F464049

General Info

Members Datasets Scaffolds Average Seq Length
563 240 563 174

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10000248|Ga0157369_1000024852
Length 202
Sequence LSKQSLSICIPQSAIRIADNPNLKGHTMARQPGTYATFDTSEGQIVCRLFEKEAPKTVKNFIDLAEGKRDWQDHVSGKKGPGPLYSGTIFHRVIPNFMIQGGDPSGTGMGGPGYKFEDETKGSPHKFDKAGKLAMANAGPNTNGSQFFITVAATDWLTGNHTIFGEVVEGQDVVDKITKLPRGAQDRPKKDIVLNSVKIEKT

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 2.84
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11760255 3300004799 Bacteria 832
2 Ga0065715_10023042 3300005293 Bacteria 1880
3 Ga0070658_10052670 3300005327 Bacteria 3301
4 Ga0070658_10213561 3300005327 Bacteria 1630
5 Ga0070683_100041067 3300005329 Bacteria 4254
6 Ga0070683_100044167 3300005329 Bacteria 4109
7 Ga0070683_100124525 3300005329 Bacteria 2436
8 Ga0070683_100142571 3300005329 Bacteria 2270
9 Ga0070683_100664148 3300005329 Bacteria 998
10 Ga0070690_100986583 3300005330 Bacteria 663
11 Ga0070677_10217253 3300005333 Bacteria 932
12 Ga0068869_100003590 3300005334 Bacteria 9518
13 Ga0068869_100223214 3300005334 Bacteria 1494
14 Ga0070666_10313863 3300005335 Bacteria 1117
15 Ga0070680_100128165 3300005336 Bacteria 2121
16 Ga0070680_101208146 3300005336 Bacteria 654
17 Ga0068868_100072804 3300005338 Bacteria 2742
18 Ga0068868_100452295 3300005338 Bacteria 1117
19 Ga0068868_100968659 3300005338 Bacteria 777
20 Ga0070660_100013843 3300005339 Bacteria 5802
21 Ga0070660_100081752 3300005339 Bacteria 2536
22 Ga0070687_100074260 3300005343 Unclassified 1835
23 Ga0070661_100033066 3300005344 Bacteria 3745
24 Ga0070661_100121768 3300005344 Bacteria 1955
25 Ga0070661_100655736 3300005344 Unclassified 852
26 Ga0070671_100134777 3300005355 Bacteria 2082
27 Ga0070673_100462759 3300005364 Bacteria 1142
28 Ga0070659_100211219 3300005366 Bacteria 1599
29 Ga0070659_100637659 3300005366 Unclassified 918
30 Ga0070667_100541729 3300005367 Bacteria 1069
31 Ga0070667_100707334 3300005367 Bacteria 932
32 Ga0070709_10003110 3300005434 Bacteria 8906
33 Ga0070709_10004804 3300005434 Bacteria 7301
34 Ga0070709_10715669 3300005434 Bacteria 780
35 Ga0070714_100001256 3300005435 Bacteria 18317
36 Ga0070714_100012151 3300005435 Bacteria 6860
37 Ga0070714_100051603 3300005435 Bacteria 3507
38 Ga0070714_100053026 3300005435 Bacteria 3460
39 Ga0070714_100136287 3300005435 Bacteria 2199
40 Ga0070714_100264310 3300005435 Unclassified 1594
41 Ga0070714_100395861 3300005435 Bacteria 1305
42 Ga0070714_100707075 3300005435 Bacteria 972
43 Ga0070714_101098546 3300005435 Bacteria 775
44 Ga0070713_100000561 3300005436 Bacteria 23535
45 Ga0070713_100003423 3300005436 Bacteria 10477
46 Ga0070713_100006965 3300005436 Bacteria 7892
47 Ga0070713_100194076 3300005436 Bacteria 1831
48 Ga0070713_100232070 3300005436 Bacteria 1678
49 Ga0070713_100369943 3300005436 Bacteria 1333
50 Ga0070713_100382192 3300005436 Bacteria 1312
51 Ga0070713_100475369 3300005436 Bacteria 1177
52 Ga0070713_101459654 3300005436 Bacteria 664
53 Ga0070710_10092133 3300005437 Bacteria 1789
54 Ga0070710_10155662 3300005437 Bacteria 1413
55 Ga0070710_10171162 3300005437 Bacteria 1353
56 Ga0070710_10320596 3300005437 Bacteria 1017
57 Ga0070711_100015990 3300005439 Bacteria 4756
58 Ga0070711_100050824 3300005439 Bacteria 2844
59 Ga0070711_100274139 3300005439 Bacteria 1332
60 Ga0070708_100023076 3300005445 Bacteria 5284
61 Ga0070708_100118735 3300005445 Bacteria 2437
62 Ga0070708_100217505 3300005445 Bacteria 1791
63 Ga0070708_100341472 3300005445 Bacteria 1411
64 Ga0070708_100586325 3300005445 Bacteria 1051
65 Ga0070663_100264861 3300005455 Bacteria 1364
66 Ga0070678_100336646 3300005456 Bacteria 1293
67 Ga0070681_10009675 3300005458 Bacteria 9483
68 Ga0070681_10034238 3300005458 Bacteria 5101
69 Ga0070681_10519452 3300005458 Bacteria 1104
70 Ga0070685_10631073 3300005466 Unclassified 774
71 Ga0070685_10751522 3300005466 Bacteria 715
72 Ga0070706_100007211 3300005467 Bacteria 10448
73 Ga0070706_100009023 3300005467 Bacteria 9285
74 Ga0070706_100063107 3300005467 Bacteria 3424
75 Ga0070706_100500873 3300005467 Bacteria 1130
76 Ga0070707_100008857 3300005468 Bacteria 9329
77 Ga0070707_100135932 3300005468 Bacteria 2391
78 Ga0070707_100227823 3300005468 Bacteria 1815
79 Ga0070707_100745583 3300005468 Bacteria 943
80 Ga0070698_100004977 3300005471 Bacteria 14557
81 Ga0070698_100118463 3300005471 Bacteria 2609
82 Ga0070699_100001625 3300005518 Bacteria 20496
83 Ga0070699_100063586 3300005518 Bacteria 3200
84 Ga0070699_100281766 3300005518 Bacteria 1489
85 Ga0070699_100748162 3300005518 Bacteria 894
86 Ga0070679_100037623 3300005530 Bacteria 4808
87 Ga0070679_100103655 3300005530 Bacteria 2831
88 Ga0070679_100170881 3300005530 Bacteria 2147
89 Ga0070679_100845831 3300005530 Bacteria 858
90 Ga0070684_100005011 3300005535 Bacteria 10119
91 Ga0070684_100074079 3300005535 Bacteria 3001
92 Ga0070684_100085594 3300005535 Bacteria 2796
93 Ga0070684_100148999 3300005535 Bacteria 2119
94 Ga0070684_100287124 3300005535 Bacteria 1508
95 Ga0070697_100000145 3300005536 Bacteria 57445
96 Ga0070697_100001728 3300005536 Bacteria 16681
97 Ga0070697_100539721 3300005536 Bacteria 1022
98 Ga0068853_100133607 3300005539 Bacteria 2223
99 Ga0068853_100491666 3300005539 Bacteria 1157
100 Ga0070695_100109964 3300005545 Bacteria 1869
101 Ga0070695_100181055 3300005545 Bacteria 1493
102 Ga0070695_100655016 3300005545 Bacteria 829
103 Ga0070695_100705510 3300005545 Bacteria 801
104 Ga0070696_100556965 3300005546 Unclassified 919
105 Ga0070693_100030451 3300005547 Bacteria 2950
106 Ga0070693_100402711 3300005547 Bacteria 949
107 Ga0070704_100821867 3300005549 Bacteria 831
108 Ga0068855_100001957 3300005563 Bacteria 25569
109 Ga0068855_100016701 3300005563 Bacteria 8827
110 Ga0068855_100109727 3300005563 Bacteria 3168
111 Ga0068855_100256147 3300005563 Bacteria 1951
112 Ga0068855_101008255 3300005563 Bacteria 874
113 Ga0068855_101266266 3300005563 Bacteria 764
114 Ga0070664_100056564 3300005564 Bacteria 3333
115 Ga0070664_100282504 3300005564 Bacteria 1497
116 Ga0070664_101772964 3300005564 Bacteria 585
117 Ga0068857_100001479 3300005577 Bacteria 18696
118 Ga0068857_100171493 3300005577 Bacteria 1972
119 Ga0068854_100007558 3300005578 Bacteria 6948
120 Ga0068854_100014538 3300005578 Bacteria 5192
121 Ga0068854_100034605 3300005578 Bacteria 3530
122 Ga0068854_100041415 3300005578 Bacteria 3254
123 Ga0068854_101474524 3300005578 Bacteria 617
124 Ga0068856_100002269 3300005614 Bacteria 19838
125 Ga0068856_100004334 3300005614 Bacteria 14150
126 Ga0068856_100075564 3300005614 Bacteria 3337
127 Ga0068856_100076832 3300005614 Bacteria 3308
128 Ga0068856_100183604 3300005614 Bacteria 2105
129 Ga0068856_100233363 3300005614 Bacteria 1855
130 Ga0068856_100304661 3300005614 Bacteria 1611
131 Ga0068856_100345122 3300005614 Bacteria 1507
132 Ga0068856_100439639 3300005614 Bacteria 1325
133 Ga0070702_100193166 3300005615 Unclassified 1341
134 Ga0068852_100148767 3300005616 Bacteria 2175
135 Ga0068852_100170184 3300005616 Bacteria 2041
136 Ga0068852_100180806 3300005616 Bacteria 1983
137 Ga0068852_100183502 3300005616 Bacteria 1969
138 Ga0068864_100007060 3300005618 Bacteria 9222
139 Ga0068864_100100058 3300005618 Bacteria 2569
140 Ga0068866_10060626 3300005718 Unclassified 1962
141 Ga0068866_10091952 3300005718 Bacteria 1654
142 Ga0068851_10002574 3300005834 Bacteria 7980
143 Ga0068851_10065600 3300005834 Bacteria 1869
144 Ga0068870_10063990 3300005840 Bacteria 1985
145 Ga0068863_100099970 3300005841 Bacteria 2756
146 Ga0068858_100004940 3300005842 Bacteria 13064
147 Ga0068858_100057600 3300005842 Bacteria 3591
148 Ga0068858_100091600 3300005842 Bacteria 2830
149 Ga0068858_100189314 3300005842 Bacteria 1944
150 Ga0068858_100640560 3300005842 Bacteria 1032
151 Ga0068860_100068668 3300005843 Bacteria 3368
152 Ga0068862_100110109 3300005844 Bacteria 2417
153 Ga0070717_10014604 3300006028 Bacteria 6047
154 Ga0070717_10034560 3300006028 Bacteria 4087
155 Ga0070717_10122066 3300006028 Bacteria 2233
156 Ga0070717_10187238 3300006028 Bacteria 1807
157 Ga0070717_10385599 3300006028 Bacteria 1257
158 Ga0070717_10571232 3300006028 Bacteria 1025
159 Ga0070717_11045725 3300006028 Bacteria 744
160 Ga0075364_10639439 3300006051 Bacteria 727
161 Ga0070716_100001403 3300006173 Bacteria 10679
162 Ga0070716_100182815 3300006173 Bacteria 1378
163 Ga0070716_100185412 3300006173 Bacteria 1370
164 Ga0070716_100190027 3300006173 Bacteria 1356
165 Ga0070712_100002903 3300006175 Bacteria 10625
166 Ga0070712_100031245 3300006175 Bacteria 3585
167 Ga0070712_100121046 3300006175 Bacteria 1969
168 Ga0070712_100182307 3300006175 Unclassified 1637
169 Ga0070712_100234831 3300006175 Bacteria 1458
170 Ga0070712_100961830 3300006175 Bacteria 738
171 Ga0070712_101401488 3300006175 Bacteria 610
172 Ga0097621_100011526 3300006237 Bacteria 6514
173 Ga0097621_100020441 3300006237 Bacteria 5102
174 Ga0097621_100053947 3300006237 Bacteria 3277
175 Ga0097621_100208487 3300006237 Bacteria 1699
176 Ga0097621_100339171 3300006237 Bacteria 1334
177 Ga0097621_100402432 3300006237 Bacteria 1226
178 Ga0068871_100000307 3300006358 Bacteria 34112
179 Ga0068871_100000339 3300006358 Bacteria 32397
180 Ga0068871_100379024 3300006358 Bacteria 1256
181 Ga0075428_100032787 3300006844 Bacteria 5736
182 Ga0075430_100360252 3300006846 Bacteria 1201
183 Ga0075431_100220497 3300006847 Bacteria 1935
184 Ga0075434_100200928 3300006871 Bacteria 2013
185 Ga0075434_100318789 3300006871 Bacteria 1575
186 Ga0075434_101182740 3300006871 Bacteria 777
187 Ga0075429_100053455 3300006880 Bacteria 3514
188 Ga0075429_100247864 3300006880 Bacteria 1560
189 Ga0068865_100419410 3300006881 Bacteria 1100
190 Ga0075436_100005040 3300006914 Bacteria 9083
191 Ga0075436_100034148 3300006914 Bacteria 3507
192 Ga0075436_100088630 3300006914 Bacteria 2149
193 Ga0075436_100143793 3300006914 Bacteria 1677
194 Ga0075435_100003987 3300007076 Bacteria 10091
195 Ga0075435_100217413 3300007076 Bacteria 1622
196 Ga0075435_100499857 3300007076 Bacteria 1051
197 Ga0105240_10008591 3300009093 Bacteria 14599
198 Ga0105240_10019287 3300009093 Bacteria 9115
199 Ga0105240_10025122 3300009093 Bacteria 7836
200 Ga0105240_10049516 3300009093 Bacteria 5302
201 Ga0105240_10057142 3300009093 Bacteria 4878
202 Ga0105240_10197102 3300009093 Bacteria 2363
203 Ga0105240_10554107 3300009093 Bacteria 1272
204 Ga0105240_10574038 3300009093 Bacteria 1245
205 Ga0105240_10996832 3300009093 Bacteria 896
206 Ga0111539_10280216 3300009094 Bacteria 1940
207 Ga0111539_11118300 3300009094 Unclassified 915
208 Ga0105245_10002176 3300009098 Bacteria 17754
209 Ga0105245_10082073 3300009098 Unclassified 2948
210 Ga0114129_10055986 3300009147 Bacteria 5526
211 Ga0114129_10518278 3300009147 Bacteria 1555
212 Ga0105241_10000052 3300009174 Bacteria 94908
213 Ga0105241_10043271 3300009174 Bacteria 3411
214 Ga0105241_10045117 3300009174 Bacteria 3343
215 Ga0105241_10121097 3300009174 Bacteria 2107
216 Ga0105241_10328491 3300009174 Bacteria 1321
217 Ga0105241_10425804 3300009174 Bacteria 1169
218 Ga0105242_10011211 3300009176 Bacteria 6888
219 Ga0105242_11095012 3300009176 Bacteria 810
220 Ga0105248_10010903 3300009177 Bacteria 10029
221 Ga0105248_10013443 3300009177 Bacteria 9012
222 Ga0105248_10297618 3300009177 Bacteria 1817
223 Ga0105248_10730083 3300009177 Bacteria 1117
224 Ga0105237_10119543 3300009545 Bacteria 2629
225 Ga0105237_10158463 3300009545 Bacteria 2261
226 Ga0105237_10555077 3300009545 Bacteria 1155
227 Ga0105237_10606168 3300009545 Bacteria 1102
228 Ga0105238_10009357 3300009551 Bacteria 9813
229 Ga0105238_10024062 3300009551 Bacteria 6210
230 Ga0105238_10088247 3300009551 Bacteria 3088
231 Ga0105238_10135659 3300009551 Bacteria 2438
232 Ga0105238_10224053 3300009551 Bacteria 1857
233 Ga0105238_10503203 3300009551 Bacteria 1213
234 Ga0105238_10559157 3300009551 Eukaryota 1149
235 Ga0105249_11328025 3300009553 Bacteria 791
236 Ga0105239_10106363 3300010375 Bacteria 3108
237 Ga0105239_10123172 3300010375 Bacteria 2881
238 Ga0105239_10531590 3300010375 Bacteria 1338
239 Ga0105239_10538097 3300010375 Bacteria 1330
240 Ga0105239_10657279 3300010375 Unclassified 1197
241 Ga0105239_12281567 3300010375 Bacteria 630
242 Ga0105246_10369540 3300011119 Bacteria 1181
243 Ga0157373_10026248 3300013100 Bacteria 4210
244 Ga0157373_10074116 3300013100 Bacteria 2401
245 Ga0157371_10250539 3300013102 Bacteria 1275
246 Ga0157370_10006013 3300013104 Bacteria 13502
247 Ga0157370_10007683 3300013104 Bacteria 11700
248 Ga0157369_10000248 3300013105 Bacteria 74496
249 Ga0157369_10006768 3300013105 Bacteria 13228
250 Ga0157369_10013029 3300013105 Bacteria 9418
251 Ga0157369_10026761 3300013105 Bacteria 6397
252 Ga0157369_10029182 3300013105 Bacteria 6098
253 Ga0157369_10049012 3300013105 Bacteria 4581
254 Ga0157369_10139818 3300013105 Bacteria 2563
255 Ga0157369_10174133 3300013105 Bacteria 2266
256 Ga0157374_10000154 3300013296 Bacteria 63162
257 Ga0157374_10022027 3300013296 Bacteria 5679
258 Ga0157374_10180694 3300013296 Bacteria 2061
259 Ga0157374_10209290 3300013296 Bacteria 1912
260 Ga0157378_10000150 3300013297 Bacteria 65230
261 Ga0157378_10000304 3300013297 Bacteria 47798
262 Ga0163162_10735141 3300013306 Bacteria 1107
263 Ga0163162_11310194 3300013306 Bacteria 823
264 Ga0157372_10000300 3300013307 Bacteria 54975
265 Ga0157372_10000997 3300013307 Bacteria 30906
266 Ga0157372_10009279 3300013307 Bacteria 10463
267 Ga0157372_10017656 3300013307 Bacteria 7657
268 Ga0157372_10019574 3300013307 Bacteria 7296
269 Ga0157372_10024713 3300013307 Bacteria 6530
270 Ga0157372_10032423 3300013307 Bacteria 5729
271 Ga0157372_10033385 3300013307 Bacteria 5652
272 Ga0157372_10119574 3300013307 Bacteria 3024
273 Ga0157372_10170881 3300013307 Bacteria 2515
274 Ga0157372_10309092 3300013307 Bacteria 1840
275 Ga0157372_10339677 3300013307 Bacteria 1749
276 Ga0157372_10686359 3300013307 Bacteria 1192
277 Ga0163163_10118556 3300014325 Bacteria 2679
278 Ga0163163_10165950 3300014325 Bacteria 2254
279 Ga0163163_10208796 3300014325 Bacteria 2001
280 Ga0157380_10007372 3300014326 Bacteria 7809
281 Ga0157380_10221955 3300014326 Bacteria 1691
282 Ga0182008_10070523 3300014497 Bacteria 1719
283 Ga0157377_10478559 3300014745 Bacteria 866
284 Ga0157376_10006505 3300014969 Bacteria 8260
285 Ga0157376_10086957 3300014969 Bacteria 2696
286 Ga0157376_10503378 3300014969 Bacteria 1191
287 Ga0182007_10006014 3300015262 Bacteria 5255
288 Ga0182005_1080866 3300015265 Bacteria 897
289 Ga0197907_10829533 3300020069 Bacteria 894
290 Ga0206350_11567381 3300020080 Bacteria 1179
291 Ga0224712_10095936 3300022467 Bacteria 1250
292 Ga0207656_10032142 3300025321 Bacteria 2178
293 Ga0207656_10183225 3300025321 Bacteria 1006
294 Ga0207692_10080219 3300025898 Bacteria 1743
295 Ga0207692_10141229 3300025898 Bacteria 1370
296 Ga0207692_10145261 3300025898 Bacteria 1353
297 Ga0207642_10001798 3300025899 Bacteria 6631
298 Ga0207642_10323696 3300025899 Bacteria 901
299 Ga0207680_10026904 3300025903 Bacteria 3194
300 Ga0207647_10027128 3300025904 Bacteria 3737
301 Ga0207685_10023264 3300025905 Unclassified 2107
302 Ga0207699_10004141 3300025906 Bacteria 6944
303 Ga0207699_10005666 3300025906 Bacteria 5998
304 Ga0207699_10060875 3300025906 Bacteria 2269
305 Ga0207699_10357543 3300025906 Bacteria 1032
306 Ga0207699_10809648 3300025906 Bacteria 689
307 Ga0207705_10030022 3300025909 Bacteria 3878
308 Ga0207705_10043479 3300025909 Bacteria 3227
309 Ga0207705_10249121 3300025909 Bacteria 1354
310 Ga0207705_10489834 3300025909 Bacteria 954
311 Ga0207684_10002114 3300025910 Bacteria 20371
312 Ga0207684_10085781 3300025910 Bacteria 2681
313 Ga0207684_10185562 3300025910 Bacteria 1793
314 Ga0207654_10000011 3300025911 Bacteria 245470
315 Ga0207654_10047004 3300025911 Bacteria 2464
316 Ga0207654_10311004 3300025911 Bacteria 1074
317 Ga0207654_10345879 3300025911 Bacteria 1023
318 Ga0207654_10771361 3300025911 Unclassified 693
319 Ga0207707_10001986 3300025912 Bacteria 18580
320 Ga0207707_10031615 3300025912 Bacteria 4632
321 Ga0207695_10032249 3300025913 Bacteria 5736
322 Ga0207695_10035120 3300025913 Bacteria 5441
323 Ga0207695_10043270 3300025913 Bacteria 4800
324 Ga0207695_10045564 3300025913 Bacteria 4654
325 Ga0207695_10094055 3300025913 Unclassified 3006
326 Ga0207695_11472545 3300025913 Bacteria 561
327 Ga0207671_10467806 3300025914 Bacteria 1005
328 Ga0207693_10001147 3300025915 Bacteria 23663
329 Ga0207693_10038670 3300025915 Bacteria 3756
330 Ga0207693_10052336 3300025915 Bacteria 3203
331 Ga0207693_10178940 3300025915 Bacteria 1669
332 Ga0207693_10297153 3300025915 Bacteria 1265
333 Ga0207693_10703130 3300025915 Bacteria 783
334 Ga0207663_10015113 3300025916 Bacteria 4251
335 Ga0207663_10170913 3300025916 Bacteria 1544
336 Ga0207663_10398284 3300025916 Bacteria 1052
337 Ga0207660_10369493 3300025917 Bacteria 1152
338 Ga0207662_10118711 3300025918 Unclassified 1657
339 Ga0207662_10131115 3300025918 Unclassified 1580
340 Ga0207657_10000197 3300025919 Bacteria 62537
341 Ga0207657_10013080 3300025919 Bacteria 8156
342 Ga0207649_10588485 3300025920 Unclassified 855
343 Ga0207652_10014706 3300025921 Bacteria 6342
344 Ga0207652_10138644 3300025921 Bacteria 2173
345 Ga0207652_10141593 3300025921 Bacteria 2151
346 Ga0207652_10277105 3300025921 Bacteria 1513
347 Ga0207652_10385502 3300025921 Bacteria 1265
348 Ga0207652_11061878 3300025921 Bacteria 710
349 Ga0207646_10005280 3300025922 Bacteria 13621
350 Ga0207646_10069986 3300025922 Bacteria 3134
351 Ga0207646_10544165 3300025922 Bacteria 1044
352 Ga0207646_10606447 3300025922 Bacteria 982
353 Ga0207646_10647779 3300025922 Bacteria 946
354 Ga0207694_10008091 3300025924 Bacteria 7948
355 Ga0207694_10009653 3300025924 Bacteria 7276
356 Ga0207694_10073436 3300025924 Bacteria 2676
357 Ga0207694_10270238 3300025924 Bacteria 1394
358 Ga0207694_10307972 3300025924 Bacteria 1305
359 Ga0207694_10519720 3300025924 Unclassified 997
360 Ga0207687_10070351 3300025927 Bacteria 2498
361 Ga0207687_10324639 3300025927 Unclassified 1247
362 Ga0207687_10336549 3300025927 Bacteria 1226
363 Ga0207700_10000650 3300025928 Bacteria 20313
364 Ga0207700_10017040 3300025928 Bacteria 4841
365 Ga0207700_10096067 3300025928 Bacteria 2352
366 Ga0207700_10227432 3300025928 Bacteria 1584
367 Ga0207700_10336239 3300025928 Bacteria 1312
368 Ga0207700_10590262 3300025928 Bacteria 988
369 Ga0207700_10874691 3300025928 Bacteria 804
370 Ga0207664_10012965 3300025929 Bacteria 5973
371 Ga0207664_10022896 3300025929 Bacteria 4673
372 Ga0207664_10153315 3300025929 Bacteria 1959
373 Ga0207664_10231318 3300025929 Unclassified 1607
374 Ga0207664_10412994 3300025929 Bacteria 1202
375 Ga0207644_10086418 3300025931 Bacteria 2329
376 Ga0207706_10096751 3300025933 Bacteria 2596
377 Ga0207686_10011425 3300025934 Bacteria 4862
378 Ga0207669_10101701 3300025937 Bacteria 1902
379 Ga0207665_10052713 3300025939 Bacteria 2741
380 Ga0207665_10184792 3300025939 Bacteria 1511
381 Ga0207711_10161154 3300025941 Bacteria 2030
382 Ga0207689_10001515 3300025942 Bacteria 22101
383 Ga0207689_10172961 3300025942 Bacteria 1781
384 Ga0207661_10199265 3300025944 Bacteria 1759
385 Ga0207661_10210480 3300025944 Bacteria 1713
386 Ga0207661_10491536 3300025944 Bacteria 1121
387 Ga0207679_10126953 3300025945 Bacteria 2040
388 Ga0207679_11167425 3300025945 Bacteria 706
389 Ga0207679_11321839 3300025945 Bacteria 661
390 Ga0207667_10000256 3300025949 Bacteria 74992
391 Ga0207667_10000811 3300025949 Bacteria 40517
392 Ga0207667_10019229 3300025949 Bacteria 7635
393 Ga0207667_10021293 3300025949 Bacteria 7186
394 Ga0207667_10681397 3300025949 Bacteria 1031
395 Ga0207667_10803690 3300025949 Bacteria 937
396 Ga0207667_11219837 3300025949 Bacteria 731
397 Ga0207651_10156959 3300025960 Bacteria 1779
398 Ga0207640_10031625 3300025981 Bacteria 3272
399 Ga0207640_10089179 3300025981 Bacteria 2131
400 Ga0207640_10202151 3300025981 Bacteria 1506
401 Ga0207658_10311026 3300025986 Bacteria 1361
402 Ga0207677_10022484 3300026023 Bacteria 3876
403 Ga0207677_10131606 3300026023 Bacteria 1900
404 Ga0207677_10498317 3300026023 Bacteria 1052
405 Ga0207703_10025243 3300026035 Bacteria 4674
406 Ga0207703_10066459 3300026035 Bacteria 2966
407 Ga0207639_10533201 3300026041 Bacteria 1076
408 Ga0207639_10548288 3300026041 Bacteria 1061
409 Ga0207678_10143247 3300026067 Bacteria 2040
410 Ga0207702_10003463 3300026078 Bacteria 14386
411 Ga0207702_10018636 3300026078 Bacteria 5743
412 Ga0207702_10037024 3300026078 Bacteria 4082
413 Ga0207702_10056413 3300026078 Bacteria 3335
414 Ga0207702_10063092 3300026078 Bacteria 3168
415 Ga0207702_10137858 3300026078 Bacteria 2204
416 Ga0207702_10146734 3300026078 Bacteria 2142
417 Ga0207702_10704614 3300026078 Bacteria 995
418 Ga0207702_10811390 3300026078 Bacteria 925
419 Ga0207702_11684322 3300026078 Bacteria 627
420 Ga0207641_10022718 3300026088 Bacteria 5164
421 Ga0207641_10573247 3300026088 Bacteria 1103
422 Ga0207648_10030759 3300026089 Bacteria 4751
423 Ga0207676_10152594 3300026095 Bacteria 1991
424 Ga0207676_10458757 3300026095 Bacteria 1203
425 Ga0207674_10004026 3300026116 Bacteria 17845
426 Ga0207674_10169286 3300026116 Bacteria 2138
427 Ga0207674_10198877 3300026116 Bacteria 1954
428 Ga0207675_100389349 3300026118 Bacteria 1372
429 Ga0207683_10679633 3300026121 Bacteria 954
430 Ga0207698_10024979 3300026142 Bacteria 4200
431 Ga0207698_10058211 3300026142 Bacteria 2994
432 Ga0207698_10129208 3300026142 Bacteria 2156
433 Ga0207698_10427628 3300026142 Bacteria 1272
434 Ga0207428_10000729 3300027907 Bacteria 37940
435 Ga0268265_10126313 3300028380 Bacteria 2117
436 Ga0265338_10010004 3300028800 Bacteria 11213
437 Ga0265332_10026266 3300031238 Bacteria 2554
438 Ga0265328_10027309 3300031239 Bacteria 2140
439 Ga0265340_10025269 3300031247 Bacteria 3010
440 Ga0265339_10006686 3300031249 Bacteria 7537
441 Ga0265339_10058157 3300031249 Bacteria 2089
442 Ga0265339_10183574 3300031249 Bacteria 1040
443 Ga0265316_10004401 3300031344 Bacteria 14029
444 Ga0265316_10023588 3300031344 Bacteria 5167
445 Ga0265316_10063187 3300031344 Bacteria 2872
446 Ga0265316_10335322 3300031344 Bacteria 1097
447 Ga0265316_10457447 3300031344 Bacteria 915
448 Ga0307408_100011185 3300031548 Bacteria 5928
449 Ga0307408_100955320 3300031548 Bacteria 787
450 Ga0265314_10007310 3300031711 Bacteria 9593
451 Ga0265314_10185373 3300031711 Bacteria 1243
452 Ga0307405_10007949 3300031731 Bacteria 5347
453 Ga0307413_10370910 3300031824 Bacteria 1112
454 Ga0307413_10463288 3300031824 Bacteria 1009
455 Ga0307410_10002296 3300031852 Bacteria 9182
456 Ga0307406_10015960 3300031901 Bacteria 4355
457 Ga0307407_10344506 3300031903 Bacteria 1053
458 Ga0307412_10035507 3300031911 Bacteria 3186
459 Ga0307409_100039932 3300031995 Bacteria 3488
460 Ga0307409_100042750 3300031995 Bacteria 3396
461 Ga0307416_100100356 3300032002 Bacteria 2517
462 Ga0307416_100554448 3300032002 Bacteria 1223
463 Ga0307416_101054101 3300032002 Bacteria 917
464 Ga0307414_10042092 3300032004 Bacteria 3101
465 Ga0307411_10009396 3300032005 Bacteria 5137
466 Ga0307415_101305563 3300032126 Bacteria 687
467 Ga0316583_10137355 3300032133 Bacteria 852
468 Ga0373943_0328304 3300035170 Bacteria 873
469 Ga0373924_0209887 3300035410 Bacteria 860
470 Ga0373937_0025926 3300036401 Bacteria 5295
471 Ga0373925_0563606 3300037068 Bacteria 937
472 Ga0436361_0570038 3300039447 Bacteria 627
473 Ga0436362_0161998 3300039453 Bacteria 1185
474 Ga0439443_017840 3300042003 Bacteria 1095
475 Ga0450923_017639 3300042125 Bacteria 1358
476 Ga0439435_0091827 3300042436 Bacteria 923
477 Ga0439444_0003896 3300042437 Bacteria 2136
478 Ga0451577_0000531 3300042876 Bacteria 63238
479 Ga0451577_0053755 3300042876 Bacteria 3595
480 Ga0451577_0108498 3300042876 Bacteria 2482
481 Ga0453683_0116047 3300044673 Bacteria 1684
482 Ga0453683_0153659 3300044673 Bacteria 1455
483 Ga0466963_0045901 3300044694 Bacteria 2879
484 Ga0466963_0147076 3300044694 Bacteria 1635
485 Ga0453684_0000324 3300044712 Bacteria 201431
486 Ga0466971_0070859 3300044719 Bacteria 1583
487 Ga0466959_0130094 3300045049 Bacteria 1784
488 Ga0466959_0371951 3300045049 Bacteria 973
489 Ga0451576_0021212 3300045051 Bacteria 7062
490 Ga0451576_0033685 3300045051 Bacteria 5444
491 Ga0451576_0145465 3300045051 Bacteria 2471
492 Ga0466958_0022113 3300045836 Bacteria 3722
493 Ga0466967_0001591 3300045976 Bacteria 13359
494 Ga0466967_0371021 3300045976 Bacteria 1388
495 Ga0466967_1452953 3300045976 Bacteria 683
496 Ga0495629_0472364 3300046459 Bacteria 848
497 Ga0495580_0006771 3300046472 Bacteria 9291
498 Ga0495594_0266368 3300046499 Bacteria 976
499 Ga0495644_0197969 3300046523 Bacteria 774
500 Ga0495621_0006597 3300046539 Bacteria 3397
501 Ga0495645_0080238 3300046543 Bacteria 2343
502 Ga0495656_0023391 3300046615 Bacteria 2432
503 Ga0495625_0113032 3300046660 Bacteria 1855
504 Ga0495669_0081681 3300046684 Bacteria 1484
505 Ga0495649_0301947 3300046694 Bacteria 815
506 Ga0495674_0182167 3300047319 Bacteria 1749
507 Ga0495615_0059596 3300048090 Bacteria 1004
508 Ga0496100_0163374 3300048903 Bacteria 1598
509 Ga0496101_0169550 3300048904 Bacteria 1677
510 Ga0496102_0083967 3300048905 Bacteria 2939
511 Ga0496104_0244559 3300048907 Bacteria 1707
512 Ga0496104_0421922 3300048907 Bacteria 1246
513 Ga0496105_0147599 3300048908 Bacteria 1934
514 Ga0496106_0305646 3300048909 Bacteria 1276
515 Ga0496108_0092946 3300048911 Bacteria 2565
516 Ga0496109_0445974 3300048912 Bacteria 1222
517 Ga0496110_0556835 3300048913 Unclassified 1042
518 Ga0496110_0643912 3300048913 Bacteria 959
519 Ga0496111_0036656 3300048914 Bacteria 3507
520 Ga0496111_0104626 3300048914 Bacteria 2082
521 Ga0496111_0235764 3300048914 Bacteria 1359
522 Ga0496112_0133583 3300048915 Bacteria 2452
523 Ga0496112_0337931 3300048915 Bacteria 1449
524 Ga0496125_0390023 3300048928 Bacteria 818
525 Ga0496126_0031870 3300048929 Bacteria 4973
526 Ga0501297_005766 3300049520 Bacteria 1304
527 Ga0501031_0153587 3300049568 Bacteria 1505
528 Ga0501036_0318747 3300049572 Bacteria 1299
529 Ga0501040_0120964 3300049576 Bacteria 1837
530 Ga0501042_0222963 3300049578 Bacteria 1360
531 Ga0501069_0251452 3300049585 Bacteria 1031
532 Ga0501069_0593238 3300049585 Bacteria 665
533 Ga0501071_0308313 3300049587 Bacteria 1201
534 Ga0501072_0063136 3300049588 Bacteria 2922
535 Ga0501073_0067071 3300049589 Bacteria 2501
536 Ga0501076_0225963 3300049592 Bacteria 1530
537 Ga0501076_0553402 3300049592 Bacteria 949
538 Ga0501077_0248815 3300049593 Bacteria 1130
539 Ga0501035_0000205 3300049822 Bacteria 72074
540 Ga0501045_0840667 3300049824 Bacteria 675
541 nmdc:mga05p37_190175_c1 3300050507 Bacteria 2493
542 nmdc:mga09592_165494_c1 3300050508 Bacteria 1911
543 nmdc:mga0qj67_62961_c1 3300050509 Bacteria 2948
544 nmdc:mga06r32_1440892_c1 3300050510 Bacteria 630
545 nmdc:mga06r32_207981_c1 3300050510 Bacteria 1945
546 nmdc:mga08y16_10731_c1 3300050511 Bacteria 9613
547 nmdc:mga08y16_196791_c1 3300050511 Bacteria 2089
548 nmdc:mga08y16_196929_c1 3300050511 Bacteria 2088
549 nmdc:mga08y16_202550_c1 3300050511 Bacteria 2057
550 nmdc:mga08y16_458450_c1 3300050511 Bacteria 1299
551 nmdc:mga0n895_14990_c1 3300050512 Bacteria 7060
552 nmdc:mga0n895_367278_c1 3300050512 Bacteria 1457
553 nmdc:mga0n895_469486_c1 3300050512 Bacteria 1269
554 nmdc:mga0rr50_43296_c1 3300050513 Bacteria 3293
555 nmdc:mga08x19_28623_c1 3300050514 Bacteria 3491
556 nmdc:mga08x19_65666_c1 3300050514 Bacteria 2357
557 nmdc:mga08x19_73116_c1 3300050514 Bacteria 2237
558 nmdc:mga08x19_97100_c1 3300050514 Bacteria 1950
559 Ga0495601_0069811 3300053077 Bacteria 2241
560 Ga0500646_0083208 3300053090 Bacteria 980
561 Ga0501084_0066289 3300054114 Bacteria 3021
562 Ga0587073_0126715 3300059492 Bacteria 696
563 Ga0530510_1276429 3300061734 Bacteria 563

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027907 Ga0207428_10000729 Ga0207428_1000072917 144
2 3300009093 Ga0105240_10996832 Ga0105240_109968322 165
3 3300009098 Ga0105245_10002176 Ga0105245_100021764 165
4 3300009177 Ga0105248_10297618 Ga0105248_102976182 165
5 3300009553 Ga0105249_11328025 Ga0105249_113280252 165
6 3300013296 Ga0157374_10000154 Ga0157374_100001549 165
7 3300013297 Ga0157378_10000150 Ga0157378_100001508 165
8 3300013297 Ga0157378_10000304 Ga0157378_1000030411 165
9 3300013307 Ga0157372_10000300 Ga0157372_1000030038 165
10 3300013307 Ga0157372_10686359 Ga0157372_106863592 165
11 3300014326 Ga0157380_10221955 Ga0157380_102219551 165
12 3300014969 Ga0157376_10086957 Ga0157376_100869573 165
13 3300048907 Ga0496104_0421922 Ga0496104_0421922_526_1026 165
14 3300005436 Ga0070713_100194076 Ga0070713_1001940762 168
15 3300005436 Ga0070713_100475369 Ga0070713_1004753692 168
16 3300005437 Ga0070710_10320596 Ga0070710_103205962 168
17 3300006173 Ga0070716_100182815 Ga0070716_1001828152 168
18 3300006175 Ga0070712_100031245 Ga0070712_1000312452 168
19 3300007076 Ga0075435_100499857 Ga0075435_1004998572 168
20 3300009093 Ga0105240_10019287 Ga0105240_100192875 168
21 3300009147 Ga0114129_10055986 Ga0114129_100559866 168
22 3300013307 Ga0157372_10119574 Ga0157372_101195742 168
23 3300013307 Ga0157372_10170881 Ga0157372_101708813 168
24 3300014969 Ga0157376_10006505 Ga0157376_100065054 168
25 3300025915 Ga0207693_10038670 Ga0207693_100386704 168
26 3300025918 Ga0207662_10131115 Ga0207662_101311152 168
27 3300025939 Ga0207665_10184792 Ga0207665_101847921 168
28 3300035170 Ga0373943_0328304 Ga0373943_0328304_278_787 168
29 3300035410 Ga0373924_0209887 Ga0373924_0209887_213_722 168
30 3300045976 Ga0466967_1452953 Ga0466967_1452953_51_560 168
31 3300047319 Ga0495674_0182167 Ga0495674_0182167_801_1310 168
32 3300050510 nmdc:mga06r32_1440892_c1 nmdc:mga06r32_1440892_c1_10_516 168
33 3300005333 Ga0070677_10217253 Ga0070677_102172532 169
34 3300006051 Ga0075364_10639439 Ga0075364_106394391 169
35 3300009094 Ga0111539_10280216 Ga0111539_102802163 169
36 3300009094 Ga0111539_11118300 Ga0111539_111183002 169
37 3300009177 Ga0105248_10730083 Ga0105248_107300832 169
38 3300014745 Ga0157377_10478559 Ga0157377_104785592 169
39 3300014969 Ga0157376_10503378 Ga0157376_105033781 169
40 3300025945 Ga0207679_11167425 Ga0207679_111674251 169
41 3300031995 Ga0307409_100039932 Ga0307409_1000399323 169
42 3300032004 Ga0307414_10042092 Ga0307414_100420923 169
43 3300042125 Ga0450923_017639 Ga0450923_017639_56_565 169
44 3300042436 Ga0439435_0091827 Ga0439435_0091827_154_663 169
45 3300042437 Ga0439444_0003896 Ga0439444_0003896_857_1366 169
46 3300046459 Ga0495629_0472364 Ga0495629_0472364_278_787 169
47 3300046499 Ga0495594_0266368 Ga0495594_0266368_289_798 169
48 3300049568 Ga0501031_0153587 Ga0501031_0153587_16_525 169
49 3300049572 Ga0501036_0318747 Ga0501036_0318747_752_1261 169
50 3300049576 Ga0501040_0120964 Ga0501040_0120964_841_1350 169
51 3300049578 Ga0501042_0222963 Ga0501042_0222963_42_551 169
52 3300049585 Ga0501069_0593238 Ga0501069_0593238_60_572 169
53 3300049588 Ga0501072_0063136 Ga0501072_0063136_870_1379 169
54 3300049589 Ga0501073_0067071 Ga0501073_0067071_858_1367 169
55 3300049592 Ga0501076_0225963 Ga0501076_0225963_140_649 169
56 3300049592 Ga0501076_0553402 Ga0501076_0553402_324_833 169
57 3300049593 Ga0501077_0248815 Ga0501077_0248815_298_807 169
58 3300049824 Ga0501045_0840667 Ga0501045_0840667_156_665 169
59 3300050511 nmdc:mga08y16_458450_c1 nmdc:mga08y16_458450_c1_33_542 169
60 3300053090 Ga0500646_0083208 Ga0500646_0083208_416_925 169
61 3300054114 Ga0501084_0066289 Ga0501084_0066289_767_1276 169
62 3300061734 Ga0530510_1276429 Ga0530510_1276429_10_519 169
63 3300005549 Ga0070704_100821867 Ga0070704_1008218672 170
64 3300049587 Ga0501071_0308313 Ga0501071_0308313_282_794 170
65 3300006844 Ga0075428_100032787 Ga0075428_1000327873 171
66 3300006871 Ga0075434_101182740 Ga0075434_1011827402 171
67 3300006880 Ga0075429_100053455 Ga0075429_1000534553 171
68 3300009147 Ga0114129_10518278 Ga0114129_105182782 171
69 3300014326 Ga0157380_10007372 Ga0157380_100073722 171
70 3300031548 Ga0307408_100955320 Ga0307408_1009553201 171
71 3300032002 Ga0307416_100554448 Ga0307416_1005544482 171
72 3300042003 Ga0439443_017840 Ga0439443_017840_412_927 171
73 3300050507 nmdc:mga05p37_190175_c1 nmdc:mga05p37_190175_c1_1516_2031 171
74 3300050508 nmdc:mga09592_165494_c1 nmdc:mga09592_165494_c1_355_870 171
75 3300050511 nmdc:mga08y16_196791_c1 nmdc:mga08y16_196791_c1_523_1038 171
76 3300050512 nmdc:mga0n895_469486_c1 nmdc:mga0n895_469486_c1_106_621 171
77 3300005545 Ga0070695_100655016 Ga0070695_1006550161 172
78 3300006880 Ga0075429_100247864 Ga0075429_1002478642 172
79 3300009176 Ga0105242_11095012 Ga0105242_110950122 172
80 3300046523 Ga0495644_0197969 Ga0495644_0197969_245_763 172
81 3300046539 Ga0495621_0006597 Ga0495621_0006597_1744_2262 172
82 3300050511 nmdc:mga08y16_10731_c1 nmdc:mga08y16_10731_c1_3026_3544 172
83 3300050511 nmdc:mga08y16_196929_c1 nmdc:mga08y16_196929_c1_384_902 172
84 3300050511 nmdc:mga08y16_202550_c1 nmdc:mga08y16_202550_c1_1069_1587 172
85 3300005445 Ga0070708_100118735 Ga0070708_1001187352 173
86 3300005467 Ga0070706_100063107 Ga0070706_1000631073 173
87 3300005468 Ga0070707_100135932 Ga0070707_1001359322 173
88 3300005468 Ga0070707_100227823 Ga0070707_1002278232 173
89 3300005471 Ga0070698_100118463 Ga0070698_1001184632 173
90 3300005518 Ga0070699_100281766 Ga0070699_1002817661 173
91 3300005518 Ga0070699_100748162 Ga0070699_1007481621 173
92 3300005536 Ga0070697_100000145 Ga0070697_10000014510 173
93 3300005536 Ga0070697_100539721 Ga0070697_1005397212 173
94 3300025910 Ga0207684_10185562 Ga0207684_101855622 173
95 3300025922 Ga0207646_10069986 Ga0207646_100699862 173
96 3300025922 Ga0207646_10544165 Ga0207646_105441651 173
97 3300025922 Ga0207646_10647779 Ga0207646_106477792 173
98 3300028800 Ga0265338_10010004 Ga0265338_100100049 173
99 3300031238 Ga0265332_10026266 Ga0265332_100262661 173
100 3300031239 Ga0265328_10027309 Ga0265328_100273093 173
101 3300031247 Ga0265340_10025269 Ga0265340_100252692 173
102 3300031249 Ga0265339_10006686 Ga0265339_100066866 173
103 3300031249 Ga0265339_10058157 Ga0265339_100581573 173
104 3300031249 Ga0265339_10183574 Ga0265339_101835742 173
105 3300031344 Ga0265316_10004401 Ga0265316_100044012 173
106 3300031344 Ga0265316_10023588 Ga0265316_100235883 173
107 3300031711 Ga0265314_10007310 Ga0265314_100073102 173
108 3300005293 Ga0065715_10023042 Ga0065715_100230423 174
109 3300005329 Ga0070683_100124525 Ga0070683_1001245252 174
110 3300005329 Ga0070683_100142571 Ga0070683_1001425712 174
111 3300005330 Ga0070690_100986583 Ga0070690_1009865831 174
112 3300005334 Ga0068869_100003590 Ga0068869_1000035902 174
113 3300005334 Ga0068869_100223214 Ga0068869_1002232142 174
114 3300005335 Ga0070666_10313863 Ga0070666_103138631 174
115 3300005336 Ga0070680_101208146 Ga0070680_1012081461 174
116 3300005338 Ga0068868_100072804 Ga0068868_1000728043 174
117 3300005338 Ga0068868_100452295 Ga0068868_1004522951 174
118 3300005338 Ga0068868_100968659 Ga0068868_1009686591 174
119 3300005339 Ga0070660_100013843 Ga0070660_1000138433 174
120 3300005343 Ga0070687_100074260 Ga0070687_1000742602 174
121 3300005344 Ga0070661_100033066 Ga0070661_1000330663 174
122 3300005344 Ga0070661_100655736 Ga0070661_1006557361 174
123 3300005355 Ga0070671_100134777 Ga0070671_1001347773 174
124 3300005364 Ga0070673_100462759 Ga0070673_1004627591 174
125 3300005366 Ga0070659_100211219 Ga0070659_1002112192 174
126 3300005366 Ga0070659_100637659 Ga0070659_1006376591 174
127 3300005367 Ga0070667_100541729 Ga0070667_1005417292 174
128 3300005367 Ga0070667_100707334 Ga0070667_1007073342 174
129 3300005434 Ga0070709_10003110 Ga0070709_100031107 174
130 3300005434 Ga0070709_10004804 Ga0070709_100048048 174
131 3300005434 Ga0070709_10715669 Ga0070709_107156691 174
132 3300005435 Ga0070714_100001256 Ga0070714_1000012561 174
133 3300005435 Ga0070714_100012151 Ga0070714_1000121512 174
134 3300005435 Ga0070714_100051603 Ga0070714_1000516033 174
135 3300005435 Ga0070714_100053026 Ga0070714_1000530263 174
136 3300005435 Ga0070714_100136287 Ga0070714_1001362872 174
137 3300005435 Ga0070714_100264310 Ga0070714_1002643102 174
138 3300005435 Ga0070714_100395861 Ga0070714_1003958612 174
139 3300005435 Ga0070714_100707075 Ga0070714_1007070751 174
140 3300005435 Ga0070714_101098546 Ga0070714_1010985461 174
141 3300005436 Ga0070713_100000561 Ga0070713_10000056118 174
142 3300005436 Ga0070713_100003423 Ga0070713_10000342310 174
143 3300005436 Ga0070713_100006965 Ga0070713_1000069652 174
144 3300005436 Ga0070713_100232070 Ga0070713_1002320702 174
145 3300005436 Ga0070713_100369943 Ga0070713_1003699432 174
146 3300005436 Ga0070713_100382192 Ga0070713_1003821921 174
147 3300005436 Ga0070713_101459654 Ga0070713_1014596541 174
148 3300005437 Ga0070710_10092133 Ga0070710_100921332 174
149 3300005437 Ga0070710_10171162 Ga0070710_101711622 174
150 3300005439 Ga0070711_100015990 Ga0070711_1000159902 174
151 3300005439 Ga0070711_100050824 Ga0070711_1000508242 174
152 3300005439 Ga0070711_100274139 Ga0070711_1002741391 174
153 3300005445 Ga0070708_100023076 Ga0070708_1000230762 174
154 3300005445 Ga0070708_100217505 Ga0070708_1002175052 174
155 3300005445 Ga0070708_100341472 Ga0070708_1003414722 174
156 3300005445 Ga0070708_100586325 Ga0070708_1005863252 174
157 3300005456 Ga0070678_100336646 Ga0070678_1003366462 174
158 3300005458 Ga0070681_10009675 Ga0070681_100096758 174
159 3300005458 Ga0070681_10519452 Ga0070681_105194522 174
160 3300005466 Ga0070685_10631073 Ga0070685_106310731 174
161 3300005466 Ga0070685_10751522 Ga0070685_107515221 174
162 3300005467 Ga0070706_100007211 Ga0070706_1000072117 174
163 3300005467 Ga0070706_100009023 Ga0070706_1000090232 174
164 3300005467 Ga0070706_100500873 Ga0070706_1005008731 174
165 3300005468 Ga0070707_100008857 Ga0070707_1000088578 174
166 3300005468 Ga0070707_100745583 Ga0070707_1007455832 174
167 3300005471 Ga0070698_100004977 Ga0070698_1000049776 174
168 3300005518 Ga0070699_100001625 Ga0070699_1000016258 174
169 3300005518 Ga0070699_100063586 Ga0070699_1000635862 174
170 3300005530 Ga0070679_100103655 Ga0070679_1001036552 174
171 3300005530 Ga0070679_100170881 Ga0070679_1001708812 174
172 3300005530 Ga0070679_100845831 Ga0070679_1008458311 174
173 3300005535 Ga0070684_100074079 Ga0070684_1000740793 174
174 3300005535 Ga0070684_100287124 Ga0070684_1002871242 174
175 3300005536 Ga0070697_100001728 Ga0070697_10000172811 174
176 3300005539 Ga0068853_100133607 Ga0068853_1001336072 174
177 3300005539 Ga0068853_100491666 Ga0068853_1004916662 174
178 3300005545 Ga0070695_100109964 Ga0070695_1001099643 174
179 3300005545 Ga0070695_100181055 Ga0070695_1001810552 174
180 3300005545 Ga0070695_100705510 Ga0070695_1007055101 174
181 3300005546 Ga0070696_100556965 Ga0070696_1005569651 174
182 3300005547 Ga0070693_100030451 Ga0070693_1000304513 174
183 3300005547 Ga0070693_100402711 Ga0070693_1004027111 174
184 3300005563 Ga0068855_100001957 Ga0068855_1000019578 174
185 3300005563 Ga0068855_100256147 Ga0068855_1002561472 174
186 3300005563 Ga0068855_101008255 Ga0068855_1010082551 174
187 3300005563 Ga0068855_101266266 Ga0068855_1012662661 174
188 3300005564 Ga0070664_100056564 Ga0070664_1000565643 174
189 3300005564 Ga0070664_100282504 Ga0070664_1002825042 174
190 3300005564 Ga0070664_101772964 Ga0070664_1017729641 174
191 3300005578 Ga0068854_100007558 Ga0068854_1000075585 174
192 3300005578 Ga0068854_100034605 Ga0068854_1000346053 174
193 3300005578 Ga0068854_100041415 Ga0068854_1000414152 174
194 3300005578 Ga0068854_101474524 Ga0068854_1014745241 174
195 3300005614 Ga0068856_100002269 Ga0068856_1000022693 174
196 3300005614 Ga0068856_100183604 Ga0068856_1001836042 174
197 3300005614 Ga0068856_100304661 Ga0068856_1003046612 174
198 3300005614 Ga0068856_100345122 Ga0068856_1003451221 174
199 3300005615 Ga0070702_100193166 Ga0070702_1001931662 174
200 3300005616 Ga0068852_100183502 Ga0068852_1001835022 174
201 3300005618 Ga0068864_100007060 Ga0068864_1000070602 174
202 3300005618 Ga0068864_100100058 Ga0068864_1001000581 174
203 3300005718 Ga0068866_10060626 Ga0068866_100606262 174
204 3300005718 Ga0068866_10091952 Ga0068866_100919522 174
205 3300005834 Ga0068851_10065600 Ga0068851_100656002 174
206 3300005840 Ga0068870_10063990 Ga0068870_100639902 174
207 3300005841 Ga0068863_100099970 Ga0068863_1000999702 174
208 3300005842 Ga0068858_100004940 Ga0068858_1000049408 174
209 3300005842 Ga0068858_100057600 Ga0068858_1000576002 174
210 3300005842 Ga0068858_100091600 Ga0068858_1000916003 174
211 3300005842 Ga0068858_100189314 Ga0068858_1001893143 174
212 3300005842 Ga0068858_100640560 Ga0068858_1006405602 174
213 3300005843 Ga0068860_100068668 Ga0068860_1000686682 174
214 3300005844 Ga0068862_100110109 Ga0068862_1001101092 174
215 3300006028 Ga0070717_10014604 Ga0070717_100146045 174
216 3300006028 Ga0070717_10034560 Ga0070717_100345602 174
217 3300006028 Ga0070717_10122066 Ga0070717_101220662 174
218 3300006028 Ga0070717_10187238 Ga0070717_101872381 174
219 3300006028 Ga0070717_10385599 Ga0070717_103855991 174
220 3300006028 Ga0070717_11045725 Ga0070717_110457251 174
221 3300006173 Ga0070716_100001403 Ga0070716_1000014037 174
222 3300006173 Ga0070716_100185412 Ga0070716_1001854121 174
223 3300006173 Ga0070716_100190027 Ga0070716_1001900272 174
224 3300006175 Ga0070712_100002903 Ga0070712_1000029037 174
225 3300006175 Ga0070712_100182307 Ga0070712_1001823072 174
226 3300006175 Ga0070712_100234831 Ga0070712_1002348312 174
227 3300006175 Ga0070712_100961830 Ga0070712_1009618301 174
228 3300006175 Ga0070712_101401488 Ga0070712_1014014881 174
229 3300006237 Ga0097621_100011526 Ga0097621_1000115263 174
230 3300006237 Ga0097621_100020441 Ga0097621_1000204415 174
231 3300006237 Ga0097621_100053947 Ga0097621_1000539474 174
232 3300006237 Ga0097621_100208487 Ga0097621_1002084872 174
233 3300006237 Ga0097621_100339171 Ga0097621_1003391712 174
234 3300006237 Ga0097621_100402432 Ga0097621_1004024322 174
235 3300006358 Ga0068871_100000307 Ga0068871_10000030714 174
236 3300006358 Ga0068871_100000339 Ga0068871_10000033920 174
237 3300006358 Ga0068871_100379024 Ga0068871_1003790242 174
238 3300006871 Ga0075434_100200928 Ga0075434_1002009283 174
239 3300006871 Ga0075434_100318789 Ga0075434_1003187892 174
240 3300006881 Ga0068865_100419410 Ga0068865_1004194102 174
241 3300006914 Ga0075436_100005040 Ga0075436_1000050408 174
242 3300006914 Ga0075436_100034148 Ga0075436_1000341484 174
243 3300006914 Ga0075436_100088630 Ga0075436_1000886302 174
244 3300006914 Ga0075436_100143793 Ga0075436_1001437931 174
245 3300007076 Ga0075435_100003987 Ga0075435_10000398710 174
246 3300007076 Ga0075435_100217413 Ga0075435_1002174133 174
247 3300009093 Ga0105240_10008591 Ga0105240_100085914 174
248 3300009093 Ga0105240_10049516 Ga0105240_100495164 174
249 3300009093 Ga0105240_10554107 Ga0105240_105541072 174
250 3300009093 Ga0105240_10574038 Ga0105240_105740382 174
251 3300009098 Ga0105245_10082073 Ga0105245_100820732 174
252 3300009174 Ga0105241_10045117 Ga0105241_100451173 174
253 3300009174 Ga0105241_10328491 Ga0105241_103284912 174
254 3300009174 Ga0105241_10425804 Ga0105241_104258042 174
255 3300009176 Ga0105242_10011211 Ga0105242_100112117 174
256 3300009177 Ga0105248_10010903 Ga0105248_100109038 174
257 3300009177 Ga0105248_10013443 Ga0105248_100134437 174
258 3300009545 Ga0105237_10158463 Ga0105237_101584633 174
259 3300009545 Ga0105237_10555077 Ga0105237_105550771 174
260 3300009545 Ga0105237_10606168 Ga0105237_106061682 174
261 3300009551 Ga0105238_10088247 Ga0105238_100882472 174
262 3300009551 Ga0105238_10135659 Ga0105238_101356593 174
263 3300009551 Ga0105238_10503203 Ga0105238_105032032 174
264 3300009551 Ga0105238_10559157 Ga0105238_105591572 174
265 3300010375 Ga0105239_10106363 Ga0105239_101063632 174
266 3300010375 Ga0105239_10531590 Ga0105239_105315901 174
267 3300010375 Ga0105239_10538097 Ga0105239_105380972 174
268 3300011119 Ga0105246_10369540 Ga0105246_103695401 174
269 3300013100 Ga0157373_10026248 Ga0157373_100262483 174
270 3300013104 Ga0157370_10007683 Ga0157370_100076838 174
271 3300013105 Ga0157369_10026761 Ga0157369_100267617 174
272 3300013105 Ga0157369_10139818 Ga0157369_101398182 174
273 3300013296 Ga0157374_10022027 Ga0157374_100220272 174
274 3300013296 Ga0157374_10180694 Ga0157374_101806942 174
275 3300013306 Ga0163162_10735141 Ga0163162_107351411 174
276 3300013307 Ga0157372_10000997 Ga0157372_1000099717 174
277 3300013307 Ga0157372_10017656 Ga0157372_100176561 174
278 3300013307 Ga0157372_10309092 Ga0157372_103090921 174
279 3300013307 Ga0157372_10339677 Ga0157372_103396772 174
280 3300014325 Ga0163163_10118556 Ga0163163_101185562 174
281 3300014325 Ga0163163_10165950 Ga0163163_101659503 174
282 3300014497 Ga0182008_10070523 Ga0182008_100705233 174
283 3300015262 Ga0182007_10006014 Ga0182007_100060144 174
284 3300015265 Ga0182005_1080866 Ga0182005_10808661 174
285 3300025898 Ga0207692_10080219 Ga0207692_100802192 174
286 3300025898 Ga0207692_10145261 Ga0207692_101452612 174
287 3300025899 Ga0207642_10001798 Ga0207642_100017987 174
288 3300025899 Ga0207642_10323696 Ga0207642_103236962 174
289 3300025903 Ga0207680_10026904 Ga0207680_100269042 174
290 3300025905 Ga0207685_10023264 Ga0207685_100232642 174
291 3300025906 Ga0207699_10004141 Ga0207699_100041417 174
292 3300025906 Ga0207699_10005666 Ga0207699_100056667 174
293 3300025906 Ga0207699_10060875 Ga0207699_100608752 174
294 3300025906 Ga0207699_10357543 Ga0207699_103575432 174
295 3300025906 Ga0207699_10809648 Ga0207699_108096481 174
296 3300025909 Ga0207705_10489834 Ga0207705_104898342 174
297 3300025910 Ga0207684_10002114 Ga0207684_1000211414 174
298 3300025910 Ga0207684_10085781 Ga0207684_100857813 174
299 3300025911 Ga0207654_10311004 Ga0207654_103110042 174
300 3300025911 Ga0207654_10345879 Ga0207654_103458792 174
301 3300025912 Ga0207707_10031615 Ga0207707_100316153 174
302 3300025913 Ga0207695_10032249 Ga0207695_100322492 174
303 3300025913 Ga0207695_10045564 Ga0207695_100455642 174
304 3300025913 Ga0207695_10094055 Ga0207695_100940552 174
305 3300025914 Ga0207671_10467806 Ga0207671_104678061 174
306 3300025915 Ga0207693_10001147 Ga0207693_1000114728 174
307 3300025915 Ga0207693_10178940 Ga0207693_101789402 174
308 3300025915 Ga0207693_10297153 Ga0207693_102971532 174
309 3300025915 Ga0207693_10703130 Ga0207693_107031301 174
310 3300025916 Ga0207663_10015113 Ga0207663_100151132 174
311 3300025916 Ga0207663_10170913 Ga0207663_101709132 174
312 3300025916 Ga0207663_10398284 Ga0207663_103982842 174
313 3300025918 Ga0207662_10118711 Ga0207662_101187112 174
314 3300025919 Ga0207657_10000197 Ga0207657_1000019742 174
315 3300025920 Ga0207649_10588485 Ga0207649_105884851 174
316 3300025921 Ga0207652_10138644 Ga0207652_101386443 174
317 3300025921 Ga0207652_10141593 Ga0207652_101415933 174
318 3300025921 Ga0207652_10385502 Ga0207652_103855021 174
319 3300025921 Ga0207652_11061878 Ga0207652_110618781 174
320 3300025922 Ga0207646_10005280 Ga0207646_1000528014 174
321 3300025922 Ga0207646_10606447 Ga0207646_106064472 174
322 3300025924 Ga0207694_10009653 Ga0207694_100096533 174
323 3300025924 Ga0207694_10307972 Ga0207694_103079722 174
324 3300025924 Ga0207694_10519720 Ga0207694_105197201 174
325 3300025927 Ga0207687_10070351 Ga0207687_100703512 174
326 3300025927 Ga0207687_10324639 Ga0207687_103246392 174
327 3300025927 Ga0207687_10336549 Ga0207687_103365491 174
328 3300025928 Ga0207700_10000650 Ga0207700_1000065019 174
329 3300025928 Ga0207700_10017040 Ga0207700_100170403 174
330 3300025928 Ga0207700_10096067 Ga0207700_100960672 174
331 3300025928 Ga0207700_10227432 Ga0207700_102274321 174
332 3300025928 Ga0207700_10336239 Ga0207700_103362391 174
333 3300025928 Ga0207700_10590262 Ga0207700_105902622 174
334 3300025928 Ga0207700_10874691 Ga0207700_108746911 174
335 3300025929 Ga0207664_10012965 Ga0207664_100129652 174
336 3300025929 Ga0207664_10022896 Ga0207664_100228964 174
337 3300025929 Ga0207664_10153315 Ga0207664_101533152 174
338 3300025929 Ga0207664_10231318 Ga0207664_102313182 174
339 3300025929 Ga0207664_10412994 Ga0207664_104129942 174
340 3300025931 Ga0207644_10086418 Ga0207644_100864183 174
341 3300025933 Ga0207706_10096751 Ga0207706_100967513 174
342 3300025934 Ga0207686_10011425 Ga0207686_100114252 174
343 3300025937 Ga0207669_10101701 Ga0207669_101017012 174
344 3300025939 Ga0207665_10052713 Ga0207665_100527134 174
345 3300025941 Ga0207711_10161154 Ga0207711_101611542 174
346 3300025942 Ga0207689_10001515 Ga0207689_1000151522 174
347 3300025942 Ga0207689_10172961 Ga0207689_101729612 174
348 3300025944 Ga0207661_10491536 Ga0207661_104915362 174
349 3300025945 Ga0207679_10126953 Ga0207679_101269532 174
350 3300025949 Ga0207667_10000811 Ga0207667_100008112 174
351 3300025949 Ga0207667_10681397 Ga0207667_106813972 174
352 3300025949 Ga0207667_10803690 Ga0207667_108036902 174
353 3300025949 Ga0207667_11219837 Ga0207667_112198371 174
354 3300025960 Ga0207651_10156959 Ga0207651_101569592 174
355 3300025981 Ga0207640_10031625 Ga0207640_100316252 174
356 3300025981 Ga0207640_10089179 Ga0207640_100891792 174
357 3300025981 Ga0207640_10202151 Ga0207640_102021512 174
358 3300025986 Ga0207658_10311026 Ga0207658_103110261 174
359 3300026023 Ga0207677_10022484 Ga0207677_100224844 174
360 3300026023 Ga0207677_10131606 Ga0207677_101316062 174
361 3300026023 Ga0207677_10498317 Ga0207677_104983172 174
362 3300026035 Ga0207703_10025243 Ga0207703_100252435 174
363 3300026035 Ga0207703_10066459 Ga0207703_100664593 174
364 3300026041 Ga0207639_10533201 Ga0207639_105332011 174
365 3300026041 Ga0207639_10548288 Ga0207639_105482881 174
366 3300026078 Ga0207702_10003463 Ga0207702_100034632 174
367 3300026078 Ga0207702_10056413 Ga0207702_100564134 174
368 3300026078 Ga0207702_10063092 Ga0207702_100630923 174
369 3300026078 Ga0207702_10146734 Ga0207702_101467343 174
370 3300026078 Ga0207702_10811390 Ga0207702_108113901 174
371 3300026088 Ga0207641_10022718 Ga0207641_100227182 174
372 3300026088 Ga0207641_10573247 Ga0207641_105732471 174
373 3300026089 Ga0207648_10030759 Ga0207648_100307593 174
374 3300026095 Ga0207676_10152594 Ga0207676_101525942 174
375 3300026095 Ga0207676_10458757 Ga0207676_104587571 174
376 3300026116 Ga0207674_10169286 Ga0207674_101692862 174
377 3300026118 Ga0207675_100389349 Ga0207675_1003893492 174
378 3300026121 Ga0207683_10679633 Ga0207683_106796332 174
379 3300026142 Ga0207698_10427628 Ga0207698_104276282 174
380 3300028380 Ga0268265_10126313 Ga0268265_101263132 174
381 3300031344 Ga0265316_10063187 Ga0265316_100631872 174
382 3300031344 Ga0265316_10335322 Ga0265316_103353222 174
383 3300031548 Ga0307408_100011185 Ga0307408_1000111853 174
384 3300031731 Ga0307405_10007949 Ga0307405_100079492 174
385 3300031824 Ga0307413_10370910 Ga0307413_103709102 174
386 3300031824 Ga0307413_10463288 Ga0307413_104632881 174
387 3300031852 Ga0307410_10002296 Ga0307410_100022964 174
388 3300031901 Ga0307406_10015960 Ga0307406_100159603 174
389 3300031903 Ga0307407_10344506 Ga0307407_103445062 174
390 3300031911 Ga0307412_10035507 Ga0307412_100355073 174
391 3300031995 Ga0307409_100042750 Ga0307409_1000427503 174
392 3300032002 Ga0307416_100100356 Ga0307416_1001003562 174
393 3300032002 Ga0307416_101054101 Ga0307416_1010541011 174
394 3300032005 Ga0307411_10009396 Ga0307411_100093965 174
395 3300032126 Ga0307415_101305563 Ga0307415_1013055632 174
396 3300032133 Ga0316583_10137355 Ga0316583_101373551 174
397 3300036401 Ga0373937_0025926 Ga0373937_0025926_3477_4004 174
398 3300037068 Ga0373925_0563606 Ga0373925_0563606_366_893 174
399 3300039447 Ga0436361_0570038 Ga0436361_0570038_62_589 174
400 3300039453 Ga0436362_0161998 Ga0436362_0161998_422_949 174
401 3300042876 Ga0451577_0000531 Ga0451577_0000531_43027_43554 174
402 3300042876 Ga0451577_0053755 Ga0451577_0053755_389_916 174
403 3300042876 Ga0451577_0108498 Ga0451577_0108498_1100_1633 174
404 3300044673 Ga0453683_0116047 Ga0453683_0116047_132_659 174
405 3300044673 Ga0453683_0153659 Ga0453683_0153659_698_1225 174
406 3300044694 Ga0466963_0045901 Ga0466963_0045901_1210_1737 174
407 3300044694 Ga0466963_0147076 Ga0466963_0147076_286_813 174
408 3300044712 Ga0453684_0000324 Ga0453684_0000324_64277_64804 174
409 3300044719 Ga0466971_0070859 Ga0466971_0070859_234_761 174
410 3300045049 Ga0466959_0130094 Ga0466959_0130094_948_1475 174
411 3300045049 Ga0466959_0371951 Ga0466959_0371951_186_713 174
412 3300045051 Ga0451576_0021212 Ga0451576_0021212_1237_1764 174
413 3300045051 Ga0451576_0033685 Ga0451576_0033685_1916_2443 174
414 3300045051 Ga0451576_0145465 Ga0451576_0145465_348_875 174
415 3300045836 Ga0466958_0022113 Ga0466958_0022113_75_602 174
416 3300045976 Ga0466967_0001591 Ga0466967_0001591_8718_9245 174
417 3300045976 Ga0466967_0371021 Ga0466967_0371021_352_879 174
418 3300046615 Ga0495656_0023391 Ga0495656_0023391_1396_1923 174
419 3300048904 Ga0496101_0169550 Ga0496101_0169550_622_1149 174
420 3300048905 Ga0496102_0083967 Ga0496102_0083967_1607_2134 174
421 3300048907 Ga0496104_0244559 Ga0496104_0244559_42_569 174
422 3300048908 Ga0496105_0147599 Ga0496105_0147599_77_604 174
423 3300048909 Ga0496106_0305646 Ga0496106_0305646_522_1049 174
424 3300048911 Ga0496108_0092946 Ga0496108_0092946_388_915 174
425 3300048912 Ga0496109_0445974 Ga0496109_0445974_682_1209 174
426 3300048913 Ga0496110_0643912 Ga0496110_0643912_399_926 174
427 3300048914 Ga0496111_0104626 Ga0496111_0104626_298_825 174
428 3300048914 Ga0496111_0235764 Ga0496111_0235764_724_1251 174
429 3300048915 Ga0496112_0133583 Ga0496112_0133583_1161_1688 174
430 3300048915 Ga0496112_0337931 Ga0496112_0337931_640_1167 174
431 3300049520 Ga0501297_005766 Ga0501297_005766_89_616 174
432 3300049585 Ga0501069_0251452 Ga0501069_0251452_430_957 174
433 3300050512 nmdc:mga0n895_14990_c1 nmdc:mga0n895_14990_c1_6235_6762 174
434 3300050512 nmdc:mga0n895_367278_c1 nmdc:mga0n895_367278_c1_561_1088 174
435 3300050513 nmdc:mga0rr50_43296_c1 nmdc:mga0rr50_43296_c1_1896_2423 174
436 3300050514 nmdc:mga08x19_28623_c1 nmdc:mga08x19_28623_c1_2557_3084 174
437 3300050514 nmdc:mga08x19_65666_c1 nmdc:mga08x19_65666_c1_1057_1584 174
438 3300050514 nmdc:mga08x19_73116_c1 nmdc:mga08x19_73116_c1_747_1274 174
439 3300050514 nmdc:mga08x19_97100_c1 nmdc:mga08x19_97100_c1_349_876 174
440 3300059492 Ga0587073_0126715 Ga0587073_0126715_152_679 174
441 3300005327 Ga0070658_10052670 Ga0070658_100526702 175
442 3300005327 Ga0070658_10213561 Ga0070658_102135613 175
443 3300005329 Ga0070683_100041067 Ga0070683_1000410672 175
444 3300005329 Ga0070683_100044167 Ga0070683_1000441673 175
445 3300005329 Ga0070683_100664148 Ga0070683_1006641481 175
446 3300005336 Ga0070680_100128165 Ga0070680_1001281652 175
447 3300005339 Ga0070660_100081752 Ga0070660_1000817523 175
448 3300005344 Ga0070661_100121768 Ga0070661_1001217682 175
449 3300005437 Ga0070710_10155662 Ga0070710_101556621 175
450 3300005455 Ga0070663_100264861 Ga0070663_1002648611 175
451 3300005458 Ga0070681_10034238 Ga0070681_100342383 175
452 3300005530 Ga0070679_100037623 Ga0070679_1000376233 175
453 3300005535 Ga0070684_100005011 Ga0070684_1000050114 175
454 3300005535 Ga0070684_100085594 Ga0070684_1000855943 175
455 3300005535 Ga0070684_100148999 Ga0070684_1001489992 175
456 3300005563 Ga0068855_100016701 Ga0068855_1000167012 175
457 3300005563 Ga0068855_100109727 Ga0068855_1001097273 175
458 3300005577 Ga0068857_100001479 Ga0068857_1000014792 175
459 3300005577 Ga0068857_100171493 Ga0068857_1001714933 175
460 3300005578 Ga0068854_100014538 Ga0068854_1000145382 175
461 3300005614 Ga0068856_100004334 Ga0068856_1000043342 175
462 3300005614 Ga0068856_100075564 Ga0068856_1000755642 175
463 3300005614 Ga0068856_100076832 Ga0068856_1000768322 175
464 3300005614 Ga0068856_100233363 Ga0068856_1002333632 175
465 3300005614 Ga0068856_100439639 Ga0068856_1004396391 175
466 3300005616 Ga0068852_100148767 Ga0068852_1001487673 175
467 3300005616 Ga0068852_100170184 Ga0068852_1001701841 175
468 3300005616 Ga0068852_100180806 Ga0068852_1001808062 175
469 3300005834 Ga0068851_10002574 Ga0068851_100025746 175
470 3300006028 Ga0070717_10571232 Ga0070717_105712321 175
471 3300006175 Ga0070712_100121046 Ga0070712_1001210462 175
472 3300009093 Ga0105240_10025122 Ga0105240_100251226 175
473 3300009093 Ga0105240_10057142 Ga0105240_100571422 175
474 3300009093 Ga0105240_10197102 Ga0105240_101971021 175
475 3300009174 Ga0105241_10000052 Ga0105241_1000005270 175
476 3300009174 Ga0105241_10043271 Ga0105241_100432712 175
477 3300009174 Ga0105241_10121097 Ga0105241_101210973 175
478 3300009545 Ga0105237_10119543 Ga0105237_101195433 175
479 3300009551 Ga0105238_10009357 Ga0105238_100093577 175
480 3300009551 Ga0105238_10024062 Ga0105238_100240622 175
481 3300009551 Ga0105238_10224053 Ga0105238_102240533 175
482 3300010375 Ga0105239_10123172 Ga0105239_101231721 175
483 3300010375 Ga0105239_10657279 Ga0105239_106572792 175
484 3300010375 Ga0105239_12281567 Ga0105239_122815671 175
485 3300013100 Ga0157373_10074116 Ga0157373_100741162 175
486 3300013102 Ga0157371_10250539 Ga0157371_102505392 175
487 3300013104 Ga0157370_10006013 Ga0157370_100060135 175
488 3300013105 Ga0157369_10006768 Ga0157369_100067685 175
489 3300013105 Ga0157369_10013029 Ga0157369_100130293 175
490 3300013105 Ga0157369_10029182 Ga0157369_100291822 175
491 3300013105 Ga0157369_10049012 Ga0157369_100490124 175
492 3300013105 Ga0157369_10174133 Ga0157369_101741332 175
493 3300013296 Ga0157374_10209290 Ga0157374_102092901 175
494 3300013306 Ga0163162_11310194 Ga0163162_113101941 175
495 3300013307 Ga0157372_10009279 Ga0157372_100092792 175
496 3300013307 Ga0157372_10019574 Ga0157372_100195746 175
497 3300013307 Ga0157372_10024713 Ga0157372_100247136 175
498 3300013307 Ga0157372_10032423 Ga0157372_100324233 175
499 3300013307 Ga0157372_10033385 Ga0157372_100333852 175
500 3300014325 Ga0163163_10208796 Ga0163163_102087962 175
501 3300020069 Ga0197907_10829533 Ga0197907_108295332 175
502 3300020080 Ga0206350_11567381 Ga0206350_115673812 175
503 3300022467 Ga0224712_10095936 Ga0224712_100959362 175
504 3300025321 Ga0207656_10032142 Ga0207656_100321423 175
505 3300025321 Ga0207656_10183225 Ga0207656_101832252 175
506 3300025898 Ga0207692_10141229 Ga0207692_101412292 175
507 3300025904 Ga0207647_10027128 Ga0207647_100271283 175
508 3300025909 Ga0207705_10030022 Ga0207705_100300222 175
509 3300025909 Ga0207705_10043479 Ga0207705_100434793 175
510 3300025909 Ga0207705_10249121 Ga0207705_102491213 175
511 3300025911 Ga0207654_10000011 Ga0207654_1000001159 175
512 3300025911 Ga0207654_10047004 Ga0207654_100470042 175
513 3300025911 Ga0207654_10771361 Ga0207654_107713611 175
514 3300025912 Ga0207707_10001986 Ga0207707_1000198610 175
515 3300025913 Ga0207695_10035120 Ga0207695_100351204 175
516 3300025913 Ga0207695_10043270 Ga0207695_100432702 175
517 3300025913 Ga0207695_11472545 Ga0207695_114725451 175
518 3300025915 Ga0207693_10052336 Ga0207693_100523364 175
519 3300025917 Ga0207660_10369493 Ga0207660_103694932 175
520 3300025919 Ga0207657_10013080 Ga0207657_100130803 175
521 3300025921 Ga0207652_10014706 Ga0207652_100147062 175
522 3300025921 Ga0207652_10277105 Ga0207652_102771052 175
523 3300025924 Ga0207694_10008091 Ga0207694_100080917 175
524 3300025924 Ga0207694_10073436 Ga0207694_100734363 175
525 3300025924 Ga0207694_10270238 Ga0207694_102702382 175
526 3300025944 Ga0207661_10199265 Ga0207661_101992652 175
527 3300025944 Ga0207661_10210480 Ga0207661_102104803 175
528 3300025945 Ga0207679_11321839 Ga0207679_113218391 175
529 3300025949 Ga0207667_10000256 Ga0207667_100002563 175
530 3300025949 Ga0207667_10019229 Ga0207667_100192296 175
531 3300025949 Ga0207667_10021293 Ga0207667_100212932 175
532 3300026067 Ga0207678_10143247 Ga0207678_101432471 175
533 3300026078 Ga0207702_10018636 Ga0207702_100186366 175
534 3300026078 Ga0207702_10037024 Ga0207702_100370241 175
535 3300026078 Ga0207702_10137858 Ga0207702_101378582 175
536 3300026078 Ga0207702_10704614 Ga0207702_107046142 175
537 3300026078 Ga0207702_11684322 Ga0207702_116843221 175
538 3300026116 Ga0207674_10004026 Ga0207674_100040268 175
539 3300026116 Ga0207674_10198877 Ga0207674_101988772 175
540 3300026142 Ga0207698_10024979 Ga0207698_100249792 175
541 3300026142 Ga0207698_10058211 Ga0207698_100582112 175
542 3300026142 Ga0207698_10129208 Ga0207698_101292083 175
543 3300031344 Ga0265316_10457447 Ga0265316_104574472 175
544 3300031711 Ga0265314_10185373 Ga0265314_101853732 175
545 3300046472 Ga0495580_0006771 Ga0495580_0006771_3719_4249 175
546 3300046543 Ga0495645_0080238 Ga0495645_0080238_1685_2215 175
547 3300046660 Ga0495625_0113032 Ga0495625_0113032_105_635 175
548 3300046684 Ga0495669_0081681 Ga0495669_0081681_759_1289 175
549 3300046694 Ga0495649_0301947 Ga0495649_0301947_24_554 175
550 3300048913 Ga0496110_0556835 Ga0496110_0556835_465_995 175
551 3300048914 Ga0496111_0036656 Ga0496111_0036656_709_1239 175
552 3300048929 Ga0496126_0031870 Ga0496126_0031870_1673_2203 175
553 3300053077 Ga0495601_0069811 Ga0495601_0069811_486_1016 175
554 3300013105 Ga0157369_10000248 Ga0157369_1000024852 180
555 3300049822 Ga0501035_0000205 Ga0501035_0000205_3359_3910 182
556 3300004799 Ga0058863_11760255 Ga0058863_117602551 183
557 3300006846 Ga0075430_100360252 Ga0075430_1003602522 183
558 3300006847 Ga0075431_100220497 Ga0075431_1002204972 183
559 3300048090 Ga0495615_0059596 Ga0495615_0059596_39_590 183
560 3300048903 Ga0496100_0163374 Ga0496100_0163374_989_1546 183
561 3300048928 Ga0496125_0390023 Ga0496125_0390023_29_586 183
562 3300050509 nmdc:mga0qj67_62961_c1 nmdc:mga0qj67_62961_c1_1576_2133 183
563 3300050510 nmdc:mga06r32_207981_c1 nmdc:mga06r32_207981_c1_469_1026 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

35

199

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w74-assembly2.cif.gz_B x-ray structure of peptidyl-prolyl cis-trans isomerase a, ppia, rv0009, from mycobacterium tuberculosis. 0.9072 13 180
1zkc-assembly2.cif.gz_B crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b 0.9051 11 179
3jb9-assembly1.cif.gz_d cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.9019 13 180
2b71-assembly1.cif.gz_A plasmodium yoelii cyclophilin-like protein 0.8979 14 178
2fu0-assembly1.cif.gz_A plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain 0.896 14 180
ID Description Score Start End Superfamily
1w74B00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9072 13 180 2.40.100.10
af_Q9FJX0_326_510_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8981 8 180 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8924 9 180 2.40.100.10
1w74B00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8867 13 180 2.40.100.10
1xyhA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8861 14 180 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A250IPL1-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.973 1 183 GO:0140839
GO:0140840
AF-A0A250IPL1-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9678 1 183 GO:0140839
GO:0140840
AF-A0A3A8IQQ2-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9673 3 183 GO:0006457
GO:0140839
GO:0140840
AF-A0A4Y6C485-F1-model_v4 deleted 0.9637 1 183
AF-A0A2N2PFY8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9619 13 182 GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
88.84 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map