga0070671_101028895
641 Ga0070674_100095457
642 Ga0070674_100248082
643 Ga0070674_100567009
644 Ga0070673_100000354
645 Ga0070673_100001479
646 Ga0070673_100861499
647 Ga0070659_100000184
648 Ga0070659_100000463
649 Ga0070659_100001102
650 Ga0070659_100101129
651 Ga0070659_100109929
652 Ga0070659_100146131
653 Ga0070659_100210950
654 Ga0070659_100619753
655 Ga0070659_101090348
656 Ga0070659_101572877
657 Ga0070667_100020452
658 Ga0070667_100106555
659 Ga0070667_100208498
660 Ga0070667_100223839
661 Ga0070667_100735283
662 Ga0070701_10918783
663 Ga0070694_100053280
664 Ga0070663_100005191
665 Ga0070663_100268125
666 Ga0070663_100447315
667 Ga0070663_100543226
668 Ga0070678_100065030
669 Ga0070678_100114619
670 Ga0070678_100119808
671 Ga0070662_100000754
672 Ga0070662_100002965
673 Ga0070662_100036442
674 Ga0070662_100090378
675 Ga0070662_101474820
676 Ga0070681_10272930
677 Ga0068867_100029006
678 Ga0068867_100069438
679 Ga0068867_100269895
680 Ga0068867_101309577
681 Ga0070679_100100066
682 Ga0070679_100295725
683 Ga0070679_101078934
684 Ga0070679_101459384
685 Ga0068853_100001421
686 Ga0068853_100124216
687 Ga0068853_100397271
688 Ga0068853_100623112
689 Ga0068853_101151290
690 Ga0070672_100000380
691 Ga0070672_100027862
692 Ga0070672_100191997
693 Ga0070672_100230804
694 Ga0070672_100578829
695 Ga0070686_100949947
696 Ga0070695_100083417
697 Ga0070696_100499163
698 Ga0070693_100051268
699 Ga0070693_100308131
700 Ga0070665_100018452
701 Ga0070665_100037535
702 Ga0070665_100541106
703 Ga0070704_100364252
704 Ga0068855_100000780
705 Ga0068855_100035037
706 Ga0068855_100059044
707 Ga0070664_100003721
708 Ga0070664_100008854
709 Ga0070664_100012056
710 Ga0070664_100136657
711 Ga0070664_100285081
712 Ga0070664_100435210
713 Ga0070664_100599443
714 Ga0068857_100003128
715 Ga0068857_100011668
716 Ga0068857_100055655
717 Ga0068857_100121144
718 Ga0068857_100314791
719 Ga0068857_100795979
720 Ga0068854_100000414
721 Ga0068854_100042391
722 Ga0068854_100051055
723 Ga0068854_100146039
724 Ga0068856_100584981
725 Ga0068852_100000798
726 Ga0068852_100070179
727 Ga0068852_100290648
728 Ga0068852_100772269
729 Ga0068859_100008232
730 Ga0068859_100150902
731 Ga0068864_100000181
732 Ga0068864_100008287
733 Ga0068864_100029454
734 Ga0068864_100184117
735 Ga0068866_10258143
736 Ga0068861_100077323
737 Ga0068861_100992281
738 Ga0068861_101006976
739 Ga0068851_10008266
740 Ga0068851_10029820
741 Ga0068851_10341861
742 Ga0068863_100004126
743 Ga0068863_100338811
744 Ga0068863_100357289
745 Ga0068863_100531670
746 Ga0068863_100561626
747 Ga0068858_100005075
748 Ga0068858_100200751
749 Ga0068860_100002079
750 Ga0068860_100071163
751 Ga0068860_100071286
752 Ga0068860_100105234
753 Ga0068860_100293400
754 Ga0068862_100036302
755 Ga0068862_100052181
756 Ga0068862_100215697
757 Ga0068862_100265035
758 Ga0068862_100462743
759 Ga0070717_10288697
760 Ga0075365_10526119
761 Ga0097621_100484186
762 Ga0068871_100200840
763 Ga0068871_100223848
764 Ga0068871_101147328
765 Ga0068865_100002737
766 Ga0068865_100141311
767 Ga0068865_100158997
768 Ga0068865_100931055
769 Ga0097620_100008232
770 Ga0097620_100029350
771 Ga0097620_100150888
772 Ga0097620_101168901
773 Ga0105245_10003294
774 Ga0105245_10473152
775 Ga0105247_10156286
776 Ga0105243_10027026
777 Ga0105243_10057528
778 Ga0105243_10432370
779 Ga0105241_10013892
780 Ga0105241_10079271
781 Ga0105241_10734971
782 Ga0105242_10075412
783 Ga0105248_10000256
784 Ga0105248_10016393
785 Ga0105248_10100250
786 Ga0105248_10126326
787 Ga0105237_10297555
788 Ga0105237_12339839
789 Ga0105238_10316977
790 Ga0105249_10278714
791 Ga0105249_10435783
792 Ga0105239_10049371
793 Ga0105239_10095834
794 Ga0105246_10002855
795 Ga0157373_10026824
796 Ga0157371_10002108
797 Ga0157371_10031413
798 Ga0157371_10138073
799 Ga0157374_10521991
800 Ga0157378_10009565
801 Ga0157378_10103811
802 Ga0163162_10483497
803 Ga0163162_10789428
804 Ga0157372_10107953
805 Ga0157372_10328574
806 Ga0157372_10532911
807 Ga0157375_10611899
808 Ga0163163_10720565
809 Ga0157380_10083803
810 Ga0157380_10800470
811 Ga0157379_10072080
812 Ga0157379_10367750
813 Ga0163161_10035407
814 Ga0163161_10691755
815 Ga0163161_10977378
816 Ga0213876_10357148
817 Ga0207697_10000007
818 Ga0207656_10002541
819 Ga0207656_10223069
820 Ga0207682_10009791
821 Ga0207682_10021935
822 Ga0207682_10062749
823 Ga0207682_10072996
824 Ga0207642_10557330
825 Ga0207688_10000318
826 Ga0207688_10046161
827 Ga0207688_10424043
828 Ga0207680_10198084
829 Ga0207680_10260773
830 Ga0207680_10313805
831 Ga0207647_10000052
832 Ga0207647_10001246
833 Ga0207645_10011287
834 Ga0207645_10016045
835 Ga0207645_10067976
836 Ga0207645_10134948
837 Ga0207705_10005213
838 Ga0207705_10013658
839 Ga0207705_10050288
840 Ga0207705_10222131
841 Ga0207705_10411581
842 Ga0207705_10539856
843 Ga0207654_10052743
844 Ga0207707_10041718
845 Ga0207660_10003720
846 Ga0207662_10148402
847 Ga0207657_10007007
848 Ga0207657_10025279
849 Ga0207657_10028702
850 Ga0207657_10143674
851 Ga0207657_10182324
852 Ga0207657_10212089
853 Ga0207657_10306114
854 Ga0207649_10051842
855 Ga0207649_10093348
856 Ga0207649_10110359
857 Ga0207649_10603160
858 Ga0207652_10004132
859 Ga0207681_10001637
860 Ga0207681_10022463
861 Ga0207681_10048071
862 Ga0207681_10143782
863 Ga0207681_10295385
864 Ga0207650_10010177
865 Ga0207650_10013470
866 Ga0207650_10021149
867 Ga0207650_10026898
868 Ga0207650_10113541
869 Ga0207650_10151922
870 Ga0207659_10004495
871 Ga0207687_10001182
872 Ga0207644_10000960
873 Ga0207644_10004259
874 Ga0207644_10008095
875 Ga0207644_10384514
876 Ga0207644_10573893
877 Ga0207644_10917207
878 Ga0207644_11213604
879 Ga0207690_10000112
880 Ga0207690_10000463
881 Ga0207690_10067085
882 Ga0207690_10117089
883 Ga0207690_10120823
884 Ga0207690_10282886
885 Ga0207690_10296353
886 Ga0207690_10361536
887 Ga0207690_10437270
888 Ga0207706_10000705
889 Ga0207706_10002562
890 Ga0207706_10016933
891 Ga0207706_10023901
892 Ga0207706_10063584
893 Ga0207706_10076453
894 Ga0207706_10201246
895 Ga0207709_10034750
896 Ga0207670_10026192
897 Ga0207670_10407838
898 Ga0207669_10166106
899 Ga0207669_10292759
900 Ga0207704_10007674
901 Ga0207704_10030575
902 Ga0207704_10132954
903 Ga0207691_10001179
904 Ga0207691_10003343
905 Ga0207691_10110951
906 Ga0207691_10246901
907 Ga0207711_10007771
908 Ga0207711_10013929
909 Ga0207711_10021847
910 Ga0207711_10022743
911 Ga0207711_10267400
912 Ga0207689_10000014
913 Ga0207661_10111881
914 Ga0207679_10007531
915 Ga0207679_10010964
916 Ga0207679_10013031
917 Ga0207679_10075155
918 Ga0207679_10307623
919 Ga0207667_10003943
920 Ga0207667_10013929
921 Ga0207667_10059579
922 Ga0207667_11187208
923 Ga0207651_10002150
924 Ga0207651_10069092
925 Ga0207651_10297899
926 Ga0207651_12102960
927 Ga0207712_10001817
928 Ga0207668_10010841
929 Ga0207668_10037322
930 Ga0207668_10163837
931 Ga0207668_10204710
932 Ga0207668_10239823
933 Ga0207668_10794818
934 Ga0207640_10000404
935 Ga0207640_10185095
936 Ga0207640_10201226
937 Ga0207640_10453004
938 Ga0207658_10024917
939 Ga0207658_10057701
940 Ga0207658_10123906
941 Ga0207658_10174549
942 Ga0207658_10299245
943 Ga0207658_10600451
944 Ga0207658_10739457
945 Ga0207658_10811102
946 Ga0207677_10000905
947 Ga0207677_10326781
948 Ga0207677_10712898
949 Ga0207703_10000933
950 Ga0207703_10233752
951 Ga0207703_10275200
952 Ga0207639_10001273
953 Ga0207639_10092416
954 Ga0207639_10336637
955 Ga0207639_10349390
956 Ga0207639_10606927
957 Ga0207678_10006202
958 Ga0207678_10013162
959 Ga0207678_10018886
960 Ga0207678_10309368
961 Ga0207702_10210849
962 Ga0207641_10001015
963 Ga0207641_10199185
964 Ga0207641_10866350
965 Ga0207648_10002058
966 Ga0207648_10074905
967 Ga0207648_10095419
968 Ga0207676_10000666
969 Ga0207676_10019771
970 Ga0207676_10046019
971 Ga0207676_10770200
972 Ga0207674_10000244
973 Ga0207674_10000308
974 Ga0207674_10754184
975 Ga0207674_11006176
976 Ga0207675_100080348
977 Ga0207675_100269835
978 Ga0207675_101260848
979 Ga0207683_10022964
980 Ga0207683_10083906
981 Ga0207683_10174132
982 Ga0207698_10000394
983 Ga0207698_10053558
984 Ga0207698_10169794
985 Ga0268266_10018395
986 Ga0268266_10032411
987 Ga0268265_10017318
988 Ga0268265_10043656
989 Ga0268265_10128544
990 Ga0268265_10180798
991 Ga0268265_10213135
992 Ga0268265_10340667
993 Ga0268264_10007446
994 Ga0268264_10016183
995 Ga0268264_10032942
996 Ga0268264_10174506
997 Ga0268264_10206901
998 Ga0265327_10003197
999 Ga0307513_10396652
1000 Ga0307408_100022859
1001 Ga0307408_100326558
1002 Ga0307408_100444399
1003 Ga0307408_101190250
1004 Ga0307408_101300451
1005 Ga0307405_10048084
1006 Ga0307405_10147343
1007 Ga0307405_10164633
1008 Ga0307405_10201937
1009 Ga0307413_10016807
1010 Ga0307413_10160903
1011 Ga0307413_10242589
1012 Ga0307413_10784678
1013 Ga0307413_10806556
1014 Ga0307413_11563297
1015 Ga0307410_10000411
1016 Ga0307410_10007304
1017 Ga0307410_10053664
1018 Ga0307410_10060046
1019 Ga0307410_10148183
1020 Ga0307410_10171746
1021 Ga0307410_11632810
1022 Ga0307410_11901688
1023 Ga0307406_10048403
1024 Ga0307406_10069459
1025 Ga0307406_11039076
1026 Ga0307407_10136059
1027 Ga0307407_10140064
1028 Ga0307407_10195226
1029 Ga0307407_10374198
1030 Ga0307412_10004709
1031 Ga0307412_10031879
1032 Ga0307412_10044839
1033 Ga0307412_10194321
1034 Ga0307412_10219557
1035 Ga0307412_10445837
1036 Ga0307412_10494982
1037 Ga0307409_100000126
1038 Ga0307409_100068897
1039 Ga0307409_100071577
1040 Ga0307409_100248608
1041 Ga0307409_100577570
1042 Ga0307409_102759867
1043 Ga0307416_100034230
1044 Ga0307416_100039255
1045 Ga0307416_100522761
1046 Ga0307416_100799833
1047 Ga0307416_102058034
1048 Ga0307414_10005163
1049 Ga0307414_10010604
1050 Ga0307414_10097015
1051 Ga0307414_10270070
1052 Ga0307414_10378636
1053 Ga0307414_10436109
1054 Ga0307414_11136084
1055 Ga0307411_10000168
1056 Ga0307411_10000751
1057 Ga0307411_10015385
1058 Ga0307411_10051596
1059 Ga0307411_10085804
1060 Ga0307411_10094719
1061 Ga0307411_10177286
1062 Ga0307411_10966869
1063 Ga0307415_100007831
1064 Ga0307415_100017023
1065 Ga0307415_100017492
1066 Ga0307415_100171309
1067 Ga0307415_100240735
1068 Ga0307415_100620223
1069 Ga0307415_101618382
1070 Ga0395899_0010243
1071 Ga0395899_0025857
1072 Ga0395900_0089179
1073 Ga0395900_0109703
1074 Ga0395900_0244646
1075 Ga0395900_0300305
1076 Ga0395898_0012082
1077 Ga0395898_0571770
1078 Ga0395905_0017849
1079 Ga0395905_0047457
1080 Ga0395905_0062943
1081 Ga0395905_0073577
1082 Ga0395905_0074185
1083 Ga0395905_0151536
1084 Ga0395905_0222130
1085 Ga0395905_0237918
1086 Ga0395905_0419240
1087 Ga0395905_0554161
1088 Ga0395905_1059103
1089 Ga0395901_0035145
1090 Ga0395901_0087173
1091 Ga0395901_0100034
1092 Ga0395901_0122210
1093 Ga0395901_0632103
1094 Ga0436365_1523673
1095 Ga0439432_022083
1096 Ga0439449_0075973
1097 Ga0439462_0029655
1098 Ga0450912_016212
1099 Ga0439458_0000005
1100 Ga0439460_0029334
1101 Ga0466966_0403687
1102 Ga0466964_0082904
1103 Ga0466967_0005262
1104 Ga0495663_0222815
1105 Ga0495598_0180856
1106 Ga0495621_0013738
1107 Ga0495621_0161347
1108 Ga0495668_0005101
1109 Ga0495669_0013901
1110 Ga0495669_0021033
1111 Ga0495669_0027230
1112 Ga0495669_0032061
1113 Ga0495670_0440750
1114 Ga0495677_0020657
1115 Ga0495677_0138621
1116 Ga0495677_0309410
1117 Ga0495685_138087
1118 Ga0496101_1306476
1119 Ga0496107_1028350
1120 Ga0496108_0018850
1121 Ga0496112_0055180
1122 Ga0496114_0000029
1123 Ga0501223_080362
1124 Ga0501242_080167
1125 Ga0501079_0663557
1126 Ga0500658_0019399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xqj-assembly2.cif.gz_B crystal structure of a pl 26 exo-rhamnogalacturonan lyase from penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose 0.813 74 118
5xqj-assembly2.cif.gz_C crystal structure of a pl 26 exo-rhamnogalacturonan lyase from penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose 0.8114 74 118
2rgq-assembly1.cif.gz_A crystal structure of a protein of unknown function with a cystatin-like fold (npun_r3134) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8079 3 135
3f7s-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution 0.786 4 133
7o21-assembly1.cif.gz_A structure of bdellovibrio bacteriovorus bd1075 0.7821 4 136
ID Description Score Start End Superfamily
af_F1R4L9_9_222_3.30.420.150 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.7873 109 136 3.30.420.150
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7678 2 135 3.10.450.50
af_Q9W2M9_16_131_3.15.10.20 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Activator of Hsp90 ATPase Aha1, N-terminal domain 0.7653 76 135 3.15.10.20
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.762 2 135 3.10.450.50
af_B4FWN0_8_135_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7589 1 135 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2Z5UD67-F1-model_v4 Uncharacterized protein 0.983 1 136
AF-A0A7K3DQ92-F1-model_v4 Nuclear transport factor 2 family protein 0.9779 3 136
AF-A0A2Z5UD67-F1-model_v4 Uncharacterized protein 0.9759 1 136
AF-A0A7H0GAH9-F1-model_v4 deleted 0.9723 1 122
AF-B4R841-F1-model_v4 DUF4440 domain-containing protein 0.9658 3 136

Map