F464032

General Info

Members Datasets Scaffolds Average Seq Length
563 472 1126 282

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10045259|Ga0075368_100452592
Length 336
Sequence MNRDGEVIDSAETTAPQTGLTRRDVLRGGIGLGVVLGLANTRLGSAPIRGEAATPFWESEMSTITTTDGTTIFYKDWGPKDAQPIMFHHGWPLTGDDWDNQMLYFLAKGYRVIAHDRRGHGRSAQVSDGHDMDHYAADAAAVVSHLNLRDTIHVGHSTGGGEATHYVARHGNGRVAKLVIIGAIPPIMLKTATNPGGLPIEVFDNLRKQLAANRSQFYRDLASGPFYGYNRPGAKVSEAVIGNWWRQGMIGGAKAHYDGIKAFSETDLTEDLKIIDVPTLVMHGDDDQIVPIADSAMLSVKLLKKGTLKVYEKLPHGMCTTHPDVVNPDILAFIKS

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
62 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
72 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
73 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
74 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
75 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
108 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
140 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
144 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
147 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
150 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
151 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
152 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
153 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
156 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
161 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
162 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
163 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
164 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
259 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
262 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
263 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
264 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
265 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
266 2511231017 Pseudomonas sp. GM55 Isolate Nodule
267 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
268 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
269 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
270 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
271 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
272 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
273 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
274 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
275 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
276 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
277 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
278 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
279 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
280 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
281 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
282 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
283 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
284 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
285 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
286 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
287 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
288 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
289 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
290 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
291 2643221640 Caulobacter sp. Root342 Isolate Unclassified
292 2643221642 Caulobacter sp. Root343 Isolate Unclassified
293 2643221736 Bosea sp. Root483D1 Isolate Unclassified
294 2718217882 Rhizobium sp. N741 Isolate Nodule
295 2718217927 Rhizobium sp. N324 Isolate Nodule
296 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
297 2718218009 Rhizobium sp. N561 Isolate Nodule
298 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
299 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
300 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
301 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
302 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
303 2718218363 Rhizobium sp. N113 Isolate Nodule
304 2718218365 Rhizobium sp. N731 Isolate Nodule
305 2718218366 Rhizobium sp. N621 Isolate Nodule
306 2718218423 Rhizobium sp. N941 Isolate Nodule
307 2721755514 Rhizobium sp. N6212 Isolate Nodule
308 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
309 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
310 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
311 2721755809 Rhizobium sp. N541 Isolate Nodule
312 2721755810 Rhizobium sp. N871 Isolate Nodule
313 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
314 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
315 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
316 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
317 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
318 2728369365 Rhizobium sp. N1341 Isolate Nodule
319 2728369397 Rhizobium sp. N1314 Isolate Nodule
320 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
321 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
322 2791355256 Rhizobium sp. M10 Isolate Nodule
323 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
324 2791355260 Rhizobium sp. L9 Isolate Nodule
325 2791355261 Rhizobium sp. J15 Isolate Nodule
326 2791355262 Rhizobium sp. M1 Isolate Nodule
327 2791355263 Rhizobium chutanense C5 Isolate Nodule
328 2791355264 Rhizobium sp. S9 Isolate Nodule
329 2791355265 Rhizobium sp. H4 Isolate Nodule
330 2791355266 Rhizobium sp. L43 Isolate Nodule
331 2791355267 Rhizobium sp. L18 Isolate Nodule
332 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
333 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
334 2802429633 Rhizobium anhuiense J3 Isolate Nodule
335 2802429634 Rhizobium anhuiense S10 Isolate Nodule
336 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
337 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
338 2802429637 Rhizobium anhuiense C15 Isolate Nodule
339 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
340 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
341 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
342 2838048938 Rhizobium pisi 27/80 Isolate Nodule
343 2838061910 Rhizobium phaseoli L15 Isolate Nodule
344 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
345 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
346 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
347 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
348 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
349 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
350 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
351 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
352 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
353 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
354 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
355 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
356 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
357 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
358 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
359 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
360 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
361 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
362 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
363 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
364 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
365 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
366 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
367 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
368 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
369 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
370 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
371 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
372 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
373 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
374 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
375 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
376 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
377 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
378 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
379 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
380 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
381 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
382 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
383 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
384 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
385 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
386 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
387 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
388 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
389 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
390 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
391 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
392 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
393 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
394 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
395 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
396 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
397 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
398 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
399 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
400 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
401 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
402 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
403 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
404 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
405 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
406 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
407 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
408 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
409 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
410 2933599457 Rhizobium phaseoli M3 Isolate Nodule
411 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
412 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
413 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
414 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
415 2936381700 Rhizobium chutanense C16 Isolate Unclassified
416 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
417 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
418 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
419 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
420 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
421 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
422 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
423 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
424 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
425 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
426 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
427 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
428 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
429 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
430 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
431 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
432 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
433 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
434 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
435 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
436 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
437 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
438 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
439 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
440 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
441 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
442 2996893221 Rhizobium sp. R635 Isolate Nodule
443 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
444 8005275841 Rhizobium sp. N4311 Isolate Nodule
445 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
446 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
447 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
448 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
449 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
450 8005382845 Rhizobium sp. R634 Isolate Nodule
451 8005395548 Rhizobium sp. R339 Isolate Nodule
452 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
453 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
454 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
455 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
456 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
457 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
458 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
459 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
460 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
461 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
462 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
463 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
464 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
465 8018176218 Rhizobium sp. N122 Isolate Nodule
466 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
467 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
468 8024501048 Rhizobium sp. H4 Isolate Nodule
469 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
470 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
471 8056382006 Rhizobium croatiense 13T Isolate Nodule
472 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.17
Metatranscriptomes 0.36
Isolates 37.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.28
Nodule 34.99
Rhizoplane 1.78
Rhizosphere 40.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10045259 3300006042 Bacteria 1738
2 JGI24735J21928_10000432 3300002067 Bacteria 14659
3 JGI25152J39213_1000546 3300002773 Bacteria 20714
4 JGI25151J46595_10003368 3300003187 Bacteria 8851
5 JGI25153J46596_10009788 3300003215 Bacteria 4406
6 JGI25153J46596_10020726 3300003215 Bacteria 2476
7 JGI25153J46596_10024070 3300003215 Bacteria 2202
8 JGI25160J50197_1029341 3300003354 Bacteria 1457
9 JGI25161J50226_1008342 3300003374 Bacteria 1607
10 JGI25404J52841_10000657 3300003659 Bacteria 5270
11 Ga0055533_1000826 3300003756 Bacteria 9539
12 Ga0055524_1032680 3300003775 Bacteria 1470
13 Ga0055524_1046466 3300003775 Bacteria 1032
14 Ga0055536_1010719 3300003781 Bacteria 3598
15 Ga0055528_1000114 3300003790 Bacteria 64549
16 Ga0055528_1000167 3300003790 Bacteria 55317
17 Ga0055528_1015534 3300003790 Bacteria 2745
18 Ga0055528_1020507 3300003790 Bacteria 2143
19 Ga0055530_10000177 3300003791 Bacteria 58191
20 Ga0055540_1000169 3300003792 Bacteria 64875
21 Ga0055531_10000305 3300003794 Bacteria 48655
22 Ga0065165_1002117 3300005262 Bacteria 18094
23 Ga0065714_10064907 3300005288 Bacteria 15754
24 Ga0068869_100046101 3300005334 Bacteria 3142
25 Ga0070675_100087485 3300005354 Bacteria 2605
26 Ga0070675_100436592 3300005354 Bacteria 1173
27 Ga0070673_100221899 3300005364 Bacteria 1636
28 Ga0070688_100091418 3300005365 Bacteria 1989
29 Ga0070700_100016498 3300005441 Bacteria 4208
30 Ga0070694_100032347 3300005444 Bacteria 3435
31 Ga0070708_100052322 3300005445 Bacteria 3621
32 Ga0070706_100003164 3300005467 Bacteria 16264
33 Ga0070706_100022313 3300005467 Bacteria 5828
34 Ga0070707_100033262 3300005468 Bacteria 4916
35 Ga0070698_100001031 3300005471 Bacteria 30624
36 Ga0070698_100018421 3300005471 Bacteria 7352
37 Ga0070698_100047220 3300005471 Bacteria 4401
38 Ga0070698_100262982 3300005471 Bacteria 1657
39 Ga0070699_100017215 3300005518 Bacteria 6207
40 Ga0070699_100084131 3300005518 Bacteria 2776
41 Ga0070697_100016196 3300005536 Bacteria 5863
42 Ga0070697_100078159 3300005536 Bacteria 2722
43 Ga0068853_100132259 3300005539 Bacteria 2235
44 Ga0070704_100031807 3300005549 Bacteria 3552
45 Ga0068859_100366627 3300005617 Bacteria 1536
46 Ga0068870_10093394 3300005840 Bacteria 1687
47 Ga0068862_100006343 3300005844 Bacteria 9832
48 Ga0081455_10000881 3300005937 Bacteria 38864
49 Ga0081539_10009656 3300005985 Bacteria 7999
50 Ga0070717_10041448 3300006028 Bacteria 3753
51 Ga0075365_10051574 3300006038 Bacteria 2718
52 Ga0075363_100028382 3300006048 Bacteria 2878
53 Ga0075363_100092777 3300006048 Bacteria 1663
54 Ga0075364_10175597 3300006051 Bacteria 1449
55 Ga0075362_10002333 3300006177 Bacteria 6349
56 Ga0075362_10026185 3300006177 Bacteria 2489
57 Ga0075367_10003748 3300006178 Bacteria 7317
58 Ga0075367_10019831 3300006178 Bacteria 3734
59 Ga0075369_10033302 3300006186 Bacteria 2183
60 Ga0075369_10035994 3300006186 Bacteria 2105
61 Ga0075366_10017393 3300006195 Bacteria 4137
62 Ga0075366_10036487 3300006195 Bacteria 2898
63 Ga0075366_10048010 3300006195 Bacteria 2531
64 Ga0075370_10049883 3300006353 Bacteria 2373
65 Ga0075370_10178352 3300006353 Bacteria 1250
66 Ga0075428_100596584 3300006844 Bacteria 1180
67 Ga0075430_100055604 3300006846 Bacteria 3328
68 Ga0075430_100265950 3300006846 Bacteria 1420
69 Ga0075431_100035919 3300006847 Bacteria 5103
70 Ga0075431_100315667 3300006847 Bacteria 1577
71 Ga0075433_10323692 3300006852 Bacteria 1364
72 Ga0075434_100450806 3300006871 Bacteria 1308
73 Ga0075436_100025527 3300006914 Bacteria 4067
74 Ga0097620_100366580 3300006931 Bacteria 1536
75 Ga0079104_1007009 3300006946 Bacteria 4155
76 Ga0105250_10016774 3300009092 Bacteria 2981
77 Ga0105240_10331732 3300009093 Bacteria 1731
78 Ga0105247_10202073 3300009101 Bacteria 1336
79 Ga0114129_10623266 3300009147 Bacteria 1395
80 Ga0105242_10078460 3300009176 Bacteria 2757
81 Ga0105237_10520469 3300009545 Bacteria 1196
82 Ga0105249_10677431 3300009553 Bacteria 1090
83 Ga0123341_1000013 3300009765 Bacteria 97696
84 Ga0123342_1024412 3300009766 Bacteria 3787
85 Ga0105239_10290111 3300010375 Bacteria 1842
86 Ga0157370_10001147 3300013104 Bacteria 33013
87 Ga0157369_10253398 3300013105 Bacteria 1837
88 Ga0157378_10589075 3300013297 Bacteria 1122
89 Ga0163162_10177895 3300013306 Bacteria 2253
90 Ga0157372_10252025 3300013307 Bacteria 2049
91 Ga0163163_10659514 3300014325 Bacteria 1110
92 Ga0157376_10487834 3300014969 Bacteria 1209
93 Ga0183368_1004 3300015687 Bacteria 1211761
94 Ga0183360_10555 3300015689 Bacteria 1081
95 Ga0183363_1029 3300015690 Bacteria 50632
96 Ga0228711_1005756 3300022739 Bacteria 18764
97 Ga0228710_1005951 3300022740 Bacteria 18765
98 Ga0209129_1000250 3300025258 Bacteria 56427
99 Ga0209129_1002082 3300025258 Bacteria 10276
100 Ga0209673_1000013 3300025273 Bacteria 571633
101 Ga0209673_1000385 3300025273 Bacteria 79491
102 Ga0209673_1000522 3300025273 Bacteria 62876
103 Ga0209675_1000097 3300025291 Bacteria 131546
104 Ga0209676_1000175 3300025292 Bacteria 153258
105 Ga0209676_1038801 3300025292 Bacteria 1359
106 Ga0209025_1000172 3300025294 Bacteria 160407
107 Ga0209025_1001166 3300025294 Bacteria 37252
108 Ga0209025_1017908 3300025294 Bacteria 4057
109 Ga0209564_1000118 3300025295 Bacteria 205431
110 Ga0209564_1000264 3300025295 Bacteria 111404
111 Ga0209564_1016816 3300025295 Bacteria 2888
112 Ga0209758_1000005 3300025297 Bacteria 1368918
113 Ga0209758_1003856 3300025297 Bacteria 13150
114 Ga0209758_1012304 3300025297 Bacteria 4803
115 Ga0209050_1000492 3300025298 Bacteria 67914
116 Ga0209050_1002815 3300025298 Bacteria 13889
117 Ga0209256_1000160 3300025299 Bacteria 138781
118 Ga0209256_1000369 3300025299 Bacteria 72557
119 Ga0207426_1000039 3300025302 Bacteria 439937
120 Ga0207426_1000479 3300025302 Bacteria 60939
121 Ga0209051_1000418 3300025303 Bacteria 58817
122 Ga0209051_1000602 3300025303 Bacteria 42068
123 Ga0209051_1009776 3300025303 Bacteria 4913
124 Ga0209051_1009869 3300025303 Bacteria 4882
125 Ga0209257_1000583 3300025304 Bacteria 61032
126 Ga0209257_1002124 3300025304 Bacteria 20695
127 Ga0209257_1004886 3300025304 Bacteria 9898
128 Ga0207688_10231610 3300025901 Bacteria 1115
129 Ga0207647_10028858 3300025904 Bacteria 3598
130 Ga0207645_10196780 3300025907 Bacteria 1325
131 Ga0207684_10002722 3300025910 Bacteria 17629
132 Ga0207684_10004018 3300025910 Bacteria 14061
133 Ga0207684_10008101 3300025910 Bacteria 9368
134 Ga0207684_10216347 3300025910 Bacteria 1653
135 Ga0207663_10018162 3300025916 Bacteria 3935
136 Ga0207663_10040981 3300025916 Bacteria 2819
137 Ga0207660_10280408 3300025917 Bacteria 1322
138 Ga0207652_10022321 3300025921 Bacteria 5235
139 Ga0207646_10024829 3300025922 Bacteria 5486
140 Ga0207681_10171367 3300025923 Bacteria 1645
141 Ga0207650_10075962 3300025925 Bacteria 2537
142 Ga0207659_10037178 3300025926 Bacteria 3378
143 Ga0207700_10226662 3300025928 Bacteria 1587
144 Ga0207700_10503048 3300025928 Bacteria 1072
145 Ga0207706_10074257 3300025933 Bacteria 2990
146 Ga0207709_10424867 3300025935 Bacteria 1022
147 Ga0207691_10055656 3300025940 Bacteria 3604
148 Ga0207668_10216025 3300025972 Bacteria 1536
149 Ga0207708_10029295 3300026075 Bacteria 4172
150 Ga0207675_100021889 3300026118 Bacteria 5951
151 Ga0207683_10400696 3300026121 Bacteria 1262
152 Ga0209281_1006860 3300027111 Bacteria 2909
153 Ga0209969_1002720 3300027360 Bacteria 2449
154 Ga0209999_1005976 3300027543 Bacteria 2187
155 Ga0209971_1000012 3300027682 Bacteria 74016
156 Ga0209966_1002561 3300027695 Bacteria 3035
157 Ga0209998_10000459 3300027717 Bacteria 11310
158 Ga0268265_10004471 3300028380 Bacteria 9688
159 Ga0268265_10366481 3300028380 Bacteria 1321
160 Ga0265319_1037721 3300028563 Bacteria 1646
161 Ga0265338_10002633 3300028800 Bacteria 26474
162 Ga0265338_10003473 3300028800 Bacteria 22157
163 Ga0265762_1001193 3300030760 Bacteria 4717
164 Ga0265760_10017357 3300031090 Bacteria 2067
165 Ga0265328_10033545 3300031239 Bacteria 1903
166 Ga0265320_10002805 3300031240 Bacteria 11997
167 Ga0265325_10113815 3300031241 Bacteria 1312
168 Ga0265339_10003904 3300031249 Bacteria 10329
169 Ga0265339_10006350 3300031249 Bacteria 7768
170 Ga0265331_10042089 3300031250 Bacteria 2217
171 Ga0265316_10009807 3300031344 Bacteria 8792
172 Ga0265314_10001670 3300031711 Bacteria 24168
173 Ga0265342_10001811 3300031712 Bacteria 19437
174 Ga0265342_10176413 3300031712 Bacteria 1172
175 Ga0307516_10191012 3300031730 Bacteria 1774
176 Ga0307413_10036223 3300031824 Bacteria 2839
177 Ga0307413_10293215 3300031824 Bacteria 1230
178 Ga0307410_10020065 3300031852 Bacteria 4080
179 Ga0307407_10291642 3300031903 Bacteria 1134
180 Ga0307412_10059117 3300031911 Bacteria 2568
181 Ga0307409_100013124 3300031995 Bacteria 5316
182 Ga0307411_10013600 3300032005 Bacteria 4497
183 Ga0373937_0548113 3300036401 Bacteria 1098
184 Ga0395905_0005888 3300037471 Bacteria 12444
185 Ga0395905_0180846 3300037471 Bacteria 1980
186 Ga0436360_0304671 3300039438 Bacteria 8371
187 Ga0436363_0735710 3300039450 Bacteria 1271
188 Ga0439436_0004180 3300041404 Bacteria 4423
189 Ga0439438_004488 3300041405 Bacteria 5338
190 Ga0439447_001409 3300041407 Bacteria 8809
191 Ga0439453_0000926 3300041408 Bacteria 3526
192 Ga0439466_0000602 3300041411 Bacteria 13489
193 Ga0439465_0009084 3300041413 Bacteria 3134
194 Ga0451791_1195474 3300041451 Bacteria 923
195 Ga0451806_115708 3300041462 Bacteria 2826
196 Ga0451807_2030052 3300041486 Bacteria 1518
197 Ga0451833_0218675 3300041491 Bacteria 4345
198 Ga0451833_1111154 3300041491 Bacteria 1270
199 Ga0451835_1123733 3300041492 Bacteria 2588
200 Ga0451837_1649472 3300041494 Bacteria 1399
201 Ga0451839_0147971 3300041496 Bacteria 3881
202 Ga0451841_0388975 3300041498 Bacteria 2258
203 Ga0451841_1258288 3300041498 Bacteria 1715
204 Ga0451845_0247088 3300041501 Bacteria 1383
205 Ga0451847_0031488 3300041503 Bacteria 1186
206 Ga0451847_0518925 3300041503 Bacteria 3489
207 Ga0451849_0224329 3300041505 Bacteria 4025
208 Ga0451849_1342573 3300041505 Bacteria 1664
209 Ga0451851_1205647 3300041507 Bacteria 5846
210 Ga0451843_0121327 3300041509 Bacteria 1405
211 Ga0451843_1740549 3300041509 Bacteria 2054
212 Ga0451855_0495296 3300041511 Bacteria 5127
213 Ga0451853_0630583 3300041512 Bacteria 5151
214 Ga0439448_0016210 3300042005 Bacteria 2266
215 Ga0439448_0087372 3300042005 Bacteria 1051
216 Ga0439432_040417 3300042006 Bacteria 1479
217 Ga0439451_024771 3300042009 Bacteria 1209
218 Ga0439452_002248 3300042010 Bacteria 7244
219 Ga0439454_005559 3300042011 Bacteria 1510
220 Ga0439456_040666 3300042013 Bacteria 1007
221 Ga0439463_014991 3300042016 Bacteria 1915
222 Ga0439446_0006738 3300042156 Bacteria 3005
223 Ga0439464_0013264 3300042439 Bacteria 2204
224 Ga0439460_0009613 3300042461 Bacteria 2457
225 Ga0450901_003585 3300042533 Bacteria 1616
226 Ga0451577_0252852 3300042876 Bacteria 1595
227 Ga0453683_0027937 3300044673 Bacteria 3575
228 Ga0453684_0293125 3300044712 Bacteria 1852
229 Ga0451576_0053954 3300045051 Bacteria 4209
230 Ga0451576_0061600 3300045051 Bacteria 3912
231 Ga0495617_000221 3300046452 Bacteria 34624
232 Ga0495627_027808 3300046453 Bacteria 1811
233 Ga0495603_0028359 3300046455 Bacteria 3376
234 Ga0495638_0000073 3300046460 Bacteria 164378
235 Ga0495638_0030838 3300046460 Bacteria 3448
236 Ga0495638_0074734 3300046460 Bacteria 2066
237 Ga0495580_0075093 3300046472 Bacteria 2359
238 Ga0495605_0058383 3300046474 Bacteria 1855
239 Ga0495639_0056935 3300046475 Bacteria 1786
240 Ga0495584_0135989 3300046491 Bacteria 1248
241 Ga0495585_0018099 3300046492 Bacteria 4065
242 Ga0495594_0001181 3300046499 Bacteria 13668
243 Ga0495583_0000087 3300046506 Bacteria 164974
244 Ga0495583_0076325 3300046506 Bacteria 1464
245 Ga0495606_0006993 3300046507 Bacteria 10245
246 Ga0495610_0070744 3300046512 Bacteria 1628
247 Ga0495620_0014886 3300046515 Bacteria 3942
248 Ga0495632_0000270 3300046519 Bacteria 51498
249 Ga0495648_0000049 3300046524 Bacteria 164366
250 Ga0495648_0000642 3300046524 Bacteria 37256
251 Ga0495642_0125797 3300046528 Bacteria 1102
252 Ga0495654_0001044 3300046530 Bacteria 20280
253 Ga0495654_0019127 3300046530 Bacteria 3582
254 Ga0495622_0006217 3300046557 Bacteria 5544
255 Ga0495633_0036746 3300046558 Bacteria 2345
256 Ga0495668_0013295 3300046616 Bacteria 4861
257 Ga0495611_0016243 3300046648 Bacteria 3182
258 Ga0495625_0019775 3300046660 Bacteria 5211
259 Ga0495625_0025002 3300046660 Bacteria 4535
260 Ga0495625_0080670 3300046660 Bacteria 2265
261 Ga0495625_0120028 3300046660 Bacteria 1790
262 Ga0495670_0004850 3300046691 Bacteria 6601
263 Ga0495671_0000042 3300046692 Bacteria 165201
264 Ga0495671_0073469 3300046692 Bacteria 1678
265 Ga0495660_0003279 3300046810 Bacteria 10043
266 Ga0495636_0043904 3300047318 Bacteria 1861
267 Ga0495672_0005190 3300047320 Bacteria 10381
268 Ga0495683_0023726 3300047323 Bacteria 3152
269 Ga0495687_000222 3300047443 Bacteria 80818
270 Ga0495687_000377 3300047443 Bacteria 55506
271 Ga0495687_009383 3300047443 Bacteria 5472
272 Ga0495687_066982 3300047443 Bacteria 1455
273 Ga0495685_057461 3300047447 Bacteria 1314
274 Ga0495673_0000111 3300047469 Bacteria 164974
275 Ga0495673_0070554 3300047469 Bacteria 1471
276 Ga0495686_0008763 3300047472 Bacteria 7375
277 Ga0496102_0181347 3300048905 Bacteria 1984
278 Ga0496103_0175269 3300048906 Bacteria 1378
279 Ga0496104_0820360 3300048907 Bacteria 836
280 Ga0496112_0141642 3300048915 Bacteria 2374
281 Ga0496113_0065925 3300048916 Bacteria 2741
282 Ga0496115_0000040 3300048918 Bacteria 122975
283 Ga0496115_0141545 3300048918 Bacteria 1985
284 Ga0496116_0121026 3300048919 Bacteria 1515
285 Ga0496117_0133832 3300048920 Bacteria 1497
286 Ga0496118_0004322 3300048921 Bacteria 16944
287 Ga0496121_0053365 3300048924 Bacteria 3387
288 Ga0496122_0011912 3300048925 Bacteria 8732
289 Ga0496123_0114493 3300048926 Bacteria 1533
290 Ga0496124_0042423 3300048927 Bacteria 3918
291 Ga0496124_0217674 3300048927 Bacteria 1439
292 Ga0496124_0264346 3300048927 Bacteria 1264
293 Ga0495678_024131 3300049459 Bacteria 2631
294 Ga0495682_0003159 3300049460 Bacteria 7427
295 Ga0495682_0008879 3300049460 Bacteria 3946
296 Ga0501031_0175349 3300049568 Bacteria 1400
297 Ga0501032_0084778 3300049569 Bacteria 2106
298 Ga0501033_0005016 3300049570 Bacteria 10534
299 Ga0501033_0203796 3300049570 Bacteria 1412
300 Ga0501034_0001197 3300049571 Bacteria 35694
301 Ga0501037_0187700 3300049573 Bacteria 1464
302 Ga0501038_0028910 3300049574 Bacteria 4919
303 Ga0501042_0014740 3300049578 Bacteria 5337
304 Ga0501043_0014211 3300049579 Bacteria 6229
305 Ga0501043_0067493 3300049579 Bacteria 2808
306 Ga0501046_0041742 3300049580 Bacteria 3659
307 Ga0501047_0071947 3300049581 Bacteria 3328
308 Ga0501067_0029252 3300049583 Bacteria 3053
309 Ga0501067_0063209 3300049583 Bacteria 2050
310 Ga0501070_0277967 3300049586 Bacteria 1366
311 Ga0501071_0191904 3300049587 Bacteria 1532
312 Ga0501073_0203333 3300049589 Bacteria 1369
313 Ga0501076_0256577 3300049592 Bacteria 1431
314 Ga0501080_0137269 3300049742 Bacteria 2262
315 Ga0501083_0205151 3300049744 Bacteria 1285
316 Ga0501035_0186998 3300049822 Bacteria 1782
317 Ga0501035_0233547 3300049822 Bacteria 1566
318 Ga0501044_0026836 3300049823 Bacteria 6096
319 nmdc:mga03683_20419_c1 3300050489 Bacteria 2541
320 nmdc:mga03683_31349_c1 3300050489 Bacteria 2132
321 nmdc:mga0k408_49080_c1 3300050493 Bacteria 2443
322 nmdc:mga0k408_7226_c1 3300050493 Bacteria 5934
323 nmdc:mga06z11_19277_c1 3300050494 Bacteria 3133
324 nmdc:mga06z11_66028_c1 3300050494 Bacteria 1900
325 nmdc:mga06z11_8609_c1 3300050494 Bacteria 4265
326 nmdc:mga07m45_73469_c1 3300050496 Bacteria 1947
327 nmdc:mga05p37_325930_c1 3300050507 Bacteria 1816
328 nmdc:mga05p37_96659_c1 3300050507 Bacteria 3639
329 nmdc:mga09592_326920_c1 3300050508 Bacteria 1328
330 nmdc:mga0qj67_30630_c1 3300050509 Bacteria 4189
331 nmdc:mga0qj67_32867_c1 3300050509 Bacteria 4047
332 nmdc:mga0qj67_404815_c1 3300050509 Bacteria 1101
333 nmdc:mga06r32_106665_c1 3300050510 Bacteria 2753
334 nmdc:mga06r32_235614_c1 3300050510 Bacteria 1818
335 nmdc:mga06r32_3041_c1 3300050510 Bacteria 15019
336 nmdc:mga06r32_60536_c1 3300050510 Bacteria 3644
337 nmdc:mga0n895_489046_c1 3300050512 Bacteria 1240
338 nmdc:mga0sz30_156623_c1 3300050516 Bacteria 1009
339 nmdc:mga0sz30_20933_c2 3300050516 Bacteria 2152
340 Ga0500578_0132191 3300053086 Bacteria 1564
341 Ga0500583_0047987 3300053092 Bacteria 1969
342 Ga0500569_008517 3300053109 Bacteria 2348
343 Ga0500642_0012171 3300053130 Bacteria 3109
344 Ga0500658_0000577 3300053134 Bacteria 15447
345 Ga0500559_0008682 3300053136 Bacteria 4440
346 Ga0500559_0035897 3300053136 Bacteria 2142
347 Ga0500604_0017147 3300053151 Bacteria 2000
348 Ga0500616_0016033 3300053153 Bacteria 4275
349 Ga0500634_0016841 3300053161 Bacteria 3906
350 Ga0500609_000561 3300053731 Bacteria 5614
351 Ga0501082_0483337 3300060353 Bacteria 1082
352 Ga0530510_0099525 3300061734 Bacteria 2126
353 2509392382 2509276021 Bacteria 7634384
354 2509446682 2509276033 Bacteria 7180565
355 2510133614 2510065019 Bacteria 6903379
356 2510895017 2510461076 Bacteria 8618824
357 2511332915 2511231017 Bacteria 6503007
358 2511503632 2511231052 Bacteria 6974333
359 2513573872 2513237084 Bacteria 7231967
360 2513577588 2513237085 Bacteria 7695351
361 2513629767 2513237093 Bacteria 7545552
362 2513708406 2513237103 Bacteria 7647401
363 2514022457 2513237162 Bacteria 7468464
364 2515112608 2515075009 Bacteria 7288508
365 2515634227 2515154113 Bacteria 7807172
366 2515640101 2515154114 Bacteria 7848616
367 2515655704 2515154116 Bacteria 7552979
368 2515740154 2515154134 Bacteria 7220242
369 2517036341 2516653077 Bacteria 7555578
370 2517076719 2516653085 Bacteria 7346596
371 2517095473 2517093000 Bacteria 7412387
372 2517407057 2517287029 Bacteria 6905599
373 2530645789 2529292951 Bacteria 6916614
374 2551696334 2551306086 Bacteria 6843938
375 2551711976 2551306089 Bacteria 7162724
376 2551719058 2551306090 Bacteria 7953713
377 2551732886 2551306092 Bacteria 6992595
378 2585527095 2585427526 Bacteria 7258840
379 2585537844 2585427528 Bacteria 6842387
380 2585835793 2585427593 Bacteria 7141551
381 2616292234 2615840624 Bacteria 6557588
382 2644227550 2643221640 Bacteria 5258820
383 2644236932 2643221642 Bacteria 5357871
384 2644747837 2643221736 Bacteria 6608466
385 2719181517 2718217882 Bacteria 6556348
386 2719386028 2718217927 Bacteria 6972593
387 2719665841 2718217997 Bacteria 6740740
388 2719732181 2718218009 Bacteria 6478651
389 2720492261 2718218199 Bacteria 6740745
390 2720613616 2718218232 Bacteria 6720332
391 2720620399 2718218233 Bacteria 6662049
392 2720631824 2718218235 Bacteria 6630699
393 2720775552 2718218269 Bacteria 6906114
394 2721147609 2718218363 Bacteria 6524337
395 2721159053 2718218365 Bacteria 6274507
396 2721164444 2718218366 Bacteria 6425255
397 2721399808 2718218423 Bacteria 6438183
398 2722840614 2721755514 Bacteria 6424414
399 2723027169 2721755556 Bacteria 6745503
400 2723560781 2721755684 Bacteria 6859907
401 2723567371 2721755685 Bacteria 6704835
402 2724038621 2721755809 Bacteria 6438790
403 2724044937 2721755810 Bacteria 6479005
404 2724090159 2721755819 Bacteria 6906405
405 2724104636 2721755822 Bacteria 6726041
406 2724110448 2721755823 Bacteria 6752556
407 2725947981 2724679232 Bacteria 7646494
408 2730108105 2728369352 Bacteria 6745171
409 2730164752 2728369365 Bacteria 6555560
410 2730298685 2728369397 Bacteria 6274511
411 2739032500 2738541333 Bacteria 7106503
412 2766066823 2765235942 Bacteria 7445910
413 2793294927 2791355256 Bacteria 6798008
414 2793312507 2791355259 Bacteria 7254731
415 2793323041 2791355260 Bacteria 6598818
416 2793329048 2791355261 Bacteria 6661293
417 2793337253 2791355262 Bacteria 6774204
418 2793344074 2791355263 Bacteria 6872478
419 2793349874 2791355264 Bacteria 6429314
420 2793357067 2791355265 Bacteria 6539969
421 2793360658 2791355266 Bacteria 7116587
422 2793367034 2791355267 Bacteria 7222458
423 2805925943 2802429605 Bacteria 6875453
424 2805938290 2802429606 Bacteria 6346811
425 2806043475 2802429633 Bacteria 7341974
426 2806050593 2802429634 Bacteria 7083200
427 2806057410 2802429635 Bacteria 7650140
428 2806064789 2802429636 Bacteria 7597525
429 2806072056 2802429637 Bacteria 7067217
430 2838017966 2838016132 Bacteria 6577831
431 2838026172 2838022645 Bacteria 6494267
432 2838043681 2838042994 Bacteria 6046894
433 2838051731 2838048938 Bacteria 6044578
434 2838066156 2838061910 Bacteria 6794874
435 2838074449 2838068647 Bacteria 6208656
436 2838673611 2838668709 Bacteria 6671819
437 2838681927 2838680041 Bacteria 6545511
438 2838687407 2838686498 Bacteria 7807632
439 2838696497 2838694306 Bacteria 6853137
440 2838706007 2838701080 Bacteria 6669771
441 2838710262 2838707686 Bacteria 6619912
442 2838736197 2838729681 Bacteria 7400765
443 2838749016 2838742623 Bacteria 7396178
444 2841858660 2841851746 Bacteria 7532261
445 2841870708 2841864319 Bacteria 6742987
446 2842078437 2842077413 Bacteria 6508645
447 2842114091 2842110456 Bacteria 7656360
448 2842119054 2842118031 Bacteria 7033875
449 2842150859 2842146304 Bacteria 5957337
450 2842157109 2842156927 Bacteria 6894975
451 2842167766 2842163707 Bacteria 6916235
452 2842181307 2842180545 Bacteria 6888678
453 2842194262 2842192696 Bacteria 6147454
454 2842201895 2842198810 Bacteria 6608673
455 2842205787 2842205361 Bacteria 6340321
456 2842217565 2842217011 Bacteria 7497767
457 2842230641 2842229732 Bacteria 7475766
458 2842239674 2842237096 Bacteria 6620661
459 2842249919 2842243621 Bacteria 7421798
460 2842255821 2842250916 Bacteria 6579627
461 2842263926 2842257432 Bacteria 7401195
462 2842265802 2842264693 Bacteria 6472963
463 2842271054 2842271015 Bacteria 7807131
464 2842279244 2842278818 Bacteria 6340002
465 2842285889 2842285085 Bacteria 6011953
466 2842292099 2842291075 Bacteria 7076806
467 2842304684 2842304105 Bacteria 7023636
468 2842314491 2842311132 Bacteria 6616990
469 2842322936 2842317721 Bacteria 6793725
470 2842345376 2842341865 Bacteria 7003929
471 2842364830 2842363717 Bacteria 6844742
472 2842372492 2842370503 Bacteria 7038661
473 2842378495 2842377471 Bacteria 7140707
474 2842385564 2842384541 Bacteria 7057858
475 2842398944 2842395702 Bacteria 6780583
476 2842403248 2842402390 Bacteria 6681310
477 2842409379 2842409023 Bacteria 6687331
478 2842416032 2842415677 Bacteria 6596907
479 2842428174 2842422224 Bacteria 6239196
480 2842429561 2842428310 Bacteria 6767288
481 2842436174 2842434925 Bacteria 6502746
482 2842442521 2842441272 Bacteria 6769273
483 2842454352 2842447887 Bacteria 6754142
484 2842463982 2842462802 Bacteria 6588055
485 2842470503 2842469257 Bacteria 6752936
486 2842490274 2842489311 Bacteria 6620893
487 2842495930 2842495871 Bacteria 6820686
488 2844458777 2844454524 Bacteria 7952546
489 2855831147 2855825444 Bacteria 6785811
490 2857520088 2857516855 Bacteria 7787325
491 2884964730 2884960567 Bacteria 5437054
492 2916009132 2916007675 Bacteria 6898660
493 2916015862 2916014648 Bacteria 6946486
494 2921238305 2921237296 Bacteria 6876710
495 2921303938 2921296804 Bacteria 7176999
496 2924165195 2924158325 Bacteria 7188855
497 2924186162 2924179722 Bacteria 6843264
498 2928531736 2928531327 Bacteria 5101314
499 2933571957 2933570622 Bacteria 7023390
500 2933590187 2933586486 Bacteria 7667493
501 2933604905 2933599457 Bacteria 5858799
502 2935897646 2935894831 Bacteria 6620579
503 2935905375 2935901341 Bacteria 7341747
504 2936372408 2936367885 Bacteria 7324495
505 2936380790 2936375103 Bacteria 6652732
506 2936387555 2936381700 Bacteria 7006523
507 2937003478 2937002841 Bacteria 6934057
508 2937065565 2937063883 Bacteria 7199456
509 2937099783 2937098957 Bacteria 7249374
510 2946790732 2946787523 Bacteria 4366789
511 2957394630 2957388812 Bacteria 6778072
512 2957430418 2957430029 Bacteria 7022557
513 2957472528 2957471148 Bacteria 6797643
514 2957499293 2957498199 Bacteria 7126688
515 2960604987 2960603979 Bacteria 6898737
516 2960625421 2960624210 Bacteria 6875384
517 2964630206 2964628898 Bacteria 7083044
518 2964679965 2964678106 Bacteria 6792020
519 2967679733 2967678726 Bacteria 7264382
520 2967699477 2967693043 Bacteria 6804451
521 2967763341 2967762386 Bacteria 6923502
522 2970020689 2970019648 Bacteria 7072033
523 2970048579 2970047711 Bacteria 7088379
524 2970062856 2970061556 Bacteria 7099761
525 2970096640 2970095765 Bacteria 6936963
526 2970116232 2970109326 Bacteria 6863976
527 2970135540 2970129317 Bacteria 6806560
528 2970156779 2970149975 Bacteria 6779706
529 2970171670 2970170962 Bacteria 6876229
530 2977544284 2977537788 Bacteria 6929320
531 2977558612 2977551784 Bacteria 7125765
532 2977579553 2977572785 Bacteria 6763888
533 2996898521 2996893221 Bacteria 5823108
534 639648845 639633055 Bacteria 7751309
535 8005280813 8005275841 Bacteria 6929066
536 8005286534 8005282627 Bacteria 6675747
537 8005293334 8005289223 Bacteria 6634003
538 8005302806 8005301065 Bacteria 6614431
539 8005312475 8005307578 Bacteria 7395396
540 8005379515 8005376324 Bacteria 6590079
541 8005385596 8005382845 Bacteria 6732062
542 8005396491 8005395548 Bacteria 6806915
543 8005431670 8005430974 Bacteria 6689030
544 8005463281 8005460587 Bacteria 7157962
545 8005500575 8005497431 Bacteria 6477605
546 8005557394 8005556819 Bacteria 6908598
547 8005566069 8005563573 Bacteria 7153261
548 8005574557 8005570704 Bacteria 6957481
549 8005621955 8005619151 Bacteria 7030230
550 8005627191 8005626139 Bacteria 6534237
551 8005671993 8005668836 Bacteria 6953162
552 8005689990 8005688590 Bacteria 6610080
553 8005696591 8005695170 Bacteria 6912330
554 8018130163 8018127388 Bacteria 7351159
555 8018166478 8018163183 Bacteria 7277977
556 8018178772 8018176218 Bacteria 6896178
557 8023685075 8023680758 Bacteria 7729763
558 8024483235 8024479707 Bacteria 6954785
559 8024501390 8024501048 Bacteria 6427847
560 8046773028 8046767195 Bacteria 7547379
561 8056376871 8056375014 Bacteria 7006639
562 8056388095 8056382006 Bacteria 6408074
563 8057874727 8057874678 Bacteria 7494653
564 Ga0075368_10045259
565 JGI24735J21928_10000432
566 JGI25152J39213_1000546
567 JGI25151J46595_10003368
568 JGI25153J46596_10009788
569 JGI25153J46596_10020726
570 JGI25153J46596_10024070
571 JGI25160J50197_1029341
572 JGI25161J50226_1008342
573 JGI25404J52841_10000657
574 Ga0055533_1000826
575 Ga0055524_1032680
576 Ga0055524_1046466
577 Ga0055536_1010719
578 Ga0055528_1000114
579 Ga0055528_1000167
580 Ga0055528_1015534
581 Ga0055528_1020507
582 Ga0055530_10000177
583 Ga0055540_1000169
584 Ga0055531_10000305
585 Ga0065165_1002117
586 Ga0065714_10064907
587 Ga0068869_100046101
588 Ga0070675_100087485
589 Ga0070675_100436592
590 Ga0070673_100221899
591 Ga0070688_100091418
592 Ga0070700_100016498
593 Ga0070694_100032347
594 Ga0070708_100052322
595 Ga0070706_100003164
596 Ga0070706_100022313
597 Ga0070707_100033262
598 Ga0070698_100001031
599 Ga0070698_100018421
600 Ga0070698_100047220
601 Ga0070698_100262982
602 Ga0070699_100017215
603 Ga0070699_100084131
604 Ga0070697_100016196
605 Ga0070697_100078159
606 Ga0068853_100132259
607 Ga0070704_100031807
608 Ga0068859_100366627
609 Ga0068870_10093394
610 Ga0068862_100006343
611 Ga0081455_10000881
612 Ga0081539_10009656
613 Ga0070717_10041448
614 Ga0075365_10051574
615 Ga0075363_100028382
616 Ga0075363_100092777
617 Ga0075364_10175597
618 Ga0075362_10002333
619 Ga0075362_10026185
620 Ga0075367_10003748
621 Ga0075367_10019831
622 Ga0075369_10033302
623 Ga0075369_10035994
624 Ga0075366_10017393
625 Ga0075366_10036487
626 Ga0075366_10048010
627 Ga0075370_10049883
628 Ga0075370_10178352
629 Ga0075428_100596584
630 Ga0075430_100055604
631 Ga0075430_100265950
632 Ga0075431_100035919
633 Ga0075431_100315667
634 Ga0075433_10323692
635 Ga0075434_100450806
636 Ga0075436_100025527
637 Ga0097620_100366580
638 Ga0079104_1007009
639 Ga0105250_10016774
640 Ga0105240_10331732
641 Ga0105247_10202073
642 Ga0114129_10623266
643 Ga0105242_10078460
644 Ga0105237_10520469
645 Ga0105249_10677431
646 Ga0123341_1000013
647 Ga0123342_1024412
648 Ga0105239_10290111
649 Ga0157370_10001147
650 Ga0157369_10253398
651 Ga0157378_10589075
652 Ga0163162_10177895
653 Ga0157372_10252025
654 Ga0163163_10659514
655 Ga0157376_10487834
656 Ga0183368_1004
657 Ga0183360_10555
658 Ga0183363_1029
659 Ga0228711_1005756
660 Ga0228710_1005951
661 Ga0209129_1000250
662 Ga0209129_1002082
663 Ga0209673_1000013
664 Ga0209673_1000385
665 Ga0209673_1000522
666 Ga0209675_1000097
667 Ga0209676_1000175
668 Ga0209676_1038801
669 Ga0209025_1000172
670 Ga0209025_1001166
671 Ga0209025_1017908
672 Ga0209564_1000118
673 Ga0209564_1000264
674 Ga0209564_1016816
675 Ga0209758_1000005
676 Ga0209758_1003856
677 Ga0209758_1012304
678 Ga0209050_1000492
679 Ga0209050_1002815
680 Ga0209256_1000160
681 Ga0209256_1000369
682 Ga0207426_1000039
683 Ga0207426_1000479
684 Ga0209051_1000418
685 Ga0209051_1000602
686 Ga0209051_1009776
687 Ga0209051_1009869
688 Ga0209257_1000583
689 Ga0209257_1002124
690 Ga0209257_1004886
691 Ga0207688_10231610
692 Ga0207647_10028858
693 Ga0207645_10196780
694 Ga0207684_10002722
695 Ga0207684_10004018
696 Ga0207684_10008101
697 Ga0207684_10216347
698 Ga0207663_10018162
699 Ga0207663_10040981
700 Ga0207660_10280408
701 Ga0207652_10022321
702 Ga0207646_10024829
703 Ga0207681_10171367
704 Ga0207650_10075962
705 Ga0207659_10037178
706 Ga0207700_10226662
707 Ga0207700_10503048
708 Ga0207706_10074257
709 Ga0207709_10424867
710 Ga0207691_10055656
711 Ga0207668_10216025
712 Ga0207708_10029295
713 Ga0207675_100021889
714 Ga0207683_10400696
715 Ga0209281_1006860
716 Ga0209969_1002720
717 Ga0209999_1005976
718 Ga0209971_1000012
719 Ga0209966_1002561
720 Ga0209998_10000459
721 Ga0268265_10004471
722 Ga0268265_10366481
723 Ga0265319_1037721
724 Ga0265338_10002633
725 Ga0265338_10003473
726 Ga0265762_1001193
727 Ga0265760_10017357
728 Ga0265328_10033545
729 Ga0265320_10002805
730 Ga0265325_10113815
731 Ga0265339_10003904
732 Ga0265339_10006350
733 Ga0265331_10042089
734 Ga0265316_10009807
735 Ga0265314_10001670
736 Ga0265342_10001811
737 Ga0265342_10176413
738 Ga0307516_10191012
739 Ga0307413_10036223
740 Ga0307413_10293215
741 Ga0307410_10020065
742 Ga0307407_10291642
743 Ga0307412_10059117
744 Ga0307409_100013124
745 Ga0307411_10013600
746 Ga0373937_0548113
747 Ga0395905_0005888
748 Ga0395905_0180846
749 Ga0436360_0304671
750 Ga0436363_0735710
751 Ga0439436_0004180
752 Ga0439438_004488
753 Ga0439447_001409
754 Ga0439453_0000926
755 Ga0439466_0000602
756 Ga0439465_0009084
757 Ga0451791_1195474
758 Ga0451806_115708
759 Ga0451807_2030052
760 Ga0451833_0218675
761 Ga0451833_1111154
762 Ga0451835_1123733
763 Ga0451837_1649472
764 Ga0451839_0147971
765 Ga0451841_0388975
766 Ga0451841_1258288
767 Ga0451845_0247088
768 Ga0451847_0031488
769 Ga0451847_0518925
770 Ga0451849_0224329
771 Ga0451849_1342573
772 Ga0451851_1205647
773 Ga0451843_0121327
774 Ga0451843_1740549
775 Ga0451855_0495296
776 Ga0451853_0630583
777 Ga0439448_0016210
778 Ga0439448_0087372
779 Ga0439432_040417
780 Ga0439451_024771
781 Ga0439452_002248
782 Ga0439454_005559
783 Ga0439456_040666
784 Ga0439463_014991
785 Ga0439446_0006738
786 Ga0439464_0013264
787 Ga0439460_0009613
788 Ga0450901_003585
789 Ga0451577_0252852
790 Ga0453683_0027937
791 Ga0453684_0293125
792 Ga0451576_0053954
793 Ga0451576_0061600
794 Ga0495617_000221
795 Ga0495627_027808
796 Ga0495603_0028359
797 Ga0495638_0000073
798 Ga0495638_0030838
799 Ga0495638_0074734
800 Ga0495580_0075093
801 Ga0495605_0058383
802 Ga0495639_0056935
803 Ga0495584_0135989
804 Ga0495585_0018099
805 Ga0495594_0001181
806 Ga0495583_0000087
807 Ga0495583_0076325
808 Ga0495606_0006993
809 Ga0495610_0070744
810 Ga0495620_0014886
811 Ga0495632_0000270
812 Ga0495648_0000049
813 Ga0495648_0000642
814 Ga0495642_0125797
815 Ga0495654_0001044
816 Ga0495654_0019127
817 Ga0495622_0006217
818 Ga0495633_0036746
819 Ga0495668_0013295
820 Ga0495611_0016243
821 Ga0495625_0019775
822 Ga0495625_0025002
823 Ga0495625_0080670
824 Ga0495625_0120028
825 Ga0495670_0004850
826 Ga0495671_0000042
827 Ga0495671_0073469
828 Ga0495660_0003279
829 Ga0495636_0043904
830 Ga0495672_0005190
831 Ga0495683_0023726
832 Ga0495687_000222
833 Ga0495687_000377
834 Ga0495687_009383
835 Ga0495687_066982
836 Ga0495685_057461
837 Ga0495673_0000111
838 Ga0495673_0070554
839 Ga0495686_0008763
840 Ga0496102_0181347
841 Ga0496103_0175269
842 Ga0496104_0820360
843 Ga0496112_0141642
844 Ga0496113_0065925
845 Ga0496115_0000040
846 Ga0496115_0141545
847 Ga0496116_0121026
848 Ga0496117_0133832
849 Ga0496118_0004322
850 Ga0496121_0053365
851 Ga0496122_0011912
852 Ga0496123_0114493
853 Ga0496124_0042423
854 Ga0496124_0217674
855 Ga0496124_0264346
856 Ga0495678_024131
857 Ga0495682_0003159
858 Ga0495682_0008879
859 Ga0501031_0175349
860 Ga0501032_0084778
861 Ga0501033_0005016
862 Ga0501033_0203796
863 Ga0501034_0001197
864 Ga0501037_0187700
865 Ga0501038_0028910
866 Ga0501042_0014740
867 Ga0501043_0014211
868 Ga0501043_0067493
869 Ga0501046_0041742
870 Ga0501047_0071947
871 Ga0501067_0029252
872 Ga0501067_0063209
873 Ga0501070_0277967
874 Ga0501071_0191904
875 Ga0501073_0203333
876 Ga0501076_0256577
877 Ga0501080_0137269
878 Ga0501083_0205151
879 Ga0501035_0186998
880 Ga0501035_0233547
881 Ga0501044_0026836
882 nmdc:mga03683_20419_c1
883 nmdc:mga03683_31349_c1
884 nmdc:mga0k408_49080_c1
885 nmdc:mga0k408_7226_c1
886 nmdc:mga06z11_19277_c1
887 nmdc:mga06z11_66028_c1
888 nmdc:mga06z11_8609_c1
889 nmdc:mga07m45_73469_c1
890 nmdc:mga05p37_325930_c1
891 nmdc:mga05p37_96659_c1
892 nmdc:mga09592_326920_c1
893 nmdc:mga0qj67_30630_c1
894 nmdc:mga0qj67_32867_c1
895 nmdc:mga0qj67_404815_c1
896 nmdc:mga06r32_106665_c1
897 nmdc:mga06r32_235614_c1
898 nmdc:mga06r32_3041_c1
899 nmdc:mga06r32_60536_c1
900 nmdc:mga0n895_489046_c1
901 nmdc:mga0sz30_156623_c1
902 nmdc:mga0sz30_20933_c2
903 Ga0500578_0132191
904 Ga0500583_0047987
905 Ga0500569_008517
906 Ga0500642_0012171
907 Ga0500658_0000577
908 Ga0500559_0008682
909 Ga0500559_0035897
910 Ga0500604_0017147
911 Ga0500616_0016033
912 Ga0500634_0016841
913 Ga0500609_000561
914 Ga0501082_0483337
915 Ga0530510_0099525
916 2509392382
917 2509446682
918 2510133614
919 2510895017
920 2511332915
921 2511503632
922 2513573872
923 2513577588
924 2513629767
925 2513708406
926 2514022457
927 2515112608
928 2515634227
929 2515640101
930 2515655704
931 2515740154
932 2517036341
933 2517076719
934 2517095473
935 2517407057
936 2530645789
937 2551696334
938 2551711976
939 2551719058
940 2551732886
941 2585527095
942 2585537844
943 2585835793
944 2616292234
945 2644227550
946 2644236932
947 2644747837
948 2719181517
949 2719386028
950 2719665841
951 2719732181
952 2720492261
953 2720613616
954 2720620399
955 2720631824
956 2720775552
957 2721147609
958 2721159053
959 2721164444
960 2721399808
961 2722840614
962 2723027169
963 2723560781
964 2723567371
965 2724038621
966 2724044937
967 2724090159
968 2724104636
969 2724110448
970 2725947981
971 2730108105
972 2730164752
973 2730298685
974 2739032500
975 2766066823
976 2793294927
977 2793312507
978 2793323041
979 2793329048
980 2793337253
981 2793344074
982 2793349874
983 2793357067
984 2793360658
985 2793367034
986 2805925943
987 2805938290
988 2806043475
989 2806050593
990 2806057410
991 2806064789
992 2806072056
993 2838017966
994 2838026172
995 2838043681
996 2838051731
997 2838066156
998 2838074449
999 2838673611
1000 2838681927
1001 2838687407
1002 2838696497
1003 2838706007
1004 2838710262
1005 2838736197
1006 2838749016
1007 2841858660
1008 2841870708
1009 2842078437
1010 2842114091
1011 2842119054
1012 2842150859
1013 2842157109
1014 2842167766
1015 2842181307
1016 2842194262
1017 2842201895
1018 2842205787
1019 2842217565
1020 2842230641
1021 2842239674
1022 2842249919
1023 2842255821
1024 2842263926
1025 2842265802
1026 2842271054
1027 2842279244
1028 2842285889
1029 2842292099
1030 2842304684
1031 2842314491
1032 2842322936
1033 2842345376
1034 2842364830
1035 2842372492
1036 2842378495
1037 2842385564
1038 2842398944
1039 2842403248
1040 2842409379
1041 2842416032
1042 2842428174
1043 2842429561
1044 2842436174
1045 2842442521
1046 2842454352
1047 2842463982
1048 2842470503
1049 2842490274
1050 2842495930
1051 2844458777
1052 2855831147
1053 2857520088
1054 2884964730
1055 2916009132
1056 2916015862
1057 2921238305
1058 2921303938
1059 2924165195
1060 2924186162
1061 2928531736
1062 2933571957
1063 2933590187
1064 2933604905
1065 2935897646
1066 2935905375
1067 2936372408
1068 2936380790
1069 2936387555
1070 2937003478
1071 2937065565
1072 2937099783
1073 2946790732
1074 2957394630
1075 2957430418
1076 2957472528
1077 2957499293
1078 2960604987
1079 2960625421
1080 2964630206
1081 2964679965
1082 2967679733
1083 2967699477
1084 2967763341
1085 2970020689
1086 2970048579
1087 2970062856
1088 2970096640
1089 2970116232
1090 2970135540
1091 2970156779
1092 2970171670
1093 2977544284
1094 2977558612
1095 2977579553
1096 2996898521
1097 639648845
1098 8005280813
1099 8005286534
1100 8005293334
1101 8005302806
1102 8005312475
1103 8005379515
1104 8005385596
1105 8005396491
1106 8005431670
1107 8005463281
1108 8005500575
1109 8005557394
1110 8005566069
1111 8005574557
1112 8005621955
1113 8005627191
1114 8005671993
1115 8005689990
1116 8005696591
1117 8018130163
1118 8018166478
1119 8018178772
1120 8023685075
1121 8024483235
1122 8024501390
1123 8046773028
1124 8056376871
1125 8056388095
1126 8057874727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

83

323

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

79

224

0.82

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

85

329

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.9863 2 273
3hi4-assembly2.cif.gz_D switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase 0.9858 2 273
8pi1-assembly1.cif.gz_B bicyclic incypro pseudomonas fluorescens esterase 0.9853 2 273
3ia2-assembly2.cif.gz_D pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog 0.9852 2 273
3t4u-assembly1.cif.gz_A l29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity 0.9852 2 273
ID Description Score Start End Superfamily
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9848 2 273 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9817 3 273 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9813 2 273 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9747 2 273 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9711 3 273 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A087NKY4-F1-model_v4 deleted 0.9902 1 273
AF-E6PXJ0-F1-model_v4 Putative peroxidase/hydrolase 0.9888 1 273 GO:0004601
GO:0016787
AF-A2WIK9-F1-model_v4 deleted 0.9865 1 273
AF-A0A098U7Z1-F1-model_v4 deleted 0.9864 3 273
AF-A0A7U7EG57-F1-model_v4 deleted 0.9863 3 273

Map