F464049
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 563 | 240 | 563 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10000248|Ga0157369_1000024852 |
| Length | 202 |
| Sequence | LSKQSLSICIPQSAIRIADNPNLKGHTMARQPGTYATFDTSEGQIVCRLFEKEAPKTVKNFIDLAEGKRDWQDHVSGKKGPGPLYSGTIFHRVIPNFMIQGGDPSGTGMGGPGYKFEDETKGSPHKFDKAGKLAMANAGPNTNGSQFFITVAATDWLTGNHTIFGEVVEGQDVVDKITKLPRGAQDRPKKDIVLNSVKIEKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 177 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 178 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 179 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 180 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 214 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 215 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 216 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 238 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 2.84 |
| Rhizosphere | 96.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11760255 | 3300004799 | Bacteria | 832 |
| 2 | Ga0065715_10023042 | 3300005293 | Bacteria | 1880 |
| 3 | Ga0070658_10052670 | 3300005327 | Bacteria | 3301 |
| 4 | Ga0070658_10213561 | 3300005327 | Bacteria | 1630 |
| 5 | Ga0070683_100041067 | 3300005329 | Bacteria | 4254 |
| 6 | Ga0070683_100044167 | 3300005329 | Bacteria | 4109 |
| 7 | Ga0070683_100124525 | 3300005329 | Bacteria | 2436 |
| 8 | Ga0070683_100142571 | 3300005329 | Bacteria | 2270 |
| 9 | Ga0070683_100664148 | 3300005329 | Bacteria | 998 |
| 10 | Ga0070690_100986583 | 3300005330 | Bacteria | 663 |
| 11 | Ga0070677_10217253 | 3300005333 | Bacteria | 932 |
| 12 | Ga0068869_100003590 | 3300005334 | Bacteria | 9518 |
| 13 | Ga0068869_100223214 | 3300005334 | Bacteria | 1494 |
| 14 | Ga0070666_10313863 | 3300005335 | Bacteria | 1117 |
| 15 | Ga0070680_100128165 | 3300005336 | Bacteria | 2121 |
| 16 | Ga0070680_101208146 | 3300005336 | Bacteria | 654 |
| 17 | Ga0068868_100072804 | 3300005338 | Bacteria | 2742 |
| 18 | Ga0068868_100452295 | 3300005338 | Bacteria | 1117 |
| 19 | Ga0068868_100968659 | 3300005338 | Bacteria | 777 |
| 20 | Ga0070660_100013843 | 3300005339 | Bacteria | 5802 |
| 21 | Ga0070660_100081752 | 3300005339 | Bacteria | 2536 |
| 22 | Ga0070687_100074260 | 3300005343 | Unclassified | 1835 |
| 23 | Ga0070661_100033066 | 3300005344 | Bacteria | 3745 |
| 24 | Ga0070661_100121768 | 3300005344 | Bacteria | 1955 |
| 25 | Ga0070661_100655736 | 3300005344 | Unclassified | 852 |
| 26 | Ga0070671_100134777 | 3300005355 | Bacteria | 2082 |
| 27 | Ga0070673_100462759 | 3300005364 | Bacteria | 1142 |
| 28 | Ga0070659_100211219 | 3300005366 | Bacteria | 1599 |
| 29 | Ga0070659_100637659 | 3300005366 | Unclassified | 918 |
| 30 | Ga0070667_100541729 | 3300005367 | Bacteria | 1069 |
| 31 | Ga0070667_100707334 | 3300005367 | Bacteria | 932 |
| 32 | Ga0070709_10003110 | 3300005434 | Bacteria | 8906 |
| 33 | Ga0070709_10004804 | 3300005434 | Bacteria | 7301 |
| 34 | Ga0070709_10715669 | 3300005434 | Bacteria | 780 |
| 35 | Ga0070714_100001256 | 3300005435 | Bacteria | 18317 |
| 36 | Ga0070714_100012151 | 3300005435 | Bacteria | 6860 |
| 37 | Ga0070714_100051603 | 3300005435 | Bacteria | 3507 |
| 38 | Ga0070714_100053026 | 3300005435 | Bacteria | 3460 |
| 39 | Ga0070714_100136287 | 3300005435 | Bacteria | 2199 |
| 40 | Ga0070714_100264310 | 3300005435 | Unclassified | 1594 |
| 41 | Ga0070714_100395861 | 3300005435 | Bacteria | 1305 |
| 42 | Ga0070714_100707075 | 3300005435 | Bacteria | 972 |
| 43 | Ga0070714_101098546 | 3300005435 | Bacteria | 775 |
| 44 | Ga0070713_100000561 | 3300005436 | Bacteria | 23535 |
| 45 | Ga0070713_100003423 | 3300005436 | Bacteria | 10477 |
| 46 | Ga0070713_100006965 | 3300005436 | Bacteria | 7892 |
| 47 | Ga0070713_100194076 | 3300005436 | Bacteria | 1831 |
| 48 | Ga0070713_100232070 | 3300005436 | Bacteria | 1678 |
| 49 | Ga0070713_100369943 | 3300005436 | Bacteria | 1333 |
| 50 | Ga0070713_100382192 | 3300005436 | Bacteria | 1312 |
| 51 | Ga0070713_100475369 | 3300005436 | Bacteria | 1177 |
| 52 | Ga0070713_101459654 | 3300005436 | Bacteria | 664 |
| 53 | Ga0070710_10092133 | 3300005437 | Bacteria | 1789 |
| 54 | Ga0070710_10155662 | 3300005437 | Bacteria | 1413 |
| 55 | Ga0070710_10171162 | 3300005437 | Bacteria | 1353 |
| 56 | Ga0070710_10320596 | 3300005437 | Bacteria | 1017 |
| 57 | Ga0070711_100015990 | 3300005439 | Bacteria | 4756 |
| 58 | Ga0070711_100050824 | 3300005439 | Bacteria | 2844 |
| 59 | Ga0070711_100274139 | 3300005439 | Bacteria | 1332 |
| 60 | Ga0070708_100023076 | 3300005445 | Bacteria | 5284 |
| 61 | Ga0070708_100118735 | 3300005445 | Bacteria | 2437 |
| 62 | Ga0070708_100217505 | 3300005445 | Bacteria | 1791 |
| 63 | Ga0070708_100341472 | 3300005445 | Bacteria | 1411 |
| 64 | Ga0070708_100586325 | 3300005445 | Bacteria | 1051 |
| 65 | Ga0070663_100264861 | 3300005455 | Bacteria | 1364 |
| 66 | Ga0070678_100336646 | 3300005456 | Bacteria | 1293 |
| 67 | Ga0070681_10009675 | 3300005458 | Bacteria | 9483 |
| 68 | Ga0070681_10034238 | 3300005458 | Bacteria | 5101 |
| 69 | Ga0070681_10519452 | 3300005458 | Bacteria | 1104 |
| 70 | Ga0070685_10631073 | 3300005466 | Unclassified | 774 |
| 71 | Ga0070685_10751522 | 3300005466 | Bacteria | 715 |
| 72 | Ga0070706_100007211 | 3300005467 | Bacteria | 10448 |
| 73 | Ga0070706_100009023 | 3300005467 | Bacteria | 9285 |
| 74 | Ga0070706_100063107 | 3300005467 | Bacteria | 3424 |
| 75 | Ga0070706_100500873 | 3300005467 | Bacteria | 1130 |
| 76 | Ga0070707_100008857 | 3300005468 | Bacteria | 9329 |
| 77 | Ga0070707_100135932 | 3300005468 | Bacteria | 2391 |
| 78 | Ga0070707_100227823 | 3300005468 | Bacteria | 1815 |
| 79 | Ga0070707_100745583 | 3300005468 | Bacteria | 943 |
| 80 | Ga0070698_100004977 | 3300005471 | Bacteria | 14557 |
| 81 | Ga0070698_100118463 | 3300005471 | Bacteria | 2609 |
| 82 | Ga0070699_100001625 | 3300005518 | Bacteria | 20496 |
| 83 | Ga0070699_100063586 | 3300005518 | Bacteria | 3200 |
| 84 | Ga0070699_100281766 | 3300005518 | Bacteria | 1489 |
| 85 | Ga0070699_100748162 | 3300005518 | Bacteria | 894 |
| 86 | Ga0070679_100037623 | 3300005530 | Bacteria | 4808 |
| 87 | Ga0070679_100103655 | 3300005530 | Bacteria | 2831 |
| 88 | Ga0070679_100170881 | 3300005530 | Bacteria | 2147 |
| 89 | Ga0070679_100845831 | 3300005530 | Bacteria | 858 |
| 90 | Ga0070684_100005011 | 3300005535 | Bacteria | 10119 |
| 91 | Ga0070684_100074079 | 3300005535 | Bacteria | 3001 |
| 92 | Ga0070684_100085594 | 3300005535 | Bacteria | 2796 |
| 93 | Ga0070684_100148999 | 3300005535 | Bacteria | 2119 |
| 94 | Ga0070684_100287124 | 3300005535 | Bacteria | 1508 |
| 95 | Ga0070697_100000145 | 3300005536 | Bacteria | 57445 |
| 96 | Ga0070697_100001728 | 3300005536 | Bacteria | 16681 |
| 97 | Ga0070697_100539721 | 3300005536 | Bacteria | 1022 |
| 98 | Ga0068853_100133607 | 3300005539 | Bacteria | 2223 |
| 99 | Ga0068853_100491666 | 3300005539 | Bacteria | 1157 |
| 100 | Ga0070695_100109964 | 3300005545 | Bacteria | 1869 |
| 101 | Ga0070695_100181055 | 3300005545 | Bacteria | 1493 |
| 102 | Ga0070695_100655016 | 3300005545 | Bacteria | 829 |
| 103 | Ga0070695_100705510 | 3300005545 | Bacteria | 801 |
| 104 | Ga0070696_100556965 | 3300005546 | Unclassified | 919 |
| 105 | Ga0070693_100030451 | 3300005547 | Bacteria | 2950 |
| 106 | Ga0070693_100402711 | 3300005547 | Bacteria | 949 |
| 107 | Ga0070704_100821867 | 3300005549 | Bacteria | 831 |
| 108 | Ga0068855_100001957 | 3300005563 | Bacteria | 25569 |
| 109 | Ga0068855_100016701 | 3300005563 | Bacteria | 8827 |
| 110 | Ga0068855_100109727 | 3300005563 | Bacteria | 3168 |
| 111 | Ga0068855_100256147 | 3300005563 | Bacteria | 1951 |
| 112 | Ga0068855_101008255 | 3300005563 | Bacteria | 874 |
| 113 | Ga0068855_101266266 | 3300005563 | Bacteria | 764 |
| 114 | Ga0070664_100056564 | 3300005564 | Bacteria | 3333 |
| 115 | Ga0070664_100282504 | 3300005564 | Bacteria | 1497 |
| 116 | Ga0070664_101772964 | 3300005564 | Bacteria | 585 |
| 117 | Ga0068857_100001479 | 3300005577 | Bacteria | 18696 |
| 118 | Ga0068857_100171493 | 3300005577 | Bacteria | 1972 |
| 119 | Ga0068854_100007558 | 3300005578 | Bacteria | 6948 |
| 120 | Ga0068854_100014538 | 3300005578 | Bacteria | 5192 |
| 121 | Ga0068854_100034605 | 3300005578 | Bacteria | 3530 |
| 122 | Ga0068854_100041415 | 3300005578 | Bacteria | 3254 |
| 123 | Ga0068854_101474524 | 3300005578 | Bacteria | 617 |
| 124 | Ga0068856_100002269 | 3300005614 | Bacteria | 19838 |
| 125 | Ga0068856_100004334 | 3300005614 | Bacteria | 14150 |
| 126 | Ga0068856_100075564 | 3300005614 | Bacteria | 3337 |
| 127 | Ga0068856_100076832 | 3300005614 | Bacteria | 3308 |
| 128 | Ga0068856_100183604 | 3300005614 | Bacteria | 2105 |
| 129 | Ga0068856_100233363 | 3300005614 | Bacteria | 1855 |
| 130 | Ga0068856_100304661 | 3300005614 | Bacteria | 1611 |
| 131 | Ga0068856_100345122 | 3300005614 | Bacteria | 1507 |
| 132 | Ga0068856_100439639 | 3300005614 | Bacteria | 1325 |
| 133 | Ga0070702_100193166 | 3300005615 | Unclassified | 1341 |
| 134 | Ga0068852_100148767 | 3300005616 | Bacteria | 2175 |
| 135 | Ga0068852_100170184 | 3300005616 | Bacteria | 2041 |
| 136 | Ga0068852_100180806 | 3300005616 | Bacteria | 1983 |
| 137 | Ga0068852_100183502 | 3300005616 | Bacteria | 1969 |
| 138 | Ga0068864_100007060 | 3300005618 | Bacteria | 9222 |
| 139 | Ga0068864_100100058 | 3300005618 | Bacteria | 2569 |
| 140 | Ga0068866_10060626 | 3300005718 | Unclassified | 1962 |
| 141 | Ga0068866_10091952 | 3300005718 | Bacteria | 1654 |
| 142 | Ga0068851_10002574 | 3300005834 | Bacteria | 7980 |
| 143 | Ga0068851_10065600 | 3300005834 | Bacteria | 1869 |
| 144 | Ga0068870_10063990 | 3300005840 | Bacteria | 1985 |
| 145 | Ga0068863_100099970 | 3300005841 | Bacteria | 2756 |
| 146 | Ga0068858_100004940 | 3300005842 | Bacteria | 13064 |
| 147 | Ga0068858_100057600 | 3300005842 | Bacteria | 3591 |
| 148 | Ga0068858_100091600 | 3300005842 | Bacteria | 2830 |
| 149 | Ga0068858_100189314 | 3300005842 | Bacteria | 1944 |
| 150 | Ga0068858_100640560 | 3300005842 | Bacteria | 1032 |
| 151 | Ga0068860_100068668 | 3300005843 | Bacteria | 3368 |
| 152 | Ga0068862_100110109 | 3300005844 | Bacteria | 2417 |
| 153 | Ga0070717_10014604 | 3300006028 | Bacteria | 6047 |
| 154 | Ga0070717_10034560 | 3300006028 | Bacteria | 4087 |
| 155 | Ga0070717_10122066 | 3300006028 | Bacteria | 2233 |
| 156 | Ga0070717_10187238 | 3300006028 | Bacteria | 1807 |
| 157 | Ga0070717_10385599 | 3300006028 | Bacteria | 1257 |
| 158 | Ga0070717_10571232 | 3300006028 | Bacteria | 1025 |
| 159 | Ga0070717_11045725 | 3300006028 | Bacteria | 744 |
| 160 | Ga0075364_10639439 | 3300006051 | Bacteria | 727 |
| 161 | Ga0070716_100001403 | 3300006173 | Bacteria | 10679 |
| 162 | Ga0070716_100182815 | 3300006173 | Bacteria | 1378 |
| 163 | Ga0070716_100185412 | 3300006173 | Bacteria | 1370 |
| 164 | Ga0070716_100190027 | 3300006173 | Bacteria | 1356 |
| 165 | Ga0070712_100002903 | 3300006175 | Bacteria | 10625 |
| 166 | Ga0070712_100031245 | 3300006175 | Bacteria | 3585 |
| 167 | Ga0070712_100121046 | 3300006175 | Bacteria | 1969 |
| 168 | Ga0070712_100182307 | 3300006175 | Unclassified | 1637 |
| 169 | Ga0070712_100234831 | 3300006175 | Bacteria | 1458 |
| 170 | Ga0070712_100961830 | 3300006175 | Bacteria | 738 |
| 171 | Ga0070712_101401488 | 3300006175 | Bacteria | 610 |
| 172 | Ga0097621_100011526 | 3300006237 | Bacteria | 6514 |
| 173 | Ga0097621_100020441 | 3300006237 | Bacteria | 5102 |
| 174 | Ga0097621_100053947 | 3300006237 | Bacteria | 3277 |
| 175 | Ga0097621_100208487 | 3300006237 | Bacteria | 1699 |
| 176 | Ga0097621_100339171 | 3300006237 | Bacteria | 1334 |
| 177 | Ga0097621_100402432 | 3300006237 | Bacteria | 1226 |
| 178 | Ga0068871_100000307 | 3300006358 | Bacteria | 34112 |
| 179 | Ga0068871_100000339 | 3300006358 | Bacteria | 32397 |
| 180 | Ga0068871_100379024 | 3300006358 | Bacteria | 1256 |
| 181 | Ga0075428_100032787 | 3300006844 | Bacteria | 5736 |
| 182 | Ga0075430_100360252 | 3300006846 | Bacteria | 1201 |
| 183 | Ga0075431_100220497 | 3300006847 | Bacteria | 1935 |
| 184 | Ga0075434_100200928 | 3300006871 | Bacteria | 2013 |
| 185 | Ga0075434_100318789 | 3300006871 | Bacteria | 1575 |
| 186 | Ga0075434_101182740 | 3300006871 | Bacteria | 777 |
| 187 | Ga0075429_100053455 | 3300006880 | Bacteria | 3514 |
| 188 | Ga0075429_100247864 | 3300006880 | Bacteria | 1560 |
| 189 | Ga0068865_100419410 | 3300006881 | Bacteria | 1100 |
| 190 | Ga0075436_100005040 | 3300006914 | Bacteria | 9083 |
| 191 | Ga0075436_100034148 | 3300006914 | Bacteria | 3507 |
| 192 | Ga0075436_100088630 | 3300006914 | Bacteria | 2149 |
| 193 | Ga0075436_100143793 | 3300006914 | Bacteria | 1677 |
| 194 | Ga0075435_100003987 | 3300007076 | Bacteria | 10091 |
| 195 | Ga0075435_100217413 | 3300007076 | Bacteria | 1622 |
| 196 | Ga0075435_100499857 | 3300007076 | Bacteria | 1051 |
| 197 | Ga0105240_10008591 | 3300009093 | Bacteria | 14599 |
| 198 | Ga0105240_10019287 | 3300009093 | Bacteria | 9115 |
| 199 | Ga0105240_10025122 | 3300009093 | Bacteria | 7836 |
| 200 | Ga0105240_10049516 | 3300009093 | Bacteria | 5302 |
| 201 | Ga0105240_10057142 | 3300009093 | Bacteria | 4878 |
| 202 | Ga0105240_10197102 | 3300009093 | Bacteria | 2363 |
| 203 | Ga0105240_10554107 | 3300009093 | Bacteria | 1272 |
| 204 | Ga0105240_10574038 | 3300009093 | Bacteria | 1245 |
| 205 | Ga0105240_10996832 | 3300009093 | Bacteria | 896 |
| 206 | Ga0111539_10280216 | 3300009094 | Bacteria | 1940 |
| 207 | Ga0111539_11118300 | 3300009094 | Unclassified | 915 |
| 208 | Ga0105245_10002176 | 3300009098 | Bacteria | 17754 |
| 209 | Ga0105245_10082073 | 3300009098 | Unclassified | 2948 |
| 210 | Ga0114129_10055986 | 3300009147 | Bacteria | 5526 |
| 211 | Ga0114129_10518278 | 3300009147 | Bacteria | 1555 |
| 212 | Ga0105241_10000052 | 3300009174 | Bacteria | 94908 |
| 213 | Ga0105241_10043271 | 3300009174 | Bacteria | 3411 |
| 214 | Ga0105241_10045117 | 3300009174 | Bacteria | 3343 |
| 215 | Ga0105241_10121097 | 3300009174 | Bacteria | 2107 |
| 216 | Ga0105241_10328491 | 3300009174 | Bacteria | 1321 |
| 217 | Ga0105241_10425804 | 3300009174 | Bacteria | 1169 |
| 218 | Ga0105242_10011211 | 3300009176 | Bacteria | 6888 |
| 219 | Ga0105242_11095012 | 3300009176 | Bacteria | 810 |
| 220 | Ga0105248_10010903 | 3300009177 | Bacteria | 10029 |
| 221 | Ga0105248_10013443 | 3300009177 | Bacteria | 9012 |
| 222 | Ga0105248_10297618 | 3300009177 | Bacteria | 1817 |
| 223 | Ga0105248_10730083 | 3300009177 | Bacteria | 1117 |
| 224 | Ga0105237_10119543 | 3300009545 | Bacteria | 2629 |
| 225 | Ga0105237_10158463 | 3300009545 | Bacteria | 2261 |
| 226 | Ga0105237_10555077 | 3300009545 | Bacteria | 1155 |
| 227 | Ga0105237_10606168 | 3300009545 | Bacteria | 1102 |
| 228 | Ga0105238_10009357 | 3300009551 | Bacteria | 9813 |
| 229 | Ga0105238_10024062 | 3300009551 | Bacteria | 6210 |
| 230 | Ga0105238_10088247 | 3300009551 | Bacteria | 3088 |
| 231 | Ga0105238_10135659 | 3300009551 | Bacteria | 2438 |
| 232 | Ga0105238_10224053 | 3300009551 | Bacteria | 1857 |
| 233 | Ga0105238_10503203 | 3300009551 | Bacteria | 1213 |
| 234 | Ga0105238_10559157 | 3300009551 | Eukaryota | 1149 |
| 235 | Ga0105249_11328025 | 3300009553 | Bacteria | 791 |
| 236 | Ga0105239_10106363 | 3300010375 | Bacteria | 3108 |
| 237 | Ga0105239_10123172 | 3300010375 | Bacteria | 2881 |
| 238 | Ga0105239_10531590 | 3300010375 | Bacteria | 1338 |
| 239 | Ga0105239_10538097 | 3300010375 | Bacteria | 1330 |
| 240 | Ga0105239_10657279 | 3300010375 | Unclassified | 1197 |
| 241 | Ga0105239_12281567 | 3300010375 | Bacteria | 630 |
| 242 | Ga0105246_10369540 | 3300011119 | Bacteria | 1181 |
| 243 | Ga0157373_10026248 | 3300013100 | Bacteria | 4210 |
| 244 | Ga0157373_10074116 | 3300013100 | Bacteria | 2401 |
| 245 | Ga0157371_10250539 | 3300013102 | Bacteria | 1275 |
| 246 | Ga0157370_10006013 | 3300013104 | Bacteria | 13502 |
| 247 | Ga0157370_10007683 | 3300013104 | Bacteria | 11700 |
| 248 | Ga0157369_10000248 | 3300013105 | Bacteria | 74496 |
| 249 | Ga0157369_10006768 | 3300013105 | Bacteria | 13228 |
| 250 | Ga0157369_10013029 | 3300013105 | Bacteria | 9418 |
| 251 | Ga0157369_10026761 | 3300013105 | Bacteria | 6397 |
| 252 | Ga0157369_10029182 | 3300013105 | Bacteria | 6098 |
| 253 | Ga0157369_10049012 | 3300013105 | Bacteria | 4581 |
| 254 | Ga0157369_10139818 | 3300013105 | Bacteria | 2563 |
| 255 | Ga0157369_10174133 | 3300013105 | Bacteria | 2266 |
| 256 | Ga0157374_10000154 | 3300013296 | Bacteria | 63162 |
| 257 | Ga0157374_10022027 | 3300013296 | Bacteria | 5679 |
| 258 | Ga0157374_10180694 | 3300013296 | Bacteria | 2061 |
| 259 | Ga0157374_10209290 | 3300013296 | Bacteria | 1912 |
| 260 | Ga0157378_10000150 | 3300013297 | Bacteria | 65230 |
| 261 | Ga0157378_10000304 | 3300013297 | Bacteria | 47798 |
| 262 | Ga0163162_10735141 | 3300013306 | Bacteria | 1107 |
| 263 | Ga0163162_11310194 | 3300013306 | Bacteria | 823 |
| 264 | Ga0157372_10000300 | 3300013307 | Bacteria | 54975 |
| 265 | Ga0157372_10000997 | 3300013307 | Bacteria | 30906 |
| 266 | Ga0157372_10009279 | 3300013307 | Bacteria | 10463 |
| 267 | Ga0157372_10017656 | 3300013307 | Bacteria | 7657 |
| 268 | Ga0157372_10019574 | 3300013307 | Bacteria | 7296 |
| 269 | Ga0157372_10024713 | 3300013307 | Bacteria | 6530 |
| 270 | Ga0157372_10032423 | 3300013307 | Bacteria | 5729 |
| 271 | Ga0157372_10033385 | 3300013307 | Bacteria | 5652 |
| 272 | Ga0157372_10119574 | 3300013307 | Bacteria | 3024 |
| 273 | Ga0157372_10170881 | 3300013307 | Bacteria | 2515 |
| 274 | Ga0157372_10309092 | 3300013307 | Bacteria | 1840 |
| 275 | Ga0157372_10339677 | 3300013307 | Bacteria | 1749 |
| 276 | Ga0157372_10686359 | 3300013307 | Bacteria | 1192 |
| 277 | Ga0163163_10118556 | 3300014325 | Bacteria | 2679 |
| 278 | Ga0163163_10165950 | 3300014325 | Bacteria | 2254 |
| 279 | Ga0163163_10208796 | 3300014325 | Bacteria | 2001 |
| 280 | Ga0157380_10007372 | 3300014326 | Bacteria | 7809 |
| 281 | Ga0157380_10221955 | 3300014326 | Bacteria | 1691 |
| 282 | Ga0182008_10070523 | 3300014497 | Bacteria | 1719 |
| 283 | Ga0157377_10478559 | 3300014745 | Bacteria | 866 |
| 284 | Ga0157376_10006505 | 3300014969 | Bacteria | 8260 |
| 285 | Ga0157376_10086957 | 3300014969 | Bacteria | 2696 |
| 286 | Ga0157376_10503378 | 3300014969 | Bacteria | 1191 |
| 287 | Ga0182007_10006014 | 3300015262 | Bacteria | 5255 |
| 288 | Ga0182005_1080866 | 3300015265 | Bacteria | 897 |
| 289 | Ga0197907_10829533 | 3300020069 | Bacteria | 894 |
| 290 | Ga0206350_11567381 | 3300020080 | Bacteria | 1179 |
| 291 | Ga0224712_10095936 | 3300022467 | Bacteria | 1250 |
| 292 | Ga0207656_10032142 | 3300025321 | Bacteria | 2178 |
| 293 | Ga0207656_10183225 | 3300025321 | Bacteria | 1006 |
| 294 | Ga0207692_10080219 | 3300025898 | Bacteria | 1743 |
| 295 | Ga0207692_10141229 | 3300025898 | Bacteria | 1370 |
| 296 | Ga0207692_10145261 | 3300025898 | Bacteria | 1353 |
| 297 | Ga0207642_10001798 | 3300025899 | Bacteria | 6631 |
| 298 | Ga0207642_10323696 | 3300025899 | Bacteria | 901 |
| 299 | Ga0207680_10026904 | 3300025903 | Bacteria | 3194 |
| 300 | Ga0207647_10027128 | 3300025904 | Bacteria | 3737 |
| 301 | Ga0207685_10023264 | 3300025905 | Unclassified | 2107 |
| 302 | Ga0207699_10004141 | 3300025906 | Bacteria | 6944 |
| 303 | Ga0207699_10005666 | 3300025906 | Bacteria | 5998 |
| 304 | Ga0207699_10060875 | 3300025906 | Bacteria | 2269 |
| 305 | Ga0207699_10357543 | 3300025906 | Bacteria | 1032 |
| 306 | Ga0207699_10809648 | 3300025906 | Bacteria | 689 |
| 307 | Ga0207705_10030022 | 3300025909 | Bacteria | 3878 |
| 308 | Ga0207705_10043479 | 3300025909 | Bacteria | 3227 |
| 309 | Ga0207705_10249121 | 3300025909 | Bacteria | 1354 |
| 310 | Ga0207705_10489834 | 3300025909 | Bacteria | 954 |
| 311 | Ga0207684_10002114 | 3300025910 | Bacteria | 20371 |
| 312 | Ga0207684_10085781 | 3300025910 | Bacteria | 2681 |
| 313 | Ga0207684_10185562 | 3300025910 | Bacteria | 1793 |
| 314 | Ga0207654_10000011 | 3300025911 | Bacteria | 245470 |
| 315 | Ga0207654_10047004 | 3300025911 | Bacteria | 2464 |
| 316 | Ga0207654_10311004 | 3300025911 | Bacteria | 1074 |
| 317 | Ga0207654_10345879 | 3300025911 | Bacteria | 1023 |
| 318 | Ga0207654_10771361 | 3300025911 | Unclassified | 693 |
| 319 | Ga0207707_10001986 | 3300025912 | Bacteria | 18580 |
| 320 | Ga0207707_10031615 | 3300025912 | Bacteria | 4632 |
| 321 | Ga0207695_10032249 | 3300025913 | Bacteria | 5736 |
| 322 | Ga0207695_10035120 | 3300025913 | Bacteria | 5441 |
| 323 | Ga0207695_10043270 | 3300025913 | Bacteria | 4800 |
| 324 | Ga0207695_10045564 | 3300025913 | Bacteria | 4654 |
| 325 | Ga0207695_10094055 | 3300025913 | Unclassified | 3006 |
| 326 | Ga0207695_11472545 | 3300025913 | Bacteria | 561 |
| 327 | Ga0207671_10467806 | 3300025914 | Bacteria | 1005 |
| 328 | Ga0207693_10001147 | 3300025915 | Bacteria | 23663 |
| 329 | Ga0207693_10038670 | 3300025915 | Bacteria | 3756 |
| 330 | Ga0207693_10052336 | 3300025915 | Bacteria | 3203 |
| 331 | Ga0207693_10178940 | 3300025915 | Bacteria | 1669 |
| 332 | Ga0207693_10297153 | 3300025915 | Bacteria | 1265 |
| 333 | Ga0207693_10703130 | 3300025915 | Bacteria | 783 |
| 334 | Ga0207663_10015113 | 3300025916 | Bacteria | 4251 |
| 335 | Ga0207663_10170913 | 3300025916 | Bacteria | 1544 |
| 336 | Ga0207663_10398284 | 3300025916 | Bacteria | 1052 |
| 337 | Ga0207660_10369493 | 3300025917 | Bacteria | 1152 |
| 338 | Ga0207662_10118711 | 3300025918 | Unclassified | 1657 |
| 339 | Ga0207662_10131115 | 3300025918 | Unclassified | 1580 |
| 340 | Ga0207657_10000197 | 3300025919 | Bacteria | 62537 |
| 341 | Ga0207657_10013080 | 3300025919 | Bacteria | 8156 |
| 342 | Ga0207649_10588485 | 3300025920 | Unclassified | 855 |
| 343 | Ga0207652_10014706 | 3300025921 | Bacteria | 6342 |
| 344 | Ga0207652_10138644 | 3300025921 | Bacteria | 2173 |
| 345 | Ga0207652_10141593 | 3300025921 | Bacteria | 2151 |
| 346 | Ga0207652_10277105 | 3300025921 | Bacteria | 1513 |
| 347 | Ga0207652_10385502 | 3300025921 | Bacteria | 1265 |
| 348 | Ga0207652_11061878 | 3300025921 | Bacteria | 710 |
| 349 | Ga0207646_10005280 | 3300025922 | Bacteria | 13621 |
| 350 | Ga0207646_10069986 | 3300025922 | Bacteria | 3134 |
| 351 | Ga0207646_10544165 | 3300025922 | Bacteria | 1044 |
| 352 | Ga0207646_10606447 | 3300025922 | Bacteria | 982 |
| 353 | Ga0207646_10647779 | 3300025922 | Bacteria | 946 |
| 354 | Ga0207694_10008091 | 3300025924 | Bacteria | 7948 |
| 355 | Ga0207694_10009653 | 3300025924 | Bacteria | 7276 |
| 356 | Ga0207694_10073436 | 3300025924 | Bacteria | 2676 |
| 357 | Ga0207694_10270238 | 3300025924 | Bacteria | 1394 |
| 358 | Ga0207694_10307972 | 3300025924 | Bacteria | 1305 |
| 359 | Ga0207694_10519720 | 3300025924 | Unclassified | 997 |
| 360 | Ga0207687_10070351 | 3300025927 | Bacteria | 2498 |
| 361 | Ga0207687_10324639 | 3300025927 | Unclassified | 1247 |
| 362 | Ga0207687_10336549 | 3300025927 | Bacteria | 1226 |
| 363 | Ga0207700_10000650 | 3300025928 | Bacteria | 20313 |
| 364 | Ga0207700_10017040 | 3300025928 | Bacteria | 4841 |
| 365 | Ga0207700_10096067 | 3300025928 | Bacteria | 2352 |
| 366 | Ga0207700_10227432 | 3300025928 | Bacteria | 1584 |
| 367 | Ga0207700_10336239 | 3300025928 | Bacteria | 1312 |
| 368 | Ga0207700_10590262 | 3300025928 | Bacteria | 988 |
| 369 | Ga0207700_10874691 | 3300025928 | Bacteria | 804 |
| 370 | Ga0207664_10012965 | 3300025929 | Bacteria | 5973 |
| 371 | Ga0207664_10022896 | 3300025929 | Bacteria | 4673 |
| 372 | Ga0207664_10153315 | 3300025929 | Bacteria | 1959 |
| 373 | Ga0207664_10231318 | 3300025929 | Unclassified | 1607 |
| 374 | Ga0207664_10412994 | 3300025929 | Bacteria | 1202 |
| 375 | Ga0207644_10086418 | 3300025931 | Bacteria | 2329 |
| 376 | Ga0207706_10096751 | 3300025933 | Bacteria | 2596 |
| 377 | Ga0207686_10011425 | 3300025934 | Bacteria | 4862 |
| 378 | Ga0207669_10101701 | 3300025937 | Bacteria | 1902 |
| 379 | Ga0207665_10052713 | 3300025939 | Bacteria | 2741 |
| 380 | Ga0207665_10184792 | 3300025939 | Bacteria | 1511 |
| 381 | Ga0207711_10161154 | 3300025941 | Bacteria | 2030 |
| 382 | Ga0207689_10001515 | 3300025942 | Bacteria | 22101 |
| 383 | Ga0207689_10172961 | 3300025942 | Bacteria | 1781 |
| 384 | Ga0207661_10199265 | 3300025944 | Bacteria | 1759 |
| 385 | Ga0207661_10210480 | 3300025944 | Bacteria | 1713 |
| 386 | Ga0207661_10491536 | 3300025944 | Bacteria | 1121 |
| 387 | Ga0207679_10126953 | 3300025945 | Bacteria | 2040 |
| 388 | Ga0207679_11167425 | 3300025945 | Bacteria | 706 |
| 389 | Ga0207679_11321839 | 3300025945 | Bacteria | 661 |
| 390 | Ga0207667_10000256 | 3300025949 | Bacteria | 74992 |
| 391 | Ga0207667_10000811 | 3300025949 | Bacteria | 40517 |
| 392 | Ga0207667_10019229 | 3300025949 | Bacteria | 7635 |
| 393 | Ga0207667_10021293 | 3300025949 | Bacteria | 7186 |
| 394 | Ga0207667_10681397 | 3300025949 | Bacteria | 1031 |
| 395 | Ga0207667_10803690 | 3300025949 | Bacteria | 937 |
| 396 | Ga0207667_11219837 | 3300025949 | Bacteria | 731 |
| 397 | Ga0207651_10156959 | 3300025960 | Bacteria | 1779 |
| 398 | Ga0207640_10031625 | 3300025981 | Bacteria | 3272 |
| 399 | Ga0207640_10089179 | 3300025981 | Bacteria | 2131 |
| 400 | Ga0207640_10202151 | 3300025981 | Bacteria | 1506 |
| 401 | Ga0207658_10311026 | 3300025986 | Bacteria | 1361 |
| 402 | Ga0207677_10022484 | 3300026023 | Bacteria | 3876 |
| 403 | Ga0207677_10131606 | 3300026023 | Bacteria | 1900 |
| 404 | Ga0207677_10498317 | 3300026023 | Bacteria | 1052 |
| 405 | Ga0207703_10025243 | 3300026035 | Bacteria | 4674 |
| 406 | Ga0207703_10066459 | 3300026035 | Bacteria | 2966 |
| 407 | Ga0207639_10533201 | 3300026041 | Bacteria | 1076 |
| 408 | Ga0207639_10548288 | 3300026041 | Bacteria | 1061 |
| 409 | Ga0207678_10143247 | 3300026067 | Bacteria | 2040 |
| 410 | Ga0207702_10003463 | 3300026078 | Bacteria | 14386 |
| 411 | Ga0207702_10018636 | 3300026078 | Bacteria | 5743 |
| 412 | Ga0207702_10037024 | 3300026078 | Bacteria | 4082 |
| 413 | Ga0207702_10056413 | 3300026078 | Bacteria | 3335 |
| 414 | Ga0207702_10063092 | 3300026078 | Bacteria | 3168 |
| 415 | Ga0207702_10137858 | 3300026078 | Bacteria | 2204 |
| 416 | Ga0207702_10146734 | 3300026078 | Bacteria | 2142 |
| 417 | Ga0207702_10704614 | 3300026078 | Bacteria | 995 |
| 418 | Ga0207702_10811390 | 3300026078 | Bacteria | 925 |
| 419 | Ga0207702_11684322 | 3300026078 | Bacteria | 627 |
| 420 | Ga0207641_10022718 | 3300026088 | Bacteria | 5164 |
| 421 | Ga0207641_10573247 | 3300026088 | Bacteria | 1103 |
| 422 | Ga0207648_10030759 | 3300026089 | Bacteria | 4751 |
| 423 | Ga0207676_10152594 | 3300026095 | Bacteria | 1991 |
| 424 | Ga0207676_10458757 | 3300026095 | Bacteria | 1203 |
| 425 | Ga0207674_10004026 | 3300026116 | Bacteria | 17845 |
| 426 | Ga0207674_10169286 | 3300026116 | Bacteria | 2138 |
| 427 | Ga0207674_10198877 | 3300026116 | Bacteria | 1954 |
| 428 | Ga0207675_100389349 | 3300026118 | Bacteria | 1372 |
| 429 | Ga0207683_10679633 | 3300026121 | Bacteria | 954 |
| 430 | Ga0207698_10024979 | 3300026142 | Bacteria | 4200 |
| 431 | Ga0207698_10058211 | 3300026142 | Bacteria | 2994 |
| 432 | Ga0207698_10129208 | 3300026142 | Bacteria | 2156 |
| 433 | Ga0207698_10427628 | 3300026142 | Bacteria | 1272 |
| 434 | Ga0207428_10000729 | 3300027907 | Bacteria | 37940 |
| 435 | Ga0268265_10126313 | 3300028380 | Bacteria | 2117 |
| 436 | Ga0265338_10010004 | 3300028800 | Bacteria | 11213 |
| 437 | Ga0265332_10026266 | 3300031238 | Bacteria | 2554 |
| 438 | Ga0265328_10027309 | 3300031239 | Bacteria | 2140 |
| 439 | Ga0265340_10025269 | 3300031247 | Bacteria | 3010 |
| 440 | Ga0265339_10006686 | 3300031249 | Bacteria | 7537 |
| 441 | Ga0265339_10058157 | 3300031249 | Bacteria | 2089 |
| 442 | Ga0265339_10183574 | 3300031249 | Bacteria | 1040 |
| 443 | Ga0265316_10004401 | 3300031344 | Bacteria | 14029 |
| 444 | Ga0265316_10023588 | 3300031344 | Bacteria | 5167 |
| 445 | Ga0265316_10063187 | 3300031344 | Bacteria | 2872 |
| 446 | Ga0265316_10335322 | 3300031344 | Bacteria | 1097 |
| 447 | Ga0265316_10457447 | 3300031344 | Bacteria | 915 |
| 448 | Ga0307408_100011185 | 3300031548 | Bacteria | 5928 |
| 449 | Ga0307408_100955320 | 3300031548 | Bacteria | 787 |
| 450 | Ga0265314_10007310 | 3300031711 | Bacteria | 9593 |
| 451 | Ga0265314_10185373 | 3300031711 | Bacteria | 1243 |
| 452 | Ga0307405_10007949 | 3300031731 | Bacteria | 5347 |
| 453 | Ga0307413_10370910 | 3300031824 | Bacteria | 1112 |
| 454 | Ga0307413_10463288 | 3300031824 | Bacteria | 1009 |
| 455 | Ga0307410_10002296 | 3300031852 | Bacteria | 9182 |
| 456 | Ga0307406_10015960 | 3300031901 | Bacteria | 4355 |
| 457 | Ga0307407_10344506 | 3300031903 | Bacteria | 1053 |
| 458 | Ga0307412_10035507 | 3300031911 | Bacteria | 3186 |
| 459 | Ga0307409_100039932 | 3300031995 | Bacteria | 3488 |
| 460 | Ga0307409_100042750 | 3300031995 | Bacteria | 3396 |
| 461 | Ga0307416_100100356 | 3300032002 | Bacteria | 2517 |
| 462 | Ga0307416_100554448 | 3300032002 | Bacteria | 1223 |
| 463 | Ga0307416_101054101 | 3300032002 | Bacteria | 917 |
| 464 | Ga0307414_10042092 | 3300032004 | Bacteria | 3101 |
| 465 | Ga0307411_10009396 | 3300032005 | Bacteria | 5137 |
| 466 | Ga0307415_101305563 | 3300032126 | Bacteria | 687 |
| 467 | Ga0316583_10137355 | 3300032133 | Bacteria | 852 |
| 468 | Ga0373943_0328304 | 3300035170 | Bacteria | 873 |
| 469 | Ga0373924_0209887 | 3300035410 | Bacteria | 860 |
| 470 | Ga0373937_0025926 | 3300036401 | Bacteria | 5295 |
| 471 | Ga0373925_0563606 | 3300037068 | Bacteria | 937 |
| 472 | Ga0436361_0570038 | 3300039447 | Bacteria | 627 |
| 473 | Ga0436362_0161998 | 3300039453 | Bacteria | 1185 |
| 474 | Ga0439443_017840 | 3300042003 | Bacteria | 1095 |
| 475 | Ga0450923_017639 | 3300042125 | Bacteria | 1358 |
| 476 | Ga0439435_0091827 | 3300042436 | Bacteria | 923 |
| 477 | Ga0439444_0003896 | 3300042437 | Bacteria | 2136 |
| 478 | Ga0451577_0000531 | 3300042876 | Bacteria | 63238 |
| 479 | Ga0451577_0053755 | 3300042876 | Bacteria | 3595 |
| 480 | Ga0451577_0108498 | 3300042876 | Bacteria | 2482 |
| 481 | Ga0453683_0116047 | 3300044673 | Bacteria | 1684 |
| 482 | Ga0453683_0153659 | 3300044673 | Bacteria | 1455 |
| 483 | Ga0466963_0045901 | 3300044694 | Bacteria | 2879 |
| 484 | Ga0466963_0147076 | 3300044694 | Bacteria | 1635 |
| 485 | Ga0453684_0000324 | 3300044712 | Bacteria | 201431 |
| 486 | Ga0466971_0070859 | 3300044719 | Bacteria | 1583 |
| 487 | Ga0466959_0130094 | 3300045049 | Bacteria | 1784 |
| 488 | Ga0466959_0371951 | 3300045049 | Bacteria | 973 |
| 489 | Ga0451576_0021212 | 3300045051 | Bacteria | 7062 |
| 490 | Ga0451576_0033685 | 3300045051 | Bacteria | 5444 |
| 491 | Ga0451576_0145465 | 3300045051 | Bacteria | 2471 |
| 492 | Ga0466958_0022113 | 3300045836 | Bacteria | 3722 |
| 493 | Ga0466967_0001591 | 3300045976 | Bacteria | 13359 |
| 494 | Ga0466967_0371021 | 3300045976 | Bacteria | 1388 |
| 495 | Ga0466967_1452953 | 3300045976 | Bacteria | 683 |
| 496 | Ga0495629_0472364 | 3300046459 | Bacteria | 848 |
| 497 | Ga0495580_0006771 | 3300046472 | Bacteria | 9291 |
| 498 | Ga0495594_0266368 | 3300046499 | Bacteria | 976 |
| 499 | Ga0495644_0197969 | 3300046523 | Bacteria | 774 |
| 500 | Ga0495621_0006597 | 3300046539 | Bacteria | 3397 |
| 501 | Ga0495645_0080238 | 3300046543 | Bacteria | 2343 |
| 502 | Ga0495656_0023391 | 3300046615 | Bacteria | 2432 |
| 503 | Ga0495625_0113032 | 3300046660 | Bacteria | 1855 |
| 504 | Ga0495669_0081681 | 3300046684 | Bacteria | 1484 |
| 505 | Ga0495649_0301947 | 3300046694 | Bacteria | 815 |
| 506 | Ga0495674_0182167 | 3300047319 | Bacteria | 1749 |
| 507 | Ga0495615_0059596 | 3300048090 | Bacteria | 1004 |
| 508 | Ga0496100_0163374 | 3300048903 | Bacteria | 1598 |
| 509 | Ga0496101_0169550 | 3300048904 | Bacteria | 1677 |
| 510 | Ga0496102_0083967 | 3300048905 | Bacteria | 2939 |
| 511 | Ga0496104_0244559 | 3300048907 | Bacteria | 1707 |
| 512 | Ga0496104_0421922 | 3300048907 | Bacteria | 1246 |
| 513 | Ga0496105_0147599 | 3300048908 | Bacteria | 1934 |
| 514 | Ga0496106_0305646 | 3300048909 | Bacteria | 1276 |
| 515 | Ga0496108_0092946 | 3300048911 | Bacteria | 2565 |
| 516 | Ga0496109_0445974 | 3300048912 | Bacteria | 1222 |
| 517 | Ga0496110_0556835 | 3300048913 | Unclassified | 1042 |
| 518 | Ga0496110_0643912 | 3300048913 | Bacteria | 959 |
| 519 | Ga0496111_0036656 | 3300048914 | Bacteria | 3507 |
| 520 | Ga0496111_0104626 | 3300048914 | Bacteria | 2082 |
| 521 | Ga0496111_0235764 | 3300048914 | Bacteria | 1359 |
| 522 | Ga0496112_0133583 | 3300048915 | Bacteria | 2452 |
| 523 | Ga0496112_0337931 | 3300048915 | Bacteria | 1449 |
| 524 | Ga0496125_0390023 | 3300048928 | Bacteria | 818 |
| 525 | Ga0496126_0031870 | 3300048929 | Bacteria | 4973 |
| 526 | Ga0501297_005766 | 3300049520 | Bacteria | 1304 |
| 527 | Ga0501031_0153587 | 3300049568 | Bacteria | 1505 |
| 528 | Ga0501036_0318747 | 3300049572 | Bacteria | 1299 |
| 529 | Ga0501040_0120964 | 3300049576 | Bacteria | 1837 |
| 530 | Ga0501042_0222963 | 3300049578 | Bacteria | 1360 |
| 531 | Ga0501069_0251452 | 3300049585 | Bacteria | 1031 |
| 532 | Ga0501069_0593238 | 3300049585 | Bacteria | 665 |
| 533 | Ga0501071_0308313 | 3300049587 | Bacteria | 1201 |
| 534 | Ga0501072_0063136 | 3300049588 | Bacteria | 2922 |
| 535 | Ga0501073_0067071 | 3300049589 | Bacteria | 2501 |
| 536 | Ga0501076_0225963 | 3300049592 | Bacteria | 1530 |
| 537 | Ga0501076_0553402 | 3300049592 | Bacteria | 949 |
| 538 | Ga0501077_0248815 | 3300049593 | Bacteria | 1130 |
| 539 | Ga0501035_0000205 | 3300049822 | Bacteria | 72074 |
| 540 | Ga0501045_0840667 | 3300049824 | Bacteria | 675 |
| 541 | nmdc:mga05p37_190175_c1 | 3300050507 | Bacteria | 2493 |
| 542 | nmdc:mga09592_165494_c1 | 3300050508 | Bacteria | 1911 |
| 543 | nmdc:mga0qj67_62961_c1 | 3300050509 | Bacteria | 2948 |
| 544 | nmdc:mga06r32_1440892_c1 | 3300050510 | Bacteria | 630 |
| 545 | nmdc:mga06r32_207981_c1 | 3300050510 | Bacteria | 1945 |
| 546 | nmdc:mga08y16_10731_c1 | 3300050511 | Bacteria | 9613 |
| 547 | nmdc:mga08y16_196791_c1 | 3300050511 | Bacteria | 2089 |
| 548 | nmdc:mga08y16_196929_c1 | 3300050511 | Bacteria | 2088 |
| 549 | nmdc:mga08y16_202550_c1 | 3300050511 | Bacteria | 2057 |
| 550 | nmdc:mga08y16_458450_c1 | 3300050511 | Bacteria | 1299 |
| 551 | nmdc:mga0n895_14990_c1 | 3300050512 | Bacteria | 7060 |
| 552 | nmdc:mga0n895_367278_c1 | 3300050512 | Bacteria | 1457 |
| 553 | nmdc:mga0n895_469486_c1 | 3300050512 | Bacteria | 1269 |
| 554 | nmdc:mga0rr50_43296_c1 | 3300050513 | Bacteria | 3293 |
| 555 | nmdc:mga08x19_28623_c1 | 3300050514 | Bacteria | 3491 |
| 556 | nmdc:mga08x19_65666_c1 | 3300050514 | Bacteria | 2357 |
| 557 | nmdc:mga08x19_73116_c1 | 3300050514 | Bacteria | 2237 |
| 558 | nmdc:mga08x19_97100_c1 | 3300050514 | Bacteria | 1950 |
| 559 | Ga0495601_0069811 | 3300053077 | Bacteria | 2241 |
| 560 | Ga0500646_0083208 | 3300053090 | Bacteria | 980 |
| 561 | Ga0501084_0066289 | 3300054114 | Bacteria | 3021 |
| 562 | Ga0587073_0126715 | 3300059492 | Bacteria | 696 |
| 563 | Ga0530510_1276429 | 3300061734 | Bacteria | 563 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027907 | Ga0207428_10000729 | Ga0207428_1000072917 | 144 |
| 2 | 3300009093 | Ga0105240_10996832 | Ga0105240_109968322 | 165 |
| 3 | 3300009098 | Ga0105245_10002176 | Ga0105245_100021764 | 165 |
| 4 | 3300009177 | Ga0105248_10297618 | Ga0105248_102976182 | 165 |
| 5 | 3300009553 | Ga0105249_11328025 | Ga0105249_113280252 | 165 |
| 6 | 3300013296 | Ga0157374_10000154 | Ga0157374_100001549 | 165 |
| 7 | 3300013297 | Ga0157378_10000150 | Ga0157378_100001508 | 165 |
| 8 | 3300013297 | Ga0157378_10000304 | Ga0157378_1000030411 | 165 |
| 9 | 3300013307 | Ga0157372_10000300 | Ga0157372_1000030038 | 165 |
| 10 | 3300013307 | Ga0157372_10686359 | Ga0157372_106863592 | 165 |
| 11 | 3300014326 | Ga0157380_10221955 | Ga0157380_102219551 | 165 |
| 12 | 3300014969 | Ga0157376_10086957 | Ga0157376_100869573 | 165 |
| 13 | 3300048907 | Ga0496104_0421922 | Ga0496104_0421922_526_1026 | 165 |
| 14 | 3300005436 | Ga0070713_100194076 | Ga0070713_1001940762 | 168 |
| 15 | 3300005436 | Ga0070713_100475369 | Ga0070713_1004753692 | 168 |
| 16 | 3300005437 | Ga0070710_10320596 | Ga0070710_103205962 | 168 |
| 17 | 3300006173 | Ga0070716_100182815 | Ga0070716_1001828152 | 168 |
| 18 | 3300006175 | Ga0070712_100031245 | Ga0070712_1000312452 | 168 |
| 19 | 3300007076 | Ga0075435_100499857 | Ga0075435_1004998572 | 168 |
| 20 | 3300009093 | Ga0105240_10019287 | Ga0105240_100192875 | 168 |
| 21 | 3300009147 | Ga0114129_10055986 | Ga0114129_100559866 | 168 |
| 22 | 3300013307 | Ga0157372_10119574 | Ga0157372_101195742 | 168 |
| 23 | 3300013307 | Ga0157372_10170881 | Ga0157372_101708813 | 168 |
| 24 | 3300014969 | Ga0157376_10006505 | Ga0157376_100065054 | 168 |
| 25 | 3300025915 | Ga0207693_10038670 | Ga0207693_100386704 | 168 |
| 26 | 3300025918 | Ga0207662_10131115 | Ga0207662_101311152 | 168 |
| 27 | 3300025939 | Ga0207665_10184792 | Ga0207665_101847921 | 168 |
| 28 | 3300035170 | Ga0373943_0328304 | Ga0373943_0328304_278_787 | 168 |
| 29 | 3300035410 | Ga0373924_0209887 | Ga0373924_0209887_213_722 | 168 |
| 30 | 3300045976 | Ga0466967_1452953 | Ga0466967_1452953_51_560 | 168 |
| 31 | 3300047319 | Ga0495674_0182167 | Ga0495674_0182167_801_1310 | 168 |
| 32 | 3300050510 | nmdc:mga06r32_1440892_c1 | nmdc:mga06r32_1440892_c1_10_516 | 168 |
| 33 | 3300005333 | Ga0070677_10217253 | Ga0070677_102172532 | 169 |
| 34 | 3300006051 | Ga0075364_10639439 | Ga0075364_106394391 | 169 |
| 35 | 3300009094 | Ga0111539_10280216 | Ga0111539_102802163 | 169 |
| 36 | 3300009094 | Ga0111539_11118300 | Ga0111539_111183002 | 169 |
| 37 | 3300009177 | Ga0105248_10730083 | Ga0105248_107300832 | 169 |
| 38 | 3300014745 | Ga0157377_10478559 | Ga0157377_104785592 | 169 |
| 39 | 3300014969 | Ga0157376_10503378 | Ga0157376_105033781 | 169 |
| 40 | 3300025945 | Ga0207679_11167425 | Ga0207679_111674251 | 169 |
| 41 | 3300031995 | Ga0307409_100039932 | Ga0307409_1000399323 | 169 |
| 42 | 3300032004 | Ga0307414_10042092 | Ga0307414_100420923 | 169 |
| 43 | 3300042125 | Ga0450923_017639 | Ga0450923_017639_56_565 | 169 |
| 44 | 3300042436 | Ga0439435_0091827 | Ga0439435_0091827_154_663 | 169 |
| 45 | 3300042437 | Ga0439444_0003896 | Ga0439444_0003896_857_1366 | 169 |
| 46 | 3300046459 | Ga0495629_0472364 | Ga0495629_0472364_278_787 | 169 |
| 47 | 3300046499 | Ga0495594_0266368 | Ga0495594_0266368_289_798 | 169 |
| 48 | 3300049568 | Ga0501031_0153587 | Ga0501031_0153587_16_525 | 169 |
| 49 | 3300049572 | Ga0501036_0318747 | Ga0501036_0318747_752_1261 | 169 |
| 50 | 3300049576 | Ga0501040_0120964 | Ga0501040_0120964_841_1350 | 169 |
| 51 | 3300049578 | Ga0501042_0222963 | Ga0501042_0222963_42_551 | 169 |
| 52 | 3300049585 | Ga0501069_0593238 | Ga0501069_0593238_60_572 | 169 |
| 53 | 3300049588 | Ga0501072_0063136 | Ga0501072_0063136_870_1379 | 169 |
| 54 | 3300049589 | Ga0501073_0067071 | Ga0501073_0067071_858_1367 | 169 |
| 55 | 3300049592 | Ga0501076_0225963 | Ga0501076_0225963_140_649 | 169 |
| 56 | 3300049592 | Ga0501076_0553402 | Ga0501076_0553402_324_833 | 169 |
| 57 | 3300049593 | Ga0501077_0248815 | Ga0501077_0248815_298_807 | 169 |
| 58 | 3300049824 | Ga0501045_0840667 | Ga0501045_0840667_156_665 | 169 |
| 59 | 3300050511 | nmdc:mga08y16_458450_c1 | nmdc:mga08y16_458450_c1_33_542 | 169 |
| 60 | 3300053090 | Ga0500646_0083208 | Ga0500646_0083208_416_925 | 169 |
| 61 | 3300054114 | Ga0501084_0066289 | Ga0501084_0066289_767_1276 | 169 |
| 62 | 3300061734 | Ga0530510_1276429 | Ga0530510_1276429_10_519 | 169 |
| 63 | 3300005549 | Ga0070704_100821867 | Ga0070704_1008218672 | 170 |
| 64 | 3300049587 | Ga0501071_0308313 | Ga0501071_0308313_282_794 | 170 |
| 65 | 3300006844 | Ga0075428_100032787 | Ga0075428_1000327873 | 171 |
| 66 | 3300006871 | Ga0075434_101182740 | Ga0075434_1011827402 | 171 |
| 67 | 3300006880 | Ga0075429_100053455 | Ga0075429_1000534553 | 171 |
| 68 | 3300009147 | Ga0114129_10518278 | Ga0114129_105182782 | 171 |
| 69 | 3300014326 | Ga0157380_10007372 | Ga0157380_100073722 | 171 |
| 70 | 3300031548 | Ga0307408_100955320 | Ga0307408_1009553201 | 171 |
| 71 | 3300032002 | Ga0307416_100554448 | Ga0307416_1005544482 | 171 |
| 72 | 3300042003 | Ga0439443_017840 | Ga0439443_017840_412_927 | 171 |
| 73 | 3300050507 | nmdc:mga05p37_190175_c1 | nmdc:mga05p37_190175_c1_1516_2031 | 171 |
| 74 | 3300050508 | nmdc:mga09592_165494_c1 | nmdc:mga09592_165494_c1_355_870 | 171 |
| 75 | 3300050511 | nmdc:mga08y16_196791_c1 | nmdc:mga08y16_196791_c1_523_1038 | 171 |
| 76 | 3300050512 | nmdc:mga0n895_469486_c1 | nmdc:mga0n895_469486_c1_106_621 | 171 |
| 77 | 3300005545 | Ga0070695_100655016 | Ga0070695_1006550161 | 172 |
| 78 | 3300006880 | Ga0075429_100247864 | Ga0075429_1002478642 | 172 |
| 79 | 3300009176 | Ga0105242_11095012 | Ga0105242_110950122 | 172 |
| 80 | 3300046523 | Ga0495644_0197969 | Ga0495644_0197969_245_763 | 172 |
| 81 | 3300046539 | Ga0495621_0006597 | Ga0495621_0006597_1744_2262 | 172 |
| 82 | 3300050511 | nmdc:mga08y16_10731_c1 | nmdc:mga08y16_10731_c1_3026_3544 | 172 |
| 83 | 3300050511 | nmdc:mga08y16_196929_c1 | nmdc:mga08y16_196929_c1_384_902 | 172 |
| 84 | 3300050511 | nmdc:mga08y16_202550_c1 | nmdc:mga08y16_202550_c1_1069_1587 | 172 |
| 85 | 3300005445 | Ga0070708_100118735 | Ga0070708_1001187352 | 173 |
| 86 | 3300005467 | Ga0070706_100063107 | Ga0070706_1000631073 | 173 |
| 87 | 3300005468 | Ga0070707_100135932 | Ga0070707_1001359322 | 173 |
| 88 | 3300005468 | Ga0070707_100227823 | Ga0070707_1002278232 | 173 |
| 89 | 3300005471 | Ga0070698_100118463 | Ga0070698_1001184632 | 173 |
| 90 | 3300005518 | Ga0070699_100281766 | Ga0070699_1002817661 | 173 |
| 91 | 3300005518 | Ga0070699_100748162 | Ga0070699_1007481621 | 173 |
| 92 | 3300005536 | Ga0070697_100000145 | Ga0070697_10000014510 | 173 |
| 93 | 3300005536 | Ga0070697_100539721 | Ga0070697_1005397212 | 173 |
| 94 | 3300025910 | Ga0207684_10185562 | Ga0207684_101855622 | 173 |
| 95 | 3300025922 | Ga0207646_10069986 | Ga0207646_100699862 | 173 |
| 96 | 3300025922 | Ga0207646_10544165 | Ga0207646_105441651 | 173 |
| 97 | 3300025922 | Ga0207646_10647779 | Ga0207646_106477792 | 173 |
| 98 | 3300028800 | Ga0265338_10010004 | Ga0265338_100100049 | 173 |
| 99 | 3300031238 | Ga0265332_10026266 | Ga0265332_100262661 | 173 |
| 100 | 3300031239 | Ga0265328_10027309 | Ga0265328_100273093 | 173 |
| 101 | 3300031247 | Ga0265340_10025269 | Ga0265340_100252692 | 173 |
| 102 | 3300031249 | Ga0265339_10006686 | Ga0265339_100066866 | 173 |
| 103 | 3300031249 | Ga0265339_10058157 | Ga0265339_100581573 | 173 |
| 104 | 3300031249 | Ga0265339_10183574 | Ga0265339_101835742 | 173 |
| 105 | 3300031344 | Ga0265316_10004401 | Ga0265316_100044012 | 173 |
| 106 | 3300031344 | Ga0265316_10023588 | Ga0265316_100235883 | 173 |
| 107 | 3300031711 | Ga0265314_10007310 | Ga0265314_100073102 | 173 |
| 108 | 3300005293 | Ga0065715_10023042 | Ga0065715_100230423 | 174 |
| 109 | 3300005329 | Ga0070683_100124525 | Ga0070683_1001245252 | 174 |
| 110 | 3300005329 | Ga0070683_100142571 | Ga0070683_1001425712 | 174 |
| 111 | 3300005330 | Ga0070690_100986583 | Ga0070690_1009865831 | 174 |
| 112 | 3300005334 | Ga0068869_100003590 | Ga0068869_1000035902 | 174 |
| 113 | 3300005334 | Ga0068869_100223214 | Ga0068869_1002232142 | 174 |
| 114 | 3300005335 | Ga0070666_10313863 | Ga0070666_103138631 | 174 |
| 115 | 3300005336 | Ga0070680_101208146 | Ga0070680_1012081461 | 174 |
| 116 | 3300005338 | Ga0068868_100072804 | Ga0068868_1000728043 | 174 |
| 117 | 3300005338 | Ga0068868_100452295 | Ga0068868_1004522951 | 174 |
| 118 | 3300005338 | Ga0068868_100968659 | Ga0068868_1009686591 | 174 |
| 119 | 3300005339 | Ga0070660_100013843 | Ga0070660_1000138433 | 174 |
| 120 | 3300005343 | Ga0070687_100074260 | Ga0070687_1000742602 | 174 |
| 121 | 3300005344 | Ga0070661_100033066 | Ga0070661_1000330663 | 174 |
| 122 | 3300005344 | Ga0070661_100655736 | Ga0070661_1006557361 | 174 |
| 123 | 3300005355 | Ga0070671_100134777 | Ga0070671_1001347773 | 174 |
| 124 | 3300005364 | Ga0070673_100462759 | Ga0070673_1004627591 | 174 |
| 125 | 3300005366 | Ga0070659_100211219 | Ga0070659_1002112192 | 174 |
| 126 | 3300005366 | Ga0070659_100637659 | Ga0070659_1006376591 | 174 |
| 127 | 3300005367 | Ga0070667_100541729 | Ga0070667_1005417292 | 174 |
| 128 | 3300005367 | Ga0070667_100707334 | Ga0070667_1007073342 | 174 |
| 129 | 3300005434 | Ga0070709_10003110 | Ga0070709_100031107 | 174 |
| 130 | 3300005434 | Ga0070709_10004804 | Ga0070709_100048048 | 174 |
| 131 | 3300005434 | Ga0070709_10715669 | Ga0070709_107156691 | 174 |
| 132 | 3300005435 | Ga0070714_100001256 | Ga0070714_1000012561 | 174 |
| 133 | 3300005435 | Ga0070714_100012151 | Ga0070714_1000121512 | 174 |
| 134 | 3300005435 | Ga0070714_100051603 | Ga0070714_1000516033 | 174 |
| 135 | 3300005435 | Ga0070714_100053026 | Ga0070714_1000530263 | 174 |
| 136 | 3300005435 | Ga0070714_100136287 | Ga0070714_1001362872 | 174 |
| 137 | 3300005435 | Ga0070714_100264310 | Ga0070714_1002643102 | 174 |
| 138 | 3300005435 | Ga0070714_100395861 | Ga0070714_1003958612 | 174 |
| 139 | 3300005435 | Ga0070714_100707075 | Ga0070714_1007070751 | 174 |
| 140 | 3300005435 | Ga0070714_101098546 | Ga0070714_1010985461 | 174 |
| 141 | 3300005436 | Ga0070713_100000561 | Ga0070713_10000056118 | 174 |
| 142 | 3300005436 | Ga0070713_100003423 | Ga0070713_10000342310 | 174 |
| 143 | 3300005436 | Ga0070713_100006965 | Ga0070713_1000069652 | 174 |
| 144 | 3300005436 | Ga0070713_100232070 | Ga0070713_1002320702 | 174 |
| 145 | 3300005436 | Ga0070713_100369943 | Ga0070713_1003699432 | 174 |
| 146 | 3300005436 | Ga0070713_100382192 | Ga0070713_1003821921 | 174 |
| 147 | 3300005436 | Ga0070713_101459654 | Ga0070713_1014596541 | 174 |
| 148 | 3300005437 | Ga0070710_10092133 | Ga0070710_100921332 | 174 |
| 149 | 3300005437 | Ga0070710_10171162 | Ga0070710_101711622 | 174 |
| 150 | 3300005439 | Ga0070711_100015990 | Ga0070711_1000159902 | 174 |
| 151 | 3300005439 | Ga0070711_100050824 | Ga0070711_1000508242 | 174 |
| 152 | 3300005439 | Ga0070711_100274139 | Ga0070711_1002741391 | 174 |
| 153 | 3300005445 | Ga0070708_100023076 | Ga0070708_1000230762 | 174 |
| 154 | 3300005445 | Ga0070708_100217505 | Ga0070708_1002175052 | 174 |
| 155 | 3300005445 | Ga0070708_100341472 | Ga0070708_1003414722 | 174 |
| 156 | 3300005445 | Ga0070708_100586325 | Ga0070708_1005863252 | 174 |
| 157 | 3300005456 | Ga0070678_100336646 | Ga0070678_1003366462 | 174 |
| 158 | 3300005458 | Ga0070681_10009675 | Ga0070681_100096758 | 174 |
| 159 | 3300005458 | Ga0070681_10519452 | Ga0070681_105194522 | 174 |
| 160 | 3300005466 | Ga0070685_10631073 | Ga0070685_106310731 | 174 |
| 161 | 3300005466 | Ga0070685_10751522 | Ga0070685_107515221 | 174 |
| 162 | 3300005467 | Ga0070706_100007211 | Ga0070706_1000072117 | 174 |
| 163 | 3300005467 | Ga0070706_100009023 | Ga0070706_1000090232 | 174 |
| 164 | 3300005467 | Ga0070706_100500873 | Ga0070706_1005008731 | 174 |
| 165 | 3300005468 | Ga0070707_100008857 | Ga0070707_1000088578 | 174 |
| 166 | 3300005468 | Ga0070707_100745583 | Ga0070707_1007455832 | 174 |
| 167 | 3300005471 | Ga0070698_100004977 | Ga0070698_1000049776 | 174 |
| 168 | 3300005518 | Ga0070699_100001625 | Ga0070699_1000016258 | 174 |
| 169 | 3300005518 | Ga0070699_100063586 | Ga0070699_1000635862 | 174 |
| 170 | 3300005530 | Ga0070679_100103655 | Ga0070679_1001036552 | 174 |
| 171 | 3300005530 | Ga0070679_100170881 | Ga0070679_1001708812 | 174 |
| 172 | 3300005530 | Ga0070679_100845831 | Ga0070679_1008458311 | 174 |
| 173 | 3300005535 | Ga0070684_100074079 | Ga0070684_1000740793 | 174 |
| 174 | 3300005535 | Ga0070684_100287124 | Ga0070684_1002871242 | 174 |
| 175 | 3300005536 | Ga0070697_100001728 | Ga0070697_10000172811 | 174 |
| 176 | 3300005539 | Ga0068853_100133607 | Ga0068853_1001336072 | 174 |
| 177 | 3300005539 | Ga0068853_100491666 | Ga0068853_1004916662 | 174 |
| 178 | 3300005545 | Ga0070695_100109964 | Ga0070695_1001099643 | 174 |
| 179 | 3300005545 | Ga0070695_100181055 | Ga0070695_1001810552 | 174 |
| 180 | 3300005545 | Ga0070695_100705510 | Ga0070695_1007055101 | 174 |
| 181 | 3300005546 | Ga0070696_100556965 | Ga0070696_1005569651 | 174 |
| 182 | 3300005547 | Ga0070693_100030451 | Ga0070693_1000304513 | 174 |
| 183 | 3300005547 | Ga0070693_100402711 | Ga0070693_1004027111 | 174 |
| 184 | 3300005563 | Ga0068855_100001957 | Ga0068855_1000019578 | 174 |
| 185 | 3300005563 | Ga0068855_100256147 | Ga0068855_1002561472 | 174 |
| 186 | 3300005563 | Ga0068855_101008255 | Ga0068855_1010082551 | 174 |
| 187 | 3300005563 | Ga0068855_101266266 | Ga0068855_1012662661 | 174 |
| 188 | 3300005564 | Ga0070664_100056564 | Ga0070664_1000565643 | 174 |
| 189 | 3300005564 | Ga0070664_100282504 | Ga0070664_1002825042 | 174 |
| 190 | 3300005564 | Ga0070664_101772964 | Ga0070664_1017729641 | 174 |
| 191 | 3300005578 | Ga0068854_100007558 | Ga0068854_1000075585 | 174 |
| 192 | 3300005578 | Ga0068854_100034605 | Ga0068854_1000346053 | 174 |
| 193 | 3300005578 | Ga0068854_100041415 | Ga0068854_1000414152 | 174 |
| 194 | 3300005578 | Ga0068854_101474524 | Ga0068854_1014745241 | 174 |
| 195 | 3300005614 | Ga0068856_100002269 | Ga0068856_1000022693 | 174 |
| 196 | 3300005614 | Ga0068856_100183604 | Ga0068856_1001836042 | 174 |
| 197 | 3300005614 | Ga0068856_100304661 | Ga0068856_1003046612 | 174 |
| 198 | 3300005614 | Ga0068856_100345122 | Ga0068856_1003451221 | 174 |
| 199 | 3300005615 | Ga0070702_100193166 | Ga0070702_1001931662 | 174 |
| 200 | 3300005616 | Ga0068852_100183502 | Ga0068852_1001835022 | 174 |
| 201 | 3300005618 | Ga0068864_100007060 | Ga0068864_1000070602 | 174 |
| 202 | 3300005618 | Ga0068864_100100058 | Ga0068864_1001000581 | 174 |
| 203 | 3300005718 | Ga0068866_10060626 | Ga0068866_100606262 | 174 |
| 204 | 3300005718 | Ga0068866_10091952 | Ga0068866_100919522 | 174 |
| 205 | 3300005834 | Ga0068851_10065600 | Ga0068851_100656002 | 174 |
| 206 | 3300005840 | Ga0068870_10063990 | Ga0068870_100639902 | 174 |
| 207 | 3300005841 | Ga0068863_100099970 | Ga0068863_1000999702 | 174 |
| 208 | 3300005842 | Ga0068858_100004940 | Ga0068858_1000049408 | 174 |
| 209 | 3300005842 | Ga0068858_100057600 | Ga0068858_1000576002 | 174 |
| 210 | 3300005842 | Ga0068858_100091600 | Ga0068858_1000916003 | 174 |
| 211 | 3300005842 | Ga0068858_100189314 | Ga0068858_1001893143 | 174 |
| 212 | 3300005842 | Ga0068858_100640560 | Ga0068858_1006405602 | 174 |
| 213 | 3300005843 | Ga0068860_100068668 | Ga0068860_1000686682 | 174 |
| 214 | 3300005844 | Ga0068862_100110109 | Ga0068862_1001101092 | 174 |
| 215 | 3300006028 | Ga0070717_10014604 | Ga0070717_100146045 | 174 |
| 216 | 3300006028 | Ga0070717_10034560 | Ga0070717_100345602 | 174 |
| 217 | 3300006028 | Ga0070717_10122066 | Ga0070717_101220662 | 174 |
| 218 | 3300006028 | Ga0070717_10187238 | Ga0070717_101872381 | 174 |
| 219 | 3300006028 | Ga0070717_10385599 | Ga0070717_103855991 | 174 |
| 220 | 3300006028 | Ga0070717_11045725 | Ga0070717_110457251 | 174 |
| 221 | 3300006173 | Ga0070716_100001403 | Ga0070716_1000014037 | 174 |
| 222 | 3300006173 | Ga0070716_100185412 | Ga0070716_1001854121 | 174 |
| 223 | 3300006173 | Ga0070716_100190027 | Ga0070716_1001900272 | 174 |
| 224 | 3300006175 | Ga0070712_100002903 | Ga0070712_1000029037 | 174 |
| 225 | 3300006175 | Ga0070712_100182307 | Ga0070712_1001823072 | 174 |
| 226 | 3300006175 | Ga0070712_100234831 | Ga0070712_1002348312 | 174 |
| 227 | 3300006175 | Ga0070712_100961830 | Ga0070712_1009618301 | 174 |
| 228 | 3300006175 | Ga0070712_101401488 | Ga0070712_1014014881 | 174 |
| 229 | 3300006237 | Ga0097621_100011526 | Ga0097621_1000115263 | 174 |
| 230 | 3300006237 | Ga0097621_100020441 | Ga0097621_1000204415 | 174 |
| 231 | 3300006237 | Ga0097621_100053947 | Ga0097621_1000539474 | 174 |
| 232 | 3300006237 | Ga0097621_100208487 | Ga0097621_1002084872 | 174 |
| 233 | 3300006237 | Ga0097621_100339171 | Ga0097621_1003391712 | 174 |
| 234 | 3300006237 | Ga0097621_100402432 | Ga0097621_1004024322 | 174 |
| 235 | 3300006358 | Ga0068871_100000307 | Ga0068871_10000030714 | 174 |
| 236 | 3300006358 | Ga0068871_100000339 | Ga0068871_10000033920 | 174 |
| 237 | 3300006358 | Ga0068871_100379024 | Ga0068871_1003790242 | 174 |
| 238 | 3300006871 | Ga0075434_100200928 | Ga0075434_1002009283 | 174 |
| 239 | 3300006871 | Ga0075434_100318789 | Ga0075434_1003187892 | 174 |
| 240 | 3300006881 | Ga0068865_100419410 | Ga0068865_1004194102 | 174 |
| 241 | 3300006914 | Ga0075436_100005040 | Ga0075436_1000050408 | 174 |
| 242 | 3300006914 | Ga0075436_100034148 | Ga0075436_1000341484 | 174 |
| 243 | 3300006914 | Ga0075436_100088630 | Ga0075436_1000886302 | 174 |
| 244 | 3300006914 | Ga0075436_100143793 | Ga0075436_1001437931 | 174 |
| 245 | 3300007076 | Ga0075435_100003987 | Ga0075435_10000398710 | 174 |
| 246 | 3300007076 | Ga0075435_100217413 | Ga0075435_1002174133 | 174 |
| 247 | 3300009093 | Ga0105240_10008591 | Ga0105240_100085914 | 174 |
| 248 | 3300009093 | Ga0105240_10049516 | Ga0105240_100495164 | 174 |
| 249 | 3300009093 | Ga0105240_10554107 | Ga0105240_105541072 | 174 |
| 250 | 3300009093 | Ga0105240_10574038 | Ga0105240_105740382 | 174 |
| 251 | 3300009098 | Ga0105245_10082073 | Ga0105245_100820732 | 174 |
| 252 | 3300009174 | Ga0105241_10045117 | Ga0105241_100451173 | 174 |
| 253 | 3300009174 | Ga0105241_10328491 | Ga0105241_103284912 | 174 |
| 254 | 3300009174 | Ga0105241_10425804 | Ga0105241_104258042 | 174 |
| 255 | 3300009176 | Ga0105242_10011211 | Ga0105242_100112117 | 174 |
| 256 | 3300009177 | Ga0105248_10010903 | Ga0105248_100109038 | 174 |
| 257 | 3300009177 | Ga0105248_10013443 | Ga0105248_100134437 | 174 |
| 258 | 3300009545 | Ga0105237_10158463 | Ga0105237_101584633 | 174 |
| 259 | 3300009545 | Ga0105237_10555077 | Ga0105237_105550771 | 174 |
| 260 | 3300009545 | Ga0105237_10606168 | Ga0105237_106061682 | 174 |
| 261 | 3300009551 | Ga0105238_10088247 | Ga0105238_100882472 | 174 |
| 262 | 3300009551 | Ga0105238_10135659 | Ga0105238_101356593 | 174 |
| 263 | 3300009551 | Ga0105238_10503203 | Ga0105238_105032032 | 174 |
| 264 | 3300009551 | Ga0105238_10559157 | Ga0105238_105591572 | 174 |
| 265 | 3300010375 | Ga0105239_10106363 | Ga0105239_101063632 | 174 |
| 266 | 3300010375 | Ga0105239_10531590 | Ga0105239_105315901 | 174 |
| 267 | 3300010375 | Ga0105239_10538097 | Ga0105239_105380972 | 174 |
| 268 | 3300011119 | Ga0105246_10369540 | Ga0105246_103695401 | 174 |
| 269 | 3300013100 | Ga0157373_10026248 | Ga0157373_100262483 | 174 |
| 270 | 3300013104 | Ga0157370_10007683 | Ga0157370_100076838 | 174 |
| 271 | 3300013105 | Ga0157369_10026761 | Ga0157369_100267617 | 174 |
| 272 | 3300013105 | Ga0157369_10139818 | Ga0157369_101398182 | 174 |
| 273 | 3300013296 | Ga0157374_10022027 | Ga0157374_100220272 | 174 |
| 274 | 3300013296 | Ga0157374_10180694 | Ga0157374_101806942 | 174 |
| 275 | 3300013306 | Ga0163162_10735141 | Ga0163162_107351411 | 174 |
| 276 | 3300013307 | Ga0157372_10000997 | Ga0157372_1000099717 | 174 |
| 277 | 3300013307 | Ga0157372_10017656 | Ga0157372_100176561 | 174 |
| 278 | 3300013307 | Ga0157372_10309092 | Ga0157372_103090921 | 174 |
| 279 | 3300013307 | Ga0157372_10339677 | Ga0157372_103396772 | 174 |
| 280 | 3300014325 | Ga0163163_10118556 | Ga0163163_101185562 | 174 |
| 281 | 3300014325 | Ga0163163_10165950 | Ga0163163_101659503 | 174 |
| 282 | 3300014497 | Ga0182008_10070523 | Ga0182008_100705233 | 174 |
| 283 | 3300015262 | Ga0182007_10006014 | Ga0182007_100060144 | 174 |
| 284 | 3300015265 | Ga0182005_1080866 | Ga0182005_10808661 | 174 |
| 285 | 3300025898 | Ga0207692_10080219 | Ga0207692_100802192 | 174 |
| 286 | 3300025898 | Ga0207692_10145261 | Ga0207692_101452612 | 174 |
| 287 | 3300025899 | Ga0207642_10001798 | Ga0207642_100017987 | 174 |
| 288 | 3300025899 | Ga0207642_10323696 | Ga0207642_103236962 | 174 |
| 289 | 3300025903 | Ga0207680_10026904 | Ga0207680_100269042 | 174 |
| 290 | 3300025905 | Ga0207685_10023264 | Ga0207685_100232642 | 174 |
| 291 | 3300025906 | Ga0207699_10004141 | Ga0207699_100041417 | 174 |
| 292 | 3300025906 | Ga0207699_10005666 | Ga0207699_100056667 | 174 |
| 293 | 3300025906 | Ga0207699_10060875 | Ga0207699_100608752 | 174 |
| 294 | 3300025906 | Ga0207699_10357543 | Ga0207699_103575432 | 174 |
| 295 | 3300025906 | Ga0207699_10809648 | Ga0207699_108096481 | 174 |
| 296 | 3300025909 | Ga0207705_10489834 | Ga0207705_104898342 | 174 |
| 297 | 3300025910 | Ga0207684_10002114 | Ga0207684_1000211414 | 174 |
| 298 | 3300025910 | Ga0207684_10085781 | Ga0207684_100857813 | 174 |
| 299 | 3300025911 | Ga0207654_10311004 | Ga0207654_103110042 | 174 |
| 300 | 3300025911 | Ga0207654_10345879 | Ga0207654_103458792 | 174 |
| 301 | 3300025912 | Ga0207707_10031615 | Ga0207707_100316153 | 174 |
| 302 | 3300025913 | Ga0207695_10032249 | Ga0207695_100322492 | 174 |
| 303 | 3300025913 | Ga0207695_10045564 | Ga0207695_100455642 | 174 |
| 304 | 3300025913 | Ga0207695_10094055 | Ga0207695_100940552 | 174 |
| 305 | 3300025914 | Ga0207671_10467806 | Ga0207671_104678061 | 174 |
| 306 | 3300025915 | Ga0207693_10001147 | Ga0207693_1000114728 | 174 |
| 307 | 3300025915 | Ga0207693_10178940 | Ga0207693_101789402 | 174 |
| 308 | 3300025915 | Ga0207693_10297153 | Ga0207693_102971532 | 174 |
| 309 | 3300025915 | Ga0207693_10703130 | Ga0207693_107031301 | 174 |
| 310 | 3300025916 | Ga0207663_10015113 | Ga0207663_100151132 | 174 |
| 311 | 3300025916 | Ga0207663_10170913 | Ga0207663_101709132 | 174 |
| 312 | 3300025916 | Ga0207663_10398284 | Ga0207663_103982842 | 174 |
| 313 | 3300025918 | Ga0207662_10118711 | Ga0207662_101187112 | 174 |
| 314 | 3300025919 | Ga0207657_10000197 | Ga0207657_1000019742 | 174 |
| 315 | 3300025920 | Ga0207649_10588485 | Ga0207649_105884851 | 174 |
| 316 | 3300025921 | Ga0207652_10138644 | Ga0207652_101386443 | 174 |
| 317 | 3300025921 | Ga0207652_10141593 | Ga0207652_101415933 | 174 |
| 318 | 3300025921 | Ga0207652_10385502 | Ga0207652_103855021 | 174 |
| 319 | 3300025921 | Ga0207652_11061878 | Ga0207652_110618781 | 174 |
| 320 | 3300025922 | Ga0207646_10005280 | Ga0207646_1000528014 | 174 |
| 321 | 3300025922 | Ga0207646_10606447 | Ga0207646_106064472 | 174 |
| 322 | 3300025924 | Ga0207694_10009653 | Ga0207694_100096533 | 174 |
| 323 | 3300025924 | Ga0207694_10307972 | Ga0207694_103079722 | 174 |
| 324 | 3300025924 | Ga0207694_10519720 | Ga0207694_105197201 | 174 |
| 325 | 3300025927 | Ga0207687_10070351 | Ga0207687_100703512 | 174 |
| 326 | 3300025927 | Ga0207687_10324639 | Ga0207687_103246392 | 174 |
| 327 | 3300025927 | Ga0207687_10336549 | Ga0207687_103365491 | 174 |
| 328 | 3300025928 | Ga0207700_10000650 | Ga0207700_1000065019 | 174 |
| 329 | 3300025928 | Ga0207700_10017040 | Ga0207700_100170403 | 174 |
| 330 | 3300025928 | Ga0207700_10096067 | Ga0207700_100960672 | 174 |
| 331 | 3300025928 | Ga0207700_10227432 | Ga0207700_102274321 | 174 |
| 332 | 3300025928 | Ga0207700_10336239 | Ga0207700_103362391 | 174 |
| 333 | 3300025928 | Ga0207700_10590262 | Ga0207700_105902622 | 174 |
| 334 | 3300025928 | Ga0207700_10874691 | Ga0207700_108746911 | 174 |
| 335 | 3300025929 | Ga0207664_10012965 | Ga0207664_100129652 | 174 |
| 336 | 3300025929 | Ga0207664_10022896 | Ga0207664_100228964 | 174 |
| 337 | 3300025929 | Ga0207664_10153315 | Ga0207664_101533152 | 174 |
| 338 | 3300025929 | Ga0207664_10231318 | Ga0207664_102313182 | 174 |
| 339 | 3300025929 | Ga0207664_10412994 | Ga0207664_104129942 | 174 |
| 340 | 3300025931 | Ga0207644_10086418 | Ga0207644_100864183 | 174 |
| 341 | 3300025933 | Ga0207706_10096751 | Ga0207706_100967513 | 174 |
| 342 | 3300025934 | Ga0207686_10011425 | Ga0207686_100114252 | 174 |
| 343 | 3300025937 | Ga0207669_10101701 | Ga0207669_101017012 | 174 |
| 344 | 3300025939 | Ga0207665_10052713 | Ga0207665_100527134 | 174 |
| 345 | 3300025941 | Ga0207711_10161154 | Ga0207711_101611542 | 174 |
| 346 | 3300025942 | Ga0207689_10001515 | Ga0207689_1000151522 | 174 |
| 347 | 3300025942 | Ga0207689_10172961 | Ga0207689_101729612 | 174 |
| 348 | 3300025944 | Ga0207661_10491536 | Ga0207661_104915362 | 174 |
| 349 | 3300025945 | Ga0207679_10126953 | Ga0207679_101269532 | 174 |
| 350 | 3300025949 | Ga0207667_10000811 | Ga0207667_100008112 | 174 |
| 351 | 3300025949 | Ga0207667_10681397 | Ga0207667_106813972 | 174 |
| 352 | 3300025949 | Ga0207667_10803690 | Ga0207667_108036902 | 174 |
| 353 | 3300025949 | Ga0207667_11219837 | Ga0207667_112198371 | 174 |
| 354 | 3300025960 | Ga0207651_10156959 | Ga0207651_101569592 | 174 |
| 355 | 3300025981 | Ga0207640_10031625 | Ga0207640_100316252 | 174 |
| 356 | 3300025981 | Ga0207640_10089179 | Ga0207640_100891792 | 174 |
| 357 | 3300025981 | Ga0207640_10202151 | Ga0207640_102021512 | 174 |
| 358 | 3300025986 | Ga0207658_10311026 | Ga0207658_103110261 | 174 |
| 359 | 3300026023 | Ga0207677_10022484 | Ga0207677_100224844 | 174 |
| 360 | 3300026023 | Ga0207677_10131606 | Ga0207677_101316062 | 174 |
| 361 | 3300026023 | Ga0207677_10498317 | Ga0207677_104983172 | 174 |
| 362 | 3300026035 | Ga0207703_10025243 | Ga0207703_100252435 | 174 |
| 363 | 3300026035 | Ga0207703_10066459 | Ga0207703_100664593 | 174 |
| 364 | 3300026041 | Ga0207639_10533201 | Ga0207639_105332011 | 174 |
| 365 | 3300026041 | Ga0207639_10548288 | Ga0207639_105482881 | 174 |
| 366 | 3300026078 | Ga0207702_10003463 | Ga0207702_100034632 | 174 |
| 367 | 3300026078 | Ga0207702_10056413 | Ga0207702_100564134 | 174 |
| 368 | 3300026078 | Ga0207702_10063092 | Ga0207702_100630923 | 174 |
| 369 | 3300026078 | Ga0207702_10146734 | Ga0207702_101467343 | 174 |
| 370 | 3300026078 | Ga0207702_10811390 | Ga0207702_108113901 | 174 |
| 371 | 3300026088 | Ga0207641_10022718 | Ga0207641_100227182 | 174 |
| 372 | 3300026088 | Ga0207641_10573247 | Ga0207641_105732471 | 174 |
| 373 | 3300026089 | Ga0207648_10030759 | Ga0207648_100307593 | 174 |
| 374 | 3300026095 | Ga0207676_10152594 | Ga0207676_101525942 | 174 |
| 375 | 3300026095 | Ga0207676_10458757 | Ga0207676_104587571 | 174 |
| 376 | 3300026116 | Ga0207674_10169286 | Ga0207674_101692862 | 174 |
| 377 | 3300026118 | Ga0207675_100389349 | Ga0207675_1003893492 | 174 |
| 378 | 3300026121 | Ga0207683_10679633 | Ga0207683_106796332 | 174 |
| 379 | 3300026142 | Ga0207698_10427628 | Ga0207698_104276282 | 174 |
| 380 | 3300028380 | Ga0268265_10126313 | Ga0268265_101263132 | 174 |
| 381 | 3300031344 | Ga0265316_10063187 | Ga0265316_100631872 | 174 |
| 382 | 3300031344 | Ga0265316_10335322 | Ga0265316_103353222 | 174 |
| 383 | 3300031548 | Ga0307408_100011185 | Ga0307408_1000111853 | 174 |
| 384 | 3300031731 | Ga0307405_10007949 | Ga0307405_100079492 | 174 |
| 385 | 3300031824 | Ga0307413_10370910 | Ga0307413_103709102 | 174 |
| 386 | 3300031824 | Ga0307413_10463288 | Ga0307413_104632881 | 174 |
| 387 | 3300031852 | Ga0307410_10002296 | Ga0307410_100022964 | 174 |
| 388 | 3300031901 | Ga0307406_10015960 | Ga0307406_100159603 | 174 |
| 389 | 3300031903 | Ga0307407_10344506 | Ga0307407_103445062 | 174 |
| 390 | 3300031911 | Ga0307412_10035507 | Ga0307412_100355073 | 174 |
| 391 | 3300031995 | Ga0307409_100042750 | Ga0307409_1000427503 | 174 |
| 392 | 3300032002 | Ga0307416_100100356 | Ga0307416_1001003562 | 174 |
| 393 | 3300032002 | Ga0307416_101054101 | Ga0307416_1010541011 | 174 |
| 394 | 3300032005 | Ga0307411_10009396 | Ga0307411_100093965 | 174 |
| 395 | 3300032126 | Ga0307415_101305563 | Ga0307415_1013055632 | 174 |
| 396 | 3300032133 | Ga0316583_10137355 | Ga0316583_101373551 | 174 |
| 397 | 3300036401 | Ga0373937_0025926 | Ga0373937_0025926_3477_4004 | 174 |
| 398 | 3300037068 | Ga0373925_0563606 | Ga0373925_0563606_366_893 | 174 |
| 399 | 3300039447 | Ga0436361_0570038 | Ga0436361_0570038_62_589 | 174 |
| 400 | 3300039453 | Ga0436362_0161998 | Ga0436362_0161998_422_949 | 174 |
| 401 | 3300042876 | Ga0451577_0000531 | Ga0451577_0000531_43027_43554 | 174 |
| 402 | 3300042876 | Ga0451577_0053755 | Ga0451577_0053755_389_916 | 174 |
| 403 | 3300042876 | Ga0451577_0108498 | Ga0451577_0108498_1100_1633 | 174 |
| 404 | 3300044673 | Ga0453683_0116047 | Ga0453683_0116047_132_659 | 174 |
| 405 | 3300044673 | Ga0453683_0153659 | Ga0453683_0153659_698_1225 | 174 |
| 406 | 3300044694 | Ga0466963_0045901 | Ga0466963_0045901_1210_1737 | 174 |
| 407 | 3300044694 | Ga0466963_0147076 | Ga0466963_0147076_286_813 | 174 |
| 408 | 3300044712 | Ga0453684_0000324 | Ga0453684_0000324_64277_64804 | 174 |
| 409 | 3300044719 | Ga0466971_0070859 | Ga0466971_0070859_234_761 | 174 |
| 410 | 3300045049 | Ga0466959_0130094 | Ga0466959_0130094_948_1475 | 174 |
| 411 | 3300045049 | Ga0466959_0371951 | Ga0466959_0371951_186_713 | 174 |
| 412 | 3300045051 | Ga0451576_0021212 | Ga0451576_0021212_1237_1764 | 174 |
| 413 | 3300045051 | Ga0451576_0033685 | Ga0451576_0033685_1916_2443 | 174 |
| 414 | 3300045051 | Ga0451576_0145465 | Ga0451576_0145465_348_875 | 174 |
| 415 | 3300045836 | Ga0466958_0022113 | Ga0466958_0022113_75_602 | 174 |
| 416 | 3300045976 | Ga0466967_0001591 | Ga0466967_0001591_8718_9245 | 174 |
| 417 | 3300045976 | Ga0466967_0371021 | Ga0466967_0371021_352_879 | 174 |
| 418 | 3300046615 | Ga0495656_0023391 | Ga0495656_0023391_1396_1923 | 174 |
| 419 | 3300048904 | Ga0496101_0169550 | Ga0496101_0169550_622_1149 | 174 |
| 420 | 3300048905 | Ga0496102_0083967 | Ga0496102_0083967_1607_2134 | 174 |
| 421 | 3300048907 | Ga0496104_0244559 | Ga0496104_0244559_42_569 | 174 |
| 422 | 3300048908 | Ga0496105_0147599 | Ga0496105_0147599_77_604 | 174 |
| 423 | 3300048909 | Ga0496106_0305646 | Ga0496106_0305646_522_1049 | 174 |
| 424 | 3300048911 | Ga0496108_0092946 | Ga0496108_0092946_388_915 | 174 |
| 425 | 3300048912 | Ga0496109_0445974 | Ga0496109_0445974_682_1209 | 174 |
| 426 | 3300048913 | Ga0496110_0643912 | Ga0496110_0643912_399_926 | 174 |
| 427 | 3300048914 | Ga0496111_0104626 | Ga0496111_0104626_298_825 | 174 |
| 428 | 3300048914 | Ga0496111_0235764 | Ga0496111_0235764_724_1251 | 174 |
| 429 | 3300048915 | Ga0496112_0133583 | Ga0496112_0133583_1161_1688 | 174 |
| 430 | 3300048915 | Ga0496112_0337931 | Ga0496112_0337931_640_1167 | 174 |
| 431 | 3300049520 | Ga0501297_005766 | Ga0501297_005766_89_616 | 174 |
| 432 | 3300049585 | Ga0501069_0251452 | Ga0501069_0251452_430_957 | 174 |
| 433 | 3300050512 | nmdc:mga0n895_14990_c1 | nmdc:mga0n895_14990_c1_6235_6762 | 174 |
| 434 | 3300050512 | nmdc:mga0n895_367278_c1 | nmdc:mga0n895_367278_c1_561_1088 | 174 |
| 435 | 3300050513 | nmdc:mga0rr50_43296_c1 | nmdc:mga0rr50_43296_c1_1896_2423 | 174 |
| 436 | 3300050514 | nmdc:mga08x19_28623_c1 | nmdc:mga08x19_28623_c1_2557_3084 | 174 |
| 437 | 3300050514 | nmdc:mga08x19_65666_c1 | nmdc:mga08x19_65666_c1_1057_1584 | 174 |
| 438 | 3300050514 | nmdc:mga08x19_73116_c1 | nmdc:mga08x19_73116_c1_747_1274 | 174 |
| 439 | 3300050514 | nmdc:mga08x19_97100_c1 | nmdc:mga08x19_97100_c1_349_876 | 174 |
| 440 | 3300059492 | Ga0587073_0126715 | Ga0587073_0126715_152_679 | 174 |
| 441 | 3300005327 | Ga0070658_10052670 | Ga0070658_100526702 | 175 |
| 442 | 3300005327 | Ga0070658_10213561 | Ga0070658_102135613 | 175 |
| 443 | 3300005329 | Ga0070683_100041067 | Ga0070683_1000410672 | 175 |
| 444 | 3300005329 | Ga0070683_100044167 | Ga0070683_1000441673 | 175 |
| 445 | 3300005329 | Ga0070683_100664148 | Ga0070683_1006641481 | 175 |
| 446 | 3300005336 | Ga0070680_100128165 | Ga0070680_1001281652 | 175 |
| 447 | 3300005339 | Ga0070660_100081752 | Ga0070660_1000817523 | 175 |
| 448 | 3300005344 | Ga0070661_100121768 | Ga0070661_1001217682 | 175 |
| 449 | 3300005437 | Ga0070710_10155662 | Ga0070710_101556621 | 175 |
| 450 | 3300005455 | Ga0070663_100264861 | Ga0070663_1002648611 | 175 |
| 451 | 3300005458 | Ga0070681_10034238 | Ga0070681_100342383 | 175 |
| 452 | 3300005530 | Ga0070679_100037623 | Ga0070679_1000376233 | 175 |
| 453 | 3300005535 | Ga0070684_100005011 | Ga0070684_1000050114 | 175 |
| 454 | 3300005535 | Ga0070684_100085594 | Ga0070684_1000855943 | 175 |
| 455 | 3300005535 | Ga0070684_100148999 | Ga0070684_1001489992 | 175 |
| 456 | 3300005563 | Ga0068855_100016701 | Ga0068855_1000167012 | 175 |
| 457 | 3300005563 | Ga0068855_100109727 | Ga0068855_1001097273 | 175 |
| 458 | 3300005577 | Ga0068857_100001479 | Ga0068857_1000014792 | 175 |
| 459 | 3300005577 | Ga0068857_100171493 | Ga0068857_1001714933 | 175 |
| 460 | 3300005578 | Ga0068854_100014538 | Ga0068854_1000145382 | 175 |
| 461 | 3300005614 | Ga0068856_100004334 | Ga0068856_1000043342 | 175 |
| 462 | 3300005614 | Ga0068856_100075564 | Ga0068856_1000755642 | 175 |
| 463 | 3300005614 | Ga0068856_100076832 | Ga0068856_1000768322 | 175 |
| 464 | 3300005614 | Ga0068856_100233363 | Ga0068856_1002333632 | 175 |
| 465 | 3300005614 | Ga0068856_100439639 | Ga0068856_1004396391 | 175 |
| 466 | 3300005616 | Ga0068852_100148767 | Ga0068852_1001487673 | 175 |
| 467 | 3300005616 | Ga0068852_100170184 | Ga0068852_1001701841 | 175 |
| 468 | 3300005616 | Ga0068852_100180806 | Ga0068852_1001808062 | 175 |
| 469 | 3300005834 | Ga0068851_10002574 | Ga0068851_100025746 | 175 |
| 470 | 3300006028 | Ga0070717_10571232 | Ga0070717_105712321 | 175 |
| 471 | 3300006175 | Ga0070712_100121046 | Ga0070712_1001210462 | 175 |
| 472 | 3300009093 | Ga0105240_10025122 | Ga0105240_100251226 | 175 |
| 473 | 3300009093 | Ga0105240_10057142 | Ga0105240_100571422 | 175 |
| 474 | 3300009093 | Ga0105240_10197102 | Ga0105240_101971021 | 175 |
| 475 | 3300009174 | Ga0105241_10000052 | Ga0105241_1000005270 | 175 |
| 476 | 3300009174 | Ga0105241_10043271 | Ga0105241_100432712 | 175 |
| 477 | 3300009174 | Ga0105241_10121097 | Ga0105241_101210973 | 175 |
| 478 | 3300009545 | Ga0105237_10119543 | Ga0105237_101195433 | 175 |
| 479 | 3300009551 | Ga0105238_10009357 | Ga0105238_100093577 | 175 |
| 480 | 3300009551 | Ga0105238_10024062 | Ga0105238_100240622 | 175 |
| 481 | 3300009551 | Ga0105238_10224053 | Ga0105238_102240533 | 175 |
| 482 | 3300010375 | Ga0105239_10123172 | Ga0105239_101231721 | 175 |
| 483 | 3300010375 | Ga0105239_10657279 | Ga0105239_106572792 | 175 |
| 484 | 3300010375 | Ga0105239_12281567 | Ga0105239_122815671 | 175 |
| 485 | 3300013100 | Ga0157373_10074116 | Ga0157373_100741162 | 175 |
| 486 | 3300013102 | Ga0157371_10250539 | Ga0157371_102505392 | 175 |
| 487 | 3300013104 | Ga0157370_10006013 | Ga0157370_100060135 | 175 |
| 488 | 3300013105 | Ga0157369_10006768 | Ga0157369_100067685 | 175 |
| 489 | 3300013105 | Ga0157369_10013029 | Ga0157369_100130293 | 175 |
| 490 | 3300013105 | Ga0157369_10029182 | Ga0157369_100291822 | 175 |
| 491 | 3300013105 | Ga0157369_10049012 | Ga0157369_100490124 | 175 |
| 492 | 3300013105 | Ga0157369_10174133 | Ga0157369_101741332 | 175 |
| 493 | 3300013296 | Ga0157374_10209290 | Ga0157374_102092901 | 175 |
| 494 | 3300013306 | Ga0163162_11310194 | Ga0163162_113101941 | 175 |
| 495 | 3300013307 | Ga0157372_10009279 | Ga0157372_100092792 | 175 |
| 496 | 3300013307 | Ga0157372_10019574 | Ga0157372_100195746 | 175 |
| 497 | 3300013307 | Ga0157372_10024713 | Ga0157372_100247136 | 175 |
| 498 | 3300013307 | Ga0157372_10032423 | Ga0157372_100324233 | 175 |
| 499 | 3300013307 | Ga0157372_10033385 | Ga0157372_100333852 | 175 |
| 500 | 3300014325 | Ga0163163_10208796 | Ga0163163_102087962 | 175 |
| 501 | 3300020069 | Ga0197907_10829533 | Ga0197907_108295332 | 175 |
| 502 | 3300020080 | Ga0206350_11567381 | Ga0206350_115673812 | 175 |
| 503 | 3300022467 | Ga0224712_10095936 | Ga0224712_100959362 | 175 |
| 504 | 3300025321 | Ga0207656_10032142 | Ga0207656_100321423 | 175 |
| 505 | 3300025321 | Ga0207656_10183225 | Ga0207656_101832252 | 175 |
| 506 | 3300025898 | Ga0207692_10141229 | Ga0207692_101412292 | 175 |
| 507 | 3300025904 | Ga0207647_10027128 | Ga0207647_100271283 | 175 |
| 508 | 3300025909 | Ga0207705_10030022 | Ga0207705_100300222 | 175 |
| 509 | 3300025909 | Ga0207705_10043479 | Ga0207705_100434793 | 175 |
| 510 | 3300025909 | Ga0207705_10249121 | Ga0207705_102491213 | 175 |
| 511 | 3300025911 | Ga0207654_10000011 | Ga0207654_1000001159 | 175 |
| 512 | 3300025911 | Ga0207654_10047004 | Ga0207654_100470042 | 175 |
| 513 | 3300025911 | Ga0207654_10771361 | Ga0207654_107713611 | 175 |
| 514 | 3300025912 | Ga0207707_10001986 | Ga0207707_1000198610 | 175 |
| 515 | 3300025913 | Ga0207695_10035120 | Ga0207695_100351204 | 175 |
| 516 | 3300025913 | Ga0207695_10043270 | Ga0207695_100432702 | 175 |
| 517 | 3300025913 | Ga0207695_11472545 | Ga0207695_114725451 | 175 |
| 518 | 3300025915 | Ga0207693_10052336 | Ga0207693_100523364 | 175 |
| 519 | 3300025917 | Ga0207660_10369493 | Ga0207660_103694932 | 175 |
| 520 | 3300025919 | Ga0207657_10013080 | Ga0207657_100130803 | 175 |
| 521 | 3300025921 | Ga0207652_10014706 | Ga0207652_100147062 | 175 |
| 522 | 3300025921 | Ga0207652_10277105 | Ga0207652_102771052 | 175 |
| 523 | 3300025924 | Ga0207694_10008091 | Ga0207694_100080917 | 175 |
| 524 | 3300025924 | Ga0207694_10073436 | Ga0207694_100734363 | 175 |
| 525 | 3300025924 | Ga0207694_10270238 | Ga0207694_102702382 | 175 |
| 526 | 3300025944 | Ga0207661_10199265 | Ga0207661_101992652 | 175 |
| 527 | 3300025944 | Ga0207661_10210480 | Ga0207661_102104803 | 175 |
| 528 | 3300025945 | Ga0207679_11321839 | Ga0207679_113218391 | 175 |
| 529 | 3300025949 | Ga0207667_10000256 | Ga0207667_100002563 | 175 |
| 530 | 3300025949 | Ga0207667_10019229 | Ga0207667_100192296 | 175 |
| 531 | 3300025949 | Ga0207667_10021293 | Ga0207667_100212932 | 175 |
| 532 | 3300026067 | Ga0207678_10143247 | Ga0207678_101432471 | 175 |
| 533 | 3300026078 | Ga0207702_10018636 | Ga0207702_100186366 | 175 |
| 534 | 3300026078 | Ga0207702_10037024 | Ga0207702_100370241 | 175 |
| 535 | 3300026078 | Ga0207702_10137858 | Ga0207702_101378582 | 175 |
| 536 | 3300026078 | Ga0207702_10704614 | Ga0207702_107046142 | 175 |
| 537 | 3300026078 | Ga0207702_11684322 | Ga0207702_116843221 | 175 |
| 538 | 3300026116 | Ga0207674_10004026 | Ga0207674_100040268 | 175 |
| 539 | 3300026116 | Ga0207674_10198877 | Ga0207674_101988772 | 175 |
| 540 | 3300026142 | Ga0207698_10024979 | Ga0207698_100249792 | 175 |
| 541 | 3300026142 | Ga0207698_10058211 | Ga0207698_100582112 | 175 |
| 542 | 3300026142 | Ga0207698_10129208 | Ga0207698_101292083 | 175 |
| 543 | 3300031344 | Ga0265316_10457447 | Ga0265316_104574472 | 175 |
| 544 | 3300031711 | Ga0265314_10185373 | Ga0265314_101853732 | 175 |
| 545 | 3300046472 | Ga0495580_0006771 | Ga0495580_0006771_3719_4249 | 175 |
| 546 | 3300046543 | Ga0495645_0080238 | Ga0495645_0080238_1685_2215 | 175 |
| 547 | 3300046660 | Ga0495625_0113032 | Ga0495625_0113032_105_635 | 175 |
| 548 | 3300046684 | Ga0495669_0081681 | Ga0495669_0081681_759_1289 | 175 |
| 549 | 3300046694 | Ga0495649_0301947 | Ga0495649_0301947_24_554 | 175 |
| 550 | 3300048913 | Ga0496110_0556835 | Ga0496110_0556835_465_995 | 175 |
| 551 | 3300048914 | Ga0496111_0036656 | Ga0496111_0036656_709_1239 | 175 |
| 552 | 3300048929 | Ga0496126_0031870 | Ga0496126_0031870_1673_2203 | 175 |
| 553 | 3300053077 | Ga0495601_0069811 | Ga0495601_0069811_486_1016 | 175 |
| 554 | 3300013105 | Ga0157369_10000248 | Ga0157369_1000024852 | 180 |
| 555 | 3300049822 | Ga0501035_0000205 | Ga0501035_0000205_3359_3910 | 182 |
| 556 | 3300004799 | Ga0058863_11760255 | Ga0058863_117602551 | 183 |
| 557 | 3300006846 | Ga0075430_100360252 | Ga0075430_1003602522 | 183 |
| 558 | 3300006847 | Ga0075431_100220497 | Ga0075431_1002204972 | 183 |
| 559 | 3300048090 | Ga0495615_0059596 | Ga0495615_0059596_39_590 | 183 |
| 560 | 3300048903 | Ga0496100_0163374 | Ga0496100_0163374_989_1546 | 183 |
| 561 | 3300048928 | Ga0496125_0390023 | Ga0496125_0390023_29_586 | 183 |
| 562 | 3300050509 | nmdc:mga0qj67_62961_c1 | nmdc:mga0qj67_62961_c1_1576_2133 | 183 |
| 563 | 3300050510 | nmdc:mga06r32_207981_c1 | nmdc:mga06r32_207981_c1_469_1026 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w74-assembly2.cif.gz_B | x-ray structure of peptidyl-prolyl cis-trans isomerase a, ppia, rv0009, from mycobacterium tuberculosis. | 0.9072 | 13 | 180 |
| 1zkc-assembly2.cif.gz_B | crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b | 0.9051 | 11 | 179 |
| 3jb9-assembly1.cif.gz_d | cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution | 0.9019 | 13 | 180 |
| 2b71-assembly1.cif.gz_A | plasmodium yoelii cyclophilin-like protein | 0.8979 | 14 | 178 |
| 2fu0-assembly1.cif.gz_A | plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain | 0.896 | 14 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1w74B00 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9072 | 13 | 180 | 2.40.100.10 |
| af_Q9FJX0_326_510_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8981 | 8 | 180 | 2.40.100.10 |
| af_A0A0R4J2Z8_2_164_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8924 | 9 | 180 | 2.40.100.10 |
| 1w74B00 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8867 | 13 | 180 | 2.40.100.10 |
| 1xyhA00 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8861 | 14 | 180 | 2.40.100.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A250IPL1-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.973 | 1 | 183 |
GO:0140839
GO:0140840 |
| AF-A0A250IPL1-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9678 | 1 | 183 |
GO:0140839
GO:0140840 |
| AF-A0A3A8IQQ2-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9673 | 3 | 183 |
GO:0006457
GO:0140839 GO:0140840 |
| AF-A0A4Y6C485-F1-model_v4 | deleted | 0.9637 | 1 | 183 |
|
| AF-A0A2N2PFY8-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9619 | 13 | 182 |
GO:0140839
GO:0140840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar