F464060

General Info

Members Datasets Scaffolds Average Seq Length
563 353 558 248

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10456732|Ga0207689_104567322
Length 298
Sequence MPRYKLTVEYDGRPFAGWQIQVNQLTVQGLLTSAIEALSGDKTLVQGAGRTDAGVHARGQVAHFDITSEKRPEEVRGALNFHLKPNPIAVPAVALAPPGFHARFSATARRYRYRILNRRSRPGIGAGLVWHVPVPLDERAMADAASVLVGTHDFNSFRSGSCQSKTSTKTLDVLSVHRDGEEIAIEVGARSFLHNQVRILVGTLQLVGRGQWRKADVEEALAARDRTRAGPTAPPVGLCLMEVVYGSDRVADLEESIDERWDRDASEAGRIEQQLGHALVAAMRDRAFHEIHPFDERT

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
8 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
9 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
10 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
11 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
12 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
13 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
14 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
20 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
135 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
136 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
236 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
237 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
242 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
252 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
264 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
267 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
268 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
269 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
301 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
302 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
317 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
318 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
319 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
320 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
321 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
322 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
323 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
328 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
329 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
330 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
343 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
344 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
345 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
346 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
347 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
348 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
349 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
350 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
351 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
352 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.18
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.8
Nodule 0
Rhizoplane 3.73
Rhizosphere 87.39
Stem 0
Stem Tuber 0
Unclassified 4.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544925 2209111006 Bacteria 18798
2 ARcpr5oldR_c000010 3300000041 Bacteria 39074
3 ARSoilYngRDRAFT_c00060 3300000042 Bacteria 17969
4 ARcpr5yngRDRAFT_c000016 3300000043 Bacteria 29226
5 ARSoilOldRDRAFT_c000011 3300000044 Bacteria 42914
6 ARCol0oldRDRAFT_c00012 3300000045 Bacteria 14081
7 ARCol0yngRDRAFT_1000018 3300000652 Bacteria 30924
8 JGI24032J14994_100108 3300001430 Bacteria 3758
9 JGI24752J21851_1001641 3300001976 Bacteria 3001
10 JGI24746J21847_1000298 3300001977 Bacteria 7092
11 JGI24747J21853_1000086 3300001978 Bacteria 4031
12 JGI24739J22299_10000724 3300001989 Bacteria 11949
13 JGI24737J22298_10001113 3300001990 Bacteria 9446
14 JGI24737J22298_10006046 3300001990 Bacteria 4152
15 JGI24737J22298_10027610 3300001990 Bacteria 1789
16 JGI24743J22301_10003623 3300001991 Bacteria 2458
17 JGI24745J21846_1000147 3300002073 Bacteria 5541
18 JGI24738J21930_10000997 3300002075 Bacteria 8121
19 JGI24749J21850_1000462 3300002076 Bacteria 5997
20 JGI24749J21850_1001104 3300002076 Bacteria 3832
21 JGI24744J21845_10000153 3300002077 Bacteria 10102
22 JGI24035J26624_1000923 3300002126 Bacteria 2781
23 JGI24034J26672_10000533 3300002239 Bacteria 4876
24 JGI24742J22300_10000137 3300002244 Bacteria 10780
25 JGI24751J29686_10000081 3300002459 Bacteria 53804
26 JGI24751J29686_10006955 3300002459 Bacteria 2308
27 JGI25151J46595_10000199 3300003187 Bacteria 73941
28 JGI25160J50197_1001785 3300003354 Bacteria 10415
29 Ga0065704_10106197 3300005289 Bacteria 2090
30 Ga0065712_10011139 3300005290 Bacteria 4292
31 Ga0065712_10120505 3300005290 Bacteria 1673
32 Ga0065707_10096262 3300005295 Bacteria 3287
33 Ga0065707_10113486 3300005295 Bacteria 2326
34 Ga0070676_10000506 3300005328 Bacteria 18658
35 Ga0070676_10035991 3300005328 Bacteria 2850
36 Ga0070683_100009453 3300005329 Bacteria 8336
37 Ga0070683_100185374 3300005329 Bacteria 1975
38 Ga0070690_100002629 3300005330 Bacteria 9678
39 Ga0070690_100005686 3300005330 Bacteria 7019
40 Ga0070690_100168761 3300005330 Bacteria 1505
41 Ga0070670_100000003 3300005331 Bacteria 529510
42 Ga0070670_100000021 3300005331 Bacteria 202776
43 Ga0070670_100004573 3300005331 Bacteria 11607
44 Ga0068869_100001832 3300005334 Bacteria 12767
45 Ga0070666_10025905 3300005335 Bacteria 3826
46 Ga0070666_10145779 3300005335 Bacteria 1650
47 Ga0070680_100003424 3300005336 Bacteria 11842
48 Ga0070680_100192361 3300005336 Bacteria 1719
49 Ga0070682_100001699 3300005337 Bacteria 12232
50 Ga0070682_100127114 3300005337 Bacteria 1720
51 Ga0068868_100012331 3300005338 Bacteria 6246
52 Ga0070660_100008125 3300005339 Bacteria 7333
53 Ga0070660_100303627 3300005339 Bacteria 1309
54 Ga0070689_100000668 3300005340 Bacteria 20748
55 Ga0070689_100018827 3300005340 Bacteria 5096
56 Ga0070691_10011670 3300005341 Bacteria 4017
57 Ga0070691_10126822 3300005341 Bacteria 1289
58 Ga0070687_100000527 3300005343 Bacteria 12848
59 Ga0070687_100096954 3300005343 Bacteria 1643
60 Ga0070661_100003238 3300005344 Bacteria 11222
61 Ga0070692_10001083 3300005345 Bacteria 9454
62 Ga0070692_10001570 3300005345 Bacteria 8386
63 Ga0070692_10014904 3300005345 Bacteria 3663
64 Ga0070668_100000055 3300005347 Bacteria 70835
65 Ga0070668_100003117 3300005347 Bacteria 12247
66 Ga0070668_100112166 3300005347 Bacteria 2171
67 Ga0070669_100000044 3300005353 Bacteria 121087
68 Ga0070669_100001315 3300005353 Bacteria 17944
69 Ga0070669_100113249 3300005353 Bacteria 2061
70 Ga0070675_100002954 3300005354 Bacteria 12826
71 Ga0070675_100015172 3300005354 Bacteria 6084
72 Ga0070675_100670546 3300005354 Bacteria 943
73 Ga0070671_100000894 3300005355 Bacteria 21729
74 Ga0070671_100035414 3300005355 Bacteria 4136
75 Ga0070674_100002968 3300005356 Bacteria 9419
76 Ga0070674_100154060 3300005356 Bacteria 1737
77 Ga0070673_100001477 3300005364 Bacteria 13763
78 Ga0070688_100001239 3300005365 Bacteria 12735
79 Ga0070688_100006198 3300005365 Bacteria 6369
80 Ga0070659_100002622 3300005366 Bacteria 12786
81 Ga0070659_100015463 3300005366 Bacteria 5717
82 Ga0070659_100227739 3300005366 Bacteria 1540
83 Ga0070667_100000122 3300005367 Bacteria 99820
84 Ga0070667_100005188 3300005367 Bacteria 10886
85 Ga0070667_100005584 3300005367 Bacteria 10501
86 Ga0070667_100015151 3300005367 Bacteria 6368
87 Ga0070667_100171642 3300005367 Bacteria 1915
88 Ga0070703_10006319 3300005406 Bacteria 3319
89 Ga0070709_10005348 3300005434 Bacteria 6954
90 Ga0070714_100017351 3300005435 Bacteria 5830
91 Ga0070713_100015040 3300005436 Bacteria 5765
92 Ga0070710_10045002 3300005437 Bacteria 2451
93 Ga0070701_10002283 3300005438 Bacteria 7348
94 Ga0070701_10008389 3300005438 Bacteria 4467
95 Ga0070711_100011236 3300005439 Bacteria 5553
96 Ga0070705_100001458 3300005440 Bacteria 12507
97 Ga0070700_100001211 3300005441 Bacteria 12787
98 Ga0070694_100001764 3300005444 Bacteria 12786
99 Ga0070694_100155907 3300005444 Bacteria 1672
100 Ga0070663_100000761 3300005455 Bacteria 17492
101 Ga0070678_100000525 3300005456 Bacteria 18583
102 Ga0070678_100008923 3300005456 Bacteria 6038
103 Ga0070662_100002968 3300005457 Bacteria 10539
104 Ga0070662_100050510 3300005457 Bacteria 3000
105 Ga0070681_10004977 3300005458 Bacteria 12786
106 Ga0070681_10033528 3300005458 Bacteria 5155
107 Ga0068867_100002950 3300005459 Bacteria 11984
108 Ga0070685_10003505 3300005466 Bacteria 7982
109 Ga0070685_10229619 3300005466 Bacteria 1220
110 Ga0070706_100557410 3300005467 Bacteria 1066
111 Ga0070699_100145636 3300005518 Bacteria 2093
112 Ga0070679_100015045 3300005530 Bacteria 7434
113 Ga0070679_100157125 3300005530 Bacteria 2248
114 Ga0070684_100005941 3300005535 Bacteria 9401
115 Ga0068853_100003070 3300005539 Bacteria 12759
116 Ga0068853_100050832 3300005539 Bacteria 3566
117 Ga0070672_100002960 3300005543 Bacteria 10932
118 Ga0070672_100464894 3300005543 Bacteria 1091
119 Ga0070686_100001573 3300005544 Bacteria 12811
120 Ga0070686_100008797 3300005544 Bacteria 5658
121 Ga0070695_100002369 3300005545 Bacteria 10826
122 Ga0070695_100091328 3300005545 Bacteria 2033
123 Ga0070696_100028599 3300005546 Bacteria 3804
124 Ga0070693_100000880 3300005547 Bacteria 13363
125 Ga0070693_100282566 3300005547 Bacteria 1112
126 Ga0070665_100025279 3300005548 Bacteria 5983
127 Ga0070704_100001917 3300005549 Bacteria 11493
128 Ga0068855_100009051 3300005563 Bacteria 12031
129 Ga0068855_100111759 3300005563 Bacteria 3136
130 Ga0070664_100002934 3300005564 Bacteria 13792
131 Ga0070664_100379526 3300005564 Bacteria 1290
132 Ga0068857_100000358 3300005577 Bacteria 31869
133 Ga0068857_100015287 3300005577 Bacteria 6700
134 Ga0068857_100086207 3300005577 Bacteria 2807
135 Ga0068857_100163221 3300005577 Bacteria 2022
136 Ga0068854_100003080 3300005578 Bacteria 10382
137 Ga0068856_100065216 3300005614 Bacteria 3598
138 Ga0068856_100069199 3300005614 Bacteria 3490
139 Ga0070702_100000526 3300005615 Bacteria 13792
140 Ga0068852_101152709 3300005616 Bacteria 796
141 Ga0068859_100005591 3300005617 Bacteria 12805
142 Ga0068859_100014466 3300005617 Bacteria 7921
143 Ga0068859_100018845 3300005617 Bacteria 6934
144 Ga0068859_100065369 3300005617 Bacteria 3671
145 Ga0068859_100488010 3300005617 Bacteria 1327
146 Ga0068864_100000004 3300005618 Bacteria 489341
147 Ga0068864_100000158 3300005618 Bacteria 62676
148 Ga0068864_100001988 3300005618 Bacteria 16835
149 Ga0068861_100001805 3300005719 Bacteria 13785
150 Ga0068861_100011624 3300005719 Bacteria 6125
151 Ga0068861_100040005 3300005719 Bacteria 3503
152 Ga0068861_100041488 3300005719 Bacteria 3447
153 Ga0068870_10000025 3300005840 Bacteria 46848
154 Ga0068863_100000002 3300005841 Bacteria 489510
155 Ga0068863_100000030 3300005841 Bacteria 176023
156 Ga0068863_100002964 3300005841 Bacteria 16783
157 Ga0068863_100057811 3300005841 Bacteria 3670
158 Ga0068858_100003227 3300005842 Bacteria 16273
159 Ga0068860_100000152 3300005843 Bacteria 112187
160 Ga0068860_100007120 3300005843 Bacteria 11192
161 Ga0068860_100055285 3300005843 Bacteria 3773
162 Ga0068862_100000001 3300005844 Bacteria 523031
163 Ga0068862_100000002 3300005844 Bacteria 489341
164 Ga0068862_100032289 3300005844 Bacteria 4423
165 Ga0081455_10000276 3300005937 Bacteria 68055
166 Ga0081455_10000545 3300005937 Bacteria 48941
167 Ga0081538_10086861 3300005981 Bacteria 1635
168 Ga0081540_1004944 3300005983 Bacteria 10022
169 Ga0075365_10047707 3300006038 Bacteria 2816
170 Ga0075432_10011268 3300006058 Bacteria 3039
171 Ga0075432_10085603 3300006058 Bacteria 1148
172 Ga0070715_10000196 3300006163 Bacteria 14161
173 Ga0075367_10208140 3300006178 Bacteria 1223
174 Ga0097621_100000456 3300006237 Bacteria 28666
175 Ga0075370_10060370 3300006353 Bacteria 2160
176 Ga0068871_100000269 3300006358 Bacteria 35773
177 Ga0075428_100136861 3300006844 Bacteria 2663
178 Ga0075430_100243354 3300006846 Bacteria 1491
179 Ga0075431_100030106 3300006847 Bacteria 5589
180 Ga0075433_10021666 3300006852 Bacteria 5391
181 Ga0075434_100011399 3300006871 Bacteria 8385
182 Ga0068865_100001731 3300006881 Bacteria 12818
183 Ga0068865_100055301 3300006881 Bacteria 2761
184 Ga0075436_100444135 3300006914 Bacteria 944
185 Ga0097620_100005590 3300006931 Bacteria 12805
186 Ga0097620_100014466 3300006931 Bacteria 7921
187 Ga0097620_100018845 3300006931 Bacteria 6934
188 Ga0097620_100065370 3300006931 Bacteria 3671
189 Ga0097620_100488013 3300006931 Bacteria 1327
190 Ga0075435_100139121 3300007076 Bacteria 2036
191 Ga0105251_10022538 3300009011 Bacteria 3268
192 Ga0105250_10025819 3300009092 Bacteria 2367
193 Ga0111539_10003217 3300009094 Bacteria 21607
194 Ga0111539_10007321 3300009094 Bacteria 14133
195 Ga0105245_10000183 3300009098 Bacteria 59105
196 Ga0105247_10009563 3300009101 Bacteria 5882
197 Ga0105247_10076689 3300009101 Bacteria 2099
198 Ga0105247_10566023 3300009101 Bacteria 838
199 Ga0114129_10020394 3300009147 Bacteria 9429
200 Ga0105243_10001561 3300009148 Bacteria 20018
201 Ga0105243_10064823 3300009148 Bacteria 2933
202 Ga0105243_10581004 3300009148 Bacteria 1075
203 Ga0105241_10003567 3300009174 Bacteria 11569
204 Ga0105242_10000701 3300009176 Bacteria 26184
205 Ga0105248_10000010 3300009177 Bacteria 344314
206 Ga0105248_10000287 3300009177 Bacteria 59537
207 Ga0105248_10010394 3300009177 Bacteria 10250
208 Ga0105248_10048525 3300009177 Bacteria 4763
209 Ga0105237_10072251 3300009545 Bacteria 3444
210 Ga0105237_10248367 3300009545 Bacteria 1781
211 Ga0105238_10404069 3300009551 Bacteria 1359
212 Ga0105249_10000041 3300009553 Bacteria 195999
213 Ga0105249_10007674 3300009553 Bacteria 9406
214 Ga0105249_10009795 3300009553 Bacteria 8397
215 Ga0105249_10037419 3300009553 Bacteria 4404
216 Ga0105249_10157328 3300009553 Bacteria 2193
217 Ga0105249_10499013 3300009553 Bacteria 1262
218 Ga0105239_10170015 3300010375 Bacteria 2437
219 Ga0105246_10002447 3300011119 Bacteria 11209
220 Ga0157337_1000504 3300012483 Bacteria 1801
221 Ga0157342_1001861 3300012507 Bacteria 1635
222 Ga0157326_1000433 3300012513 Bacteria 4960
223 Ga0157371_10018807 3300013102 Bacteria 5103
224 Ga0157369_10631810 3300013105 Bacteria 1105
225 Ga0157374_10000463 3300013296 Bacteria 36848
226 Ga0157378_10000613 3300013297 Bacteria 33512
227 Ga0157378_10078681 3300013297 Bacteria 2975
228 Ga0157378_10189118 3300013297 Bacteria 1941
229 Ga0163162_10020966 3300013306 Bacteria 6429
230 Ga0163162_10514426 3300013306 Bacteria 1327
231 Ga0157372_10010921 3300013307 Bacteria 9665
232 Ga0157372_10458495 3300013307 Bacteria 1486
233 Ga0157375_10004786 3300013308 Bacteria 11768
234 Ga0157375_10639127 3300013308 Bacteria 1221
235 Ga0163163_10201970 3300014325 Bacteria 2036
236 Ga0157380_10004641 3300014326 Bacteria 9554
237 Ga0157380_10164250 3300014326 Bacteria 1933
238 Ga0182008_10151350 3300014497 Bacteria 1164
239 Ga0157379_10003902 3300014968 Bacteria 12714
240 Ga0157379_10146649 3300014968 Bacteria 2128
241 Ga0157376_10003730 3300014969 Bacteria 10526
242 Ga0157376_10435195 3300014969 Bacteria 1276
243 Ga0206353_11997182 3300020082 Bacteria 20195
244 Ga0213875_10004900 3300021388 Bacteria 7267
245 Ga0207666_1000140 3300025271 Bacteria 11329
246 Ga0209130_1000749 3300025284 Bacteria 28197
247 Ga0207673_1000039 3300025290 Bacteria 10384
248 Ga0209025_1000847 3300025294 Bacteria 48445
249 Ga0209758_1002804 3300025297 Bacteria 17007
250 Ga0207426_1000616 3300025302 Bacteria 45569
251 Ga0207697_10000763 3300025315 Bacteria 18220
252 Ga0207696_1022621 3300025711 Bacteria 1994
253 Ga0207713_1019929 3300025735 Bacteria 3266
254 Ga0207653_10001778 3300025885 Bacteria 6892
255 Ga0207692_10056041 3300025898 Bacteria 2020
256 Ga0207710_10004068 3300025900 Bacteria 6431
257 Ga0207688_10001992 3300025901 Bacteria 10954
258 Ga0207688_10086237 3300025901 Bacteria 1799
259 Ga0207680_10028054 3300025903 Bacteria 3144
260 Ga0207680_10127284 3300025903 Bacteria 1674
261 Ga0207680_10135703 3300025903 Bacteria 1626
262 Ga0207647_10003504 3300025904 Bacteria 11767
263 Ga0207685_10106615 3300025905 Bacteria 1208
264 Ga0207699_10048618 3300025906 Bacteria 2492
265 Ga0207645_10000248 3300025907 Bacteria 44949
266 Ga0207643_10000064 3300025908 Bacteria 70490
267 Ga0207705_10143274 3300025909 Bacteria 1786
268 Ga0207654_10001623 3300025911 Bacteria 11742
269 Ga0207707_10002084 3300025912 Bacteria 18100
270 Ga0207707_10523957 3300025912 Bacteria 1009
271 Ga0207671_10007347 3300025914 Bacteria 9567
272 Ga0207671_10016982 3300025914 Bacteria 5633
273 Ga0207693_10031950 3300025915 Bacteria 4159
274 Ga0207660_10000194 3300025917 Bacteria 38742
275 Ga0207662_10001637 3300025918 Bacteria 10959
276 Ga0207662_10062873 3300025918 Bacteria 2231
277 Ga0207657_10006919 3300025919 Bacteria 11695
278 Ga0207657_10424603 3300025919 Bacteria 1044
279 Ga0207649_10000234 3300025920 Bacteria 45397
280 Ga0207649_10072825 3300025920 Bacteria 2199
281 Ga0207652_10001613 3300025921 Bacteria 19823
282 Ga0207681_10000041 3300025923 Bacteria 140201
283 Ga0207681_10000794 3300025923 Bacteria 20828
284 Ga0207681_10061762 3300025923 Bacteria 2577
285 Ga0207650_10000004 3300025925 Bacteria 743372
286 Ga0207650_10000298 3300025925 Bacteria 49421
287 Ga0207650_10010580 3300025925 Bacteria 6336
288 Ga0207659_10000172 3300025926 Bacteria 38725
289 Ga0207659_10396630 3300025926 Bacteria 1153
290 Ga0207687_10008699 3300025927 Bacteria 6631
291 Ga0207700_10006617 3300025928 Bacteria 7021
292 Ga0207664_10078623 3300025929 Bacteria 2675
293 Ga0207644_10000169 3300025931 Bacteria 46645
294 Ga0207644_10000439 3300025931 Bacteria 26923
295 Ga0207690_10000796 3300025932 Bacteria 20342
296 Ga0207690_10056673 3300025932 Bacteria 2644
297 Ga0207706_10005059 3300025933 Bacteria 12314
298 Ga0207686_10001093 3300025934 Bacteria 15891
299 Ga0207709_10001438 3300025935 Bacteria 16619
300 Ga0207709_10012223 3300025935 Bacteria 4730
301 Ga0207670_10000807 3300025936 Bacteria 16336
302 Ga0207670_10131498 3300025936 Bacteria 1834
303 Ga0207669_10000141 3300025937 Bacteria 34618
304 Ga0207669_10130268 3300025937 Bacteria 1727
305 Ga0207669_10303083 3300025937 Bacteria 1215
306 Ga0207704_10000755 3300025938 Bacteria 14264
307 Ga0207665_10002433 3300025939 Bacteria 12590
308 Ga0207691_10006997 3300025940 Bacteria 10884
309 Ga0207691_10210058 3300025940 Bacteria 1691
310 Ga0207711_10000038 3300025941 Bacteria 163520
311 Ga0207711_10000658 3300025941 Bacteria 34432
312 Ga0207711_10006747 3300025941 Bacteria 9652
313 Ga0207711_10035665 3300025941 Bacteria 4218
314 Ga0207689_10456732 3300025942 Bacteria 1068
315 Ga0207661_10000098 3300025944 Bacteria 55518
316 Ga0207661_10138465 3300025944 Bacteria 2092
317 Ga0207679_10000174 3300025945 Bacteria 53051
318 Ga0207679_10097786 3300025945 Bacteria 2287
319 Ga0207679_10680521 3300025945 Bacteria 932
320 Ga0207667_10004743 3300025949 Bacteria 16630
321 Ga0207667_10207178 3300025949 Bacteria 2010
322 Ga0207651_10000782 3300025960 Bacteria 13684
323 Ga0207712_10000659 3300025961 Bacteria 26800
324 Ga0207712_10005928 3300025961 Bacteria 7703
325 Ga0207668_10001107 3300025972 Bacteria 16030
326 Ga0207668_10002109 3300025972 Bacteria 11604
327 Ga0207668_10012828 3300025972 Bacteria 5142
328 Ga0207640_10000846 3300025981 Bacteria 17376
329 Ga0207640_10035208 3300025981 Bacteria 3131
330 Ga0207658_10000092 3300025986 Bacteria 99965
331 Ga0207658_10000474 3300025986 Bacteria 37159
332 Ga0207658_10001843 3300025986 Bacteria 15875
333 Ga0207658_10003847 3300025986 Bacteria 10575
334 Ga0207658_10199433 3300025986 Bacteria 1670
335 Ga0207677_10144090 3300026023 Bacteria 1828
336 Ga0207703_10002433 3300026035 Bacteria 16135
337 Ga0207639_10017221 3300026041 Bacteria 5123
338 Ga0207639_10361416 3300026041 Bacteria 1299
339 Ga0207678_10001059 3300026067 Bacteria 25176
340 Ga0207708_10002793 3300026075 Bacteria 12833
341 Ga0207702_10014464 3300026078 Bacteria 6553
342 Ga0207702_10067037 3300026078 Bacteria 3079
343 Ga0207641_10000001 3300026088 Bacteria 1180841
344 Ga0207641_10000002 3300026088 Bacteria 981004
345 Ga0207641_10000622 3300026088 Bacteria 38657
346 Ga0207641_10009974 3300026088 Bacteria 7815
347 Ga0207641_10135165 3300026088 Bacteria 2219
348 Ga0207648_10009300 3300026089 Bacteria 9423
349 Ga0207676_10000005 3300026095 Bacteria 698744
350 Ga0207676_10000006 3300026095 Bacteria 681936
351 Ga0207676_10002696 3300026095 Bacteria 12630
352 Ga0207674_10001342 3300026116 Bacteria 31848
353 Ga0207674_10021817 3300026116 Bacteria 6892
354 Ga0207674_10036947 3300026116 Bacteria 5083
355 Ga0207674_10175278 3300026116 Bacteria 2097
356 Ga0207675_100000309 3300026118 Bacteria 46765
357 Ga0207675_100006706 3300026118 Bacteria 10886
358 Ga0207675_100011711 3300026118 Bacteria 8203
359 Ga0207675_100489763 3300026118 Bacteria 1223
360 Ga0207683_10001193 3300026121 Bacteria 23509
361 Ga0207683_10010913 3300026121 Bacteria 7748
362 Ga0209973_1003691 3300027252 Bacteria 1525
363 Ga0209982_1015579 3300027552 Bacteria 1154
364 Ga0209971_1015247 3300027682 Bacteria 1822
365 Ga0209966_1001072 3300027695 Bacteria 4995
366 Ga0209966_1002975 3300027695 Bacteria 2842
367 Ga0209998_10001333 3300027717 Bacteria 5996
368 Ga0209998_10001362 3300027717 Bacteria 5937
369 Ga0209974_10014808 3300027876 Bacteria 2590
370 Ga0209974_10020958 3300027876 Bacteria 2166
371 Ga0207428_10000513 3300027907 Bacteria 46311
372 Ga0207428_10000626 3300027907 Bacteria 41522
373 Ga0268266_10305765 3300028379 Bacteria 1485
374 Ga0268265_10000001 3300028380 Bacteria 1230727
375 Ga0268265_10000003 3300028380 Bacteria 949201
376 Ga0268265_10002370 3300028380 Bacteria 14256
377 Ga0268265_10014719 3300028380 Bacteria 5337
378 Ga0268264_10000111 3300028381 Bacteria 204718
379 Ga0268264_10004444 3300028381 Bacteria 11961
380 Ga0268264_10276778 3300028381 Bacteria 1570
381 Ga0316576_10128314 3300031727 Bacteria 1907
382 Ga0307405_10542773 3300031731 Bacteria 939
383 Ga0307406_10018812 3300031901 Bacteria 4043
384 Ga0307406_10145223 3300031901 Bacteria 1685
385 Ga0307412_10001980 3300031911 Bacteria 11350
386 Ga0307412_10015841 3300031911 Bacteria 4477
387 Ga0307412_10043249 3300031911 Bacteria 2932
388 Ga0307416_100191670 3300032002 Bacteria 1929
389 Ga0316583_10079080 3300032133 Bacteria 1149
390 Ga0307510_10119715 3300033180 Bacteria 2342
391 Ga0373930_0004579 3300034816 Bacteria 2260
392 Ga0373948_0000049 3300034817 Bacteria 12986
393 Ga0373948_0010541 3300034817 Bacteria 1616
394 Ga0373950_0000665 3300034818 Bacteria 4258
395 Ga0373958_0000026 3300034819 Bacteria 16079
396 Ga0373958_0000135 3300034819 Bacteria 8219
397 Ga0373959_0001171 3300034820 Bacteria 4235
398 Ga0373959_0002832 3300034820 Bacteria 2756
399 Ga0373938_0000133 3300034957 Bacteria 10609
400 Ga0373928_0007183 3300035084 Bacteria 2147
401 Ga0373929_0000110 3300035085 Bacteria 13537
402 Ga0373929_0004350 3300035085 Bacteria 2543
403 Ga0373940_0002247 3300035088 Bacteria 3714
404 Ga0373940_0006899 3300035088 Bacteria 2543
405 Ga0373949_0000771 3300035090 Bacteria 10307
406 Ga0373949_0001010 3300035090 Bacteria 8668
407 Ga0373951_0003615 3300035091 Bacteria 3728
408 Ga0373952_0000200 3300035092 Bacteria 9497
409 Ga0373932_0000822 3300035112 Bacteria 9175
410 Ga0373932_0001180 3300035112 Bacteria 7469
411 Ga0373939_0003897 3300035114 Bacteria 3509
412 Ga0373941_0000259 3300035115 Bacteria 10177
413 Ga0373960_0000277 3300035121 Bacteria 9832
414 Ga0373960_0001175 3300035121 Bacteria 5700
415 Ga0373942_0029123 3300035207 Bacteria 1447
416 Ga0373961_0001383 3300035241 Bacteria 7253
417 Ga0373961_0001598 3300035241 Bacteria 6444
418 Ga0373962_0000275 3300035242 Bacteria 11095
419 Ga0373931_0002417 3300035691 Bacteria 8259
420 Ga0373931_0007842 3300035691 Bacteria 5046
421 Ga0373931_0032643 3300035691 Bacteria 2695
422 Ga0373927_0197669 3300035695 Bacteria 1320
423 Ga0373933_0130460 3300035724 Unclassified 1580
424 Ga0316582_0108359 3300036647 Bacteria 1847
425 Ga0395899_0218369 3300037312 Bacteria 1322
426 Ga0395900_0002906 3300037418 Bacteria 18663
427 Ga0395898_0125357 3300037466 Bacteria 2460
428 Ga0436364_1309894 3300037853 Bacteria 49139
429 Ga0395901_0006644 3300038443 Bacteria 11686
430 Ga0395901_0190413 3300038443 Bacteria 2151
431 Ga0242420_016335 3300038996 Bacteria 1292
432 Ga0451806_525822 3300041462 Bacteria 1499
433 Ga0439463_026003 3300042016 Bacteria 1470
434 Ga0450907_005098 3300042146 Bacteria 2229
435 Ga0439444_0022357 3300042437 Bacteria 1127
436 Ga0439464_0011060 3300042439 Bacteria 2386
437 Ga0466973_0110359 3300044659 Bacteria 2301
438 Ga0451576_0013587 3300045051 Bacteria 9101
439 Ga0495663_0035443 3300046525 Bacteria 1499
440 Ga0495654_0008624 3300046530 Bacteria 5621
441 Ga0495654_0034158 3300046530 Bacteria 2568
442 Ga0495597_0010903 3300046542 Bacteria 4422
443 Ga0495633_0187535 3300046558 Bacteria 951
444 Ga0495668_0005443 3300046616 Bacteria 8636
445 Ga0495668_0012118 3300046616 Bacteria 5128
446 Ga0495668_0029780 3300046616 Bacteria 3084
447 Ga0495625_0500182 3300046660 Bacteria 743
448 Ga0495669_0194113 3300046684 Bacteria 969
449 Ga0495677_0021568 3300047445 Bacteria 2334
450 Ga0495686_0000302 3300047472 Bacteria 84826
451 Ga0495686_0017645 3300047472 Bacteria 4802
452 Ga0495686_0022875 3300047472 Bacteria 4130
453 Ga0495686_0118679 3300047472 Bacteria 1579
454 Ga0496100_0000447 3300048903 Bacteria 19924
455 Ga0496101_0001349 3300048904 Bacteria 14712
456 Ga0496101_0557092 3300048904 Bacteria 906
457 Ga0496102_0002263 3300048905 Bacteria 16489
458 Ga0496102_0002354 3300048905 Bacteria 16125
459 Ga0496102_0344120 3300048905 Bacteria 1404
460 Ga0496103_0000837 3300048906 Bacteria 22480
461 Ga0496103_0001362 3300048906 Bacteria 16473
462 Ga0496106_0001351 3300048909 Bacteria 18370
463 Ga0496106_0150742 3300048909 Bacteria 1834
464 Ga0496107_0001211 3300048910 Bacteria 15713
465 Ga0496107_0154644 3300048910 Bacteria 1698
466 Ga0496107_0246573 3300048910 Bacteria 1329
467 Ga0496109_0005044 3300048912 Bacteria 11034
468 Ga0496110_0030428 3300048913 Bacteria 4654
469 Ga0496110_0030903 3300048913 Bacteria 4619
470 Ga0496111_0060526 3300048914 Bacteria 2745
471 Ga0496113_0192565 3300048916 Bacteria 1618
472 Ga0496114_0001734 3300048917 Bacteria 16551
473 Ga0496115_0000592 3300048918 Bacteria 27769
474 Ga0496116_0003256 3300048919 Bacteria 16177
475 Ga0496117_0004043 3300048920 Bacteria 16489
476 Ga0496117_0004127 3300048920 Bacteria 16262
477 Ga0496118_0000463 3300048921 Bacteria 67382
478 Ga0496118_0004497 3300048921 Bacteria 16489
479 Ga0496118_0027922 3300048921 Bacteria 4766
480 Ga0496119_0016231 3300048922 Bacteria 5684
481 Ga0496119_0164339 3300048922 Bacteria 1177
482 Ga0496119_0164696 3300048922 Bacteria 1175
483 Ga0496120_0131593 3300048923 Bacteria 1280
484 Ga0496120_0175430 3300048923 Bacteria 1057
485 Ga0496122_0389929 3300048925 Bacteria 711
486 Ga0496124_0004389 3300048927 Bacteria 16489
487 Ga0496124_0072061 3300048927 Bacteria 2862
488 Ga0496126_0110561 3300048929 Bacteria 2394
489 Ga0501290_000038 3300049513 Bacteria 17018
490 Ga0501292_000038 3300049515 Bacteria 31848
491 Ga0501294_000225 3300049517 Bacteria 6944
492 Ga0501032_0015359 3300049569 Bacteria 5405
493 Ga0501034_0097580 3300049571 Bacteria 2934
494 Ga0501038_0020281 3300049574 Bacteria 5979
495 Ga0501039_0227957 3300049575 Bacteria 1464
496 Ga0501041_0231945 3300049577 Bacteria 1159
497 Ga0501043_0010164 3300049579 Bacteria 7377
498 Ga0501043_0150354 3300049579 Bacteria 1822
499 Ga0501047_0000876 3300049581 Bacteria 30712
500 Ga0501068_0219173 3300049584 Bacteria 1209
501 Ga0501070_0264359 3300049586 Bacteria 1406
502 Ga0501072_0392571 3300049588 Bacteria 1101
503 Ga0501075_0233841 3300049591 Bacteria 1401
504 Ga0501075_0317299 3300049591 Bacteria 1188
505 Ga0501076_0098870 3300049592 Bacteria 2351
506 Ga0501077_0033324 3300049593 Bacteria 3278
507 Ga0501077_0185458 3300049593 Bacteria 1322
508 Ga0501202_031880 3300049652 Bacteria 1104
509 Ga0501206_001289 3300049653 Bacteria 3130
510 Ga0501223_002886 3300049663 Bacteria 3770
511 Ga0501224_003519 3300049664 Bacteria 2191
512 Ga0501235_009139 3300049669 Bacteria 2165
513 Ga0501249_000464 3300049679 Bacteria 10123
514 Ga0501259_004554 3300049688 Bacteria 2205
515 Ga0501261_000037 3300049690 Bacteria 27038
516 Ga0501079_0102332 3300049741 Bacteria 2221
517 Ga0501080_0068719 3300049742 Bacteria 3295
518 Ga0501081_0382498 3300049743 Bacteria 1040
519 Ga0501279_000016 3300049775 Bacteria 64067
520 Ga0501280_000059 3300049776 Bacteria 31802
521 Ga0501281_00345 3300049777 Bacteria 4757
522 Ga0501282_000110 3300049778 Bacteria 9466
523 Ga0501044_0240007 3300049823 Bacteria 1756
524 Ga0501044_0384362 3300049823 Bacteria 1318
525 Ga0501045_0177761 3300049824 Bacteria 1586
526 nmdc:mga06z11_73418_c1 3300050494 Bacteria 1816
527 nmdc:mga09592_281149_c1 3300050508 Bacteria 1443
528 nmdc:mga0qj67_286469_c1 3300050509 Bacteria 1335
529 nmdc:mga06r32_114169_c1 3300050510 Bacteria 2659
530 nmdc:mga08y16_7407_c1 3300050511 Bacteria 11499
531 nmdc:mga08y16_8959_c1 3300050511 Bacteria 10509
532 nmdc:mga0n895_298486_c1 3300050512 Bacteria 1633
533 nmdc:mga0n895_3698_c1 3300050512 Bacteria 12366
534 nmdc:mga0rr50_227667_c1 3300050513 Bacteria 1541
535 nmdc:mga0rr50_390810_c1 3300050513 Bacteria 1174
536 nmdc:mga0rr50_401477_c1 3300050513 Bacteria 1158
537 nmdc:mga0a205_1633_c1 3300050515 Bacteria 19288
538 nmdc:mga0a205_94603_c1 3300050515 Bacteria 2886
539 Ga0495619_0195583 3300053085 Bacteria 1400
540 Ga0500643_000115 3300053087 Bacteria 84126
541 Ga0500643_000326 3300053087 Bacteria 38307
542 Ga0500643_001868 3300053087 Bacteria 11468
543 Ga0500643_083140 3300053087 Bacteria 878
544 Ga0500647_0032167 3300053091 Bacteria 2499
545 Ga0500651_0002180 3300053093 Bacteria 10245
546 Ga0500592_000019 3300053116 Bacteria 57900
547 Ga0500614_023206 3300053123 Bacteria 1456
548 Ga0500655_000162 3300053133 Bacteria 16347
549 Ga0500577_0027326 3300053142 Bacteria 1953
550 Ga0500590_000967 3300053148 Bacteria 11087
551 Ga0500622_0006224 3300053156 Bacteria 6981
552 Ga0500627_0000211 3300053158 Bacteria 16854
553 Ga0500627_0003527 3300053158 Bacteria 4854
554 Ga0500627_0036531 3300053158 Bacteria 2092
555 Ga0500627_0052392 3300053158 Bacteria 1781
556 Ga0500570_000414 3300053724 Bacteria 16236
557 Ga0501084_0030992 3300054114 Bacteria 4472
558 Ga0501084_0120232 3300054114 Bacteria 2209

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0389929 Ga0496122_0389929_31_693 219
2 3300053123 Ga0500614_023206 Ga0500614_023206_10_675 219
3 3300048922 Ga0496119_0016231 Ga0496119_0016231_3707_4447 226
4 3300048923 Ga0496120_0175430 Ga0496120_0175430_63_803 226
5 3300046660 Ga0495625_0500182 Ga0495625_0500182_11_709 230
6 3300048921 Ga0496118_0027922 Ga0496118_0027922_2188_2886 230
7 3300046616 Ga0495668_0005443 Ga0495668_0005443_1582_2349 232
8 3300047472 Ga0495686_0000302 Ga0495686_0000302_12017_12757 237
9 3300005328 Ga0070676_10035991 Ga0070676_100359912 239
10 3300005330 Ga0070690_100168761 Ga0070690_1001687612 239
11 3300005456 Ga0070678_100008923 Ga0070678_1000089234 239
12 3300013297 Ga0157378_10189118 Ga0157378_101891182 239
13 3300014969 Ga0157376_10435195 Ga0157376_104351952 239
14 3300025937 Ga0207669_10130268 Ga0207669_101302683 239
15 3300026121 Ga0207683_10010913 Ga0207683_100109135 239
16 iso_pu_bacteria 2582581305 2585260207 241
17 iso_pu_bacteria 2643221541 2643730016 241
18 iso_pu_bacteria 2643221605 2644039801 241
19 iso_pu_bacteria 2643221606 2644045502 241
20 iso_pu_bacteria 2643221671 2644392872 241
21 3300031727 Ga0316576_10128314 Ga0316576_101283143 244
22 2209111006 2214544925 2213593502 245
23 3300000041 ARcpr5oldR_c000010 ARcpr5oldR_00001015 245
24 3300000042 ARSoilYngRDRAFT_c00060 ARSoilYngRDRAFT_0006017 245
25 3300000043 ARcpr5yngRDRAFT_c000016 ARcpr5yngRDRAFT_0000164 245
26 3300000044 ARSoilOldRDRAFT_c000011 ARSoilOldRDRAFT_00001129 245
27 3300000045 ARCol0oldRDRAFT_c00012 ARCol0oldRDRAFT_0001212 245
28 3300000652 ARCol0yngRDRAFT_1000018 ARCol0yngRDRAFT_100001829 245
29 3300001430 JGI24032J14994_100108 JGI24032J14994_1001084 245
30 3300001976 JGI24752J21851_1001641 JGI24752J21851_10016412 245
31 3300001977 JGI24746J21847_1000298 JGI24746J21847_10002982 245
32 3300001978 JGI24747J21853_1000086 JGI24747J21853_10000864 245
33 3300001989 JGI24739J22299_10000724 JGI24739J22299_100007244 245
34 3300001990 JGI24737J22298_10001113 JGI24737J22298_100011135 245
35 3300001990 JGI24737J22298_10006046 JGI24737J22298_100060465 245
36 3300001990 JGI24737J22298_10027610 JGI24737J22298_100276102 245
37 3300001991 JGI24743J22301_10003623 JGI24743J22301_100036232 245
38 3300002073 JGI24745J21846_1000147 JGI24745J21846_10001473 245
39 3300002075 JGI24738J21930_10000997 JGI24738J21930_100009977 245
40 3300002076 JGI24749J21850_1000462 JGI24749J21850_10004626 245
41 3300002076 JGI24749J21850_1001104 JGI24749J21850_10011043 245
42 3300002077 JGI24744J21845_10000153 JGI24744J21845_100001534 245
43 3300002126 JGI24035J26624_1000923 JGI24035J26624_10009233 245
44 3300002239 JGI24034J26672_10000533 JGI24034J26672_100005332 245
45 3300002244 JGI24742J22300_10000137 JGI24742J22300_100001379 245
46 3300002459 JGI24751J29686_10000081 JGI24751J29686_1000008166 245
47 3300002459 JGI24751J29686_10006955 JGI24751J29686_100069552 245
48 3300003187 JGI25151J46595_10000199 JGI25151J46595_1000019935 245
49 3300003354 JGI25160J50197_1001785 JGI25160J50197_100178511 245
50 3300005289 Ga0065704_10106197 Ga0065704_101061972 245
51 3300005290 Ga0065712_10011139 Ga0065712_100111392 245
52 3300005290 Ga0065712_10120505 Ga0065712_101205052 245
53 3300005295 Ga0065707_10096262 Ga0065707_100962623 245
54 3300005295 Ga0065707_10113486 Ga0065707_101134862 245
55 3300005328 Ga0070676_10000506 Ga0070676_1000050613 245
56 3300005329 Ga0070683_100009453 Ga0070683_1000094538 245
57 3300005329 Ga0070683_100185374 Ga0070683_1001853742 245
58 3300005330 Ga0070690_100002629 Ga0070690_1000026293 245
59 3300005330 Ga0070690_100005686 Ga0070690_1000056865 245
60 3300005331 Ga0070670_100000003 Ga0070670_100000003124 245
61 3300005331 Ga0070670_100000021 Ga0070670_100000021132 245
62 3300005331 Ga0070670_100004573 Ga0070670_1000045734 245
63 3300005334 Ga0068869_100001832 Ga0068869_1000018327 245
64 3300005335 Ga0070666_10025905 Ga0070666_100259052 245
65 3300005335 Ga0070666_10145779 Ga0070666_101457792 245
66 3300005336 Ga0070680_100003424 Ga0070680_1000034246 245
67 3300005336 Ga0070680_100192361 Ga0070680_1001923612 245
68 3300005337 Ga0070682_100001699 Ga0070682_1000016996 245
69 3300005337 Ga0070682_100127114 Ga0070682_1001271141 245
70 3300005338 Ga0068868_100012331 Ga0068868_1000123312 245
71 3300005339 Ga0070660_100008125 Ga0070660_1000081256 245
72 3300005339 Ga0070660_100303627 Ga0070660_1003036271 245
73 3300005340 Ga0070689_100000668 Ga0070689_1000006688 245
74 3300005340 Ga0070689_100018827 Ga0070689_1000188272 245
75 3300005341 Ga0070691_10011670 Ga0070691_100116703 245
76 3300005341 Ga0070691_10126822 Ga0070691_101268222 245
77 3300005343 Ga0070687_100000527 Ga0070687_1000005277 245
78 3300005343 Ga0070687_100096954 Ga0070687_1000969541 245
79 3300005344 Ga0070661_100003238 Ga0070661_1000032385 245
80 3300005345 Ga0070692_10001083 Ga0070692_100010837 245
81 3300005345 Ga0070692_10001570 Ga0070692_100015704 245
82 3300005345 Ga0070692_10014904 Ga0070692_100149044 245
83 3300005347 Ga0070668_100000055 Ga0070668_10000005549 245
84 3300005347 Ga0070668_100003117 Ga0070668_1000031178 245
85 3300005347 Ga0070668_100112166 Ga0070668_1001121662 245
86 3300005353 Ga0070669_100000044 Ga0070669_10000004456 245
87 3300005353 Ga0070669_100001315 Ga0070669_1000013158 245
88 3300005353 Ga0070669_100113249 Ga0070669_1001132492 245
89 3300005354 Ga0070675_100002954 Ga0070675_1000029547 245
90 3300005354 Ga0070675_100015172 Ga0070675_1000151722 245
91 3300005354 Ga0070675_100670546 Ga0070675_1006705461 245
92 3300005355 Ga0070671_100000894 Ga0070671_10000089414 245
93 3300005355 Ga0070671_100035414 Ga0070671_1000354144 245
94 3300005356 Ga0070674_100002968 Ga0070674_1000029683 245
95 3300005356 Ga0070674_100154060 Ga0070674_1001540601 245
96 3300005364 Ga0070673_100001477 Ga0070673_1000014778 245
97 3300005365 Ga0070688_100001239 Ga0070688_1000012398 245
98 3300005365 Ga0070688_100006198 Ga0070688_1000061981 245
99 3300005366 Ga0070659_100002622 Ga0070659_1000026228 245
100 3300005366 Ga0070659_100015463 Ga0070659_1000154631 245
101 3300005366 Ga0070659_100227739 Ga0070659_1002277392 245
102 3300005367 Ga0070667_100000122 Ga0070667_10000012237 245
103 3300005367 Ga0070667_100005188 Ga0070667_1000051885 245
104 3300005367 Ga0070667_100005584 Ga0070667_1000055843 245
105 3300005367 Ga0070667_100015151 Ga0070667_1000151516 245
106 3300005367 Ga0070667_100171642 Ga0070667_1001716422 245
107 3300005406 Ga0070703_10006319 Ga0070703_100063194 245
108 3300005434 Ga0070709_10005348 Ga0070709_100053484 245
109 3300005435 Ga0070714_100017351 Ga0070714_1000173512 245
110 3300005436 Ga0070713_100015040 Ga0070713_1000150402 245
111 3300005437 Ga0070710_10045002 Ga0070710_100450022 245
112 3300005438 Ga0070701_10002283 Ga0070701_100022833 245
113 3300005438 Ga0070701_10008389 Ga0070701_100083892 245
114 3300005439 Ga0070711_100011236 Ga0070711_1000112365 245
115 3300005440 Ga0070705_100001458 Ga0070705_1000014587 245
116 3300005441 Ga0070700_100001211 Ga0070700_1000012117 245
117 3300005444 Ga0070694_100001764 Ga0070694_1000017647 245
118 3300005444 Ga0070694_100155907 Ga0070694_1001559072 245
119 3300005455 Ga0070663_100000761 Ga0070663_1000007618 245
120 3300005456 Ga0070678_100000525 Ga0070678_10000052513 245
121 3300005457 Ga0070662_100002968 Ga0070662_1000029686 245
122 3300005457 Ga0070662_100050510 Ga0070662_1000505101 245
123 3300005458 Ga0070681_10004977 Ga0070681_100049778 245
124 3300005458 Ga0070681_10033528 Ga0070681_100335283 245
125 3300005459 Ga0068867_100002950 Ga0068867_1000029509 245
126 3300005466 Ga0070685_10003505 Ga0070685_100035051 245
127 3300005466 Ga0070685_10229619 Ga0070685_102296191 245
128 3300005467 Ga0070706_100557410 Ga0070706_1005574101 245
129 3300005518 Ga0070699_100145636 Ga0070699_1001456362 245
130 3300005530 Ga0070679_100015045 Ga0070679_1000150457 245
131 3300005530 Ga0070679_100157125 Ga0070679_1001571253 245
132 3300005535 Ga0070684_100005941 Ga0070684_1000059413 245
133 3300005539 Ga0068853_100003070 Ga0068853_1000030707 245
134 3300005539 Ga0068853_100050832 Ga0068853_1000508322 245
135 3300005543 Ga0070672_100002960 Ga0070672_1000029605 245
136 3300005543 Ga0070672_100464894 Ga0070672_1004648941 245
137 3300005544 Ga0070686_100001573 Ga0070686_1000015737 245
138 3300005544 Ga0070686_100008797 Ga0070686_1000087977 245
139 3300005545 Ga0070695_100002369 Ga0070695_1000023698 245
140 3300005545 Ga0070695_100091328 Ga0070695_1000913282 245
141 3300005546 Ga0070696_100028599 Ga0070696_1000285994 245
142 3300005547 Ga0070693_100000880 Ga0070693_1000008807 245
143 3300005547 Ga0070693_100282566 Ga0070693_1002825661 245
144 3300005548 Ga0070665_100025279 Ga0070665_1000252792 245
145 3300005549 Ga0070704_100001917 Ga0070704_1000019176 245
146 3300005563 Ga0068855_100009051 Ga0068855_1000090514 245
147 3300005563 Ga0068855_100111759 Ga0068855_1001117593 245
148 3300005564 Ga0070664_100002934 Ga0070664_1000029348 245
149 3300005564 Ga0070664_100379526 Ga0070664_1003795261 245
150 3300005577 Ga0068857_100000358 Ga0068857_1000003588 245
151 3300005577 Ga0068857_100015287 Ga0068857_1000152878 245
152 3300005577 Ga0068857_100086207 Ga0068857_1000862072 245
153 3300005577 Ga0068857_100163221 Ga0068857_1001632212 245
154 3300005578 Ga0068854_100003080 Ga0068854_1000030803 245
155 3300005614 Ga0068856_100065216 Ga0068856_1000652163 245
156 3300005614 Ga0068856_100069199 Ga0068856_1000691993 245
157 3300005615 Ga0070702_100000526 Ga0070702_1000005268 245
158 3300005616 Ga0068852_101152709 Ga0068852_1011527091 245
159 3300005617 Ga0068859_100005591 Ga0068859_1000055917 245
160 3300005617 Ga0068859_100014466 Ga0068859_1000144663 245
161 3300005617 Ga0068859_100018845 Ga0068859_1000188455 245
162 3300005617 Ga0068859_100065369 Ga0068859_1000653694 245
163 3300005617 Ga0068859_100488010 Ga0068859_1004880102 245
164 3300005618 Ga0068864_100000004 Ga0068864_100000004224 245
165 3300005618 Ga0068864_100000158 Ga0068864_10000015868 245
166 3300005618 Ga0068864_100001988 Ga0068864_10000198810 245
167 3300005719 Ga0068861_100001805 Ga0068861_1000018058 245
168 3300005719 Ga0068861_100011624 Ga0068861_1000116241 245
169 3300005719 Ga0068861_100040005 Ga0068861_1000400053 245
170 3300005719 Ga0068861_100041488 Ga0068861_1000414882 245
171 3300005840 Ga0068870_10000025 Ga0068870_1000002521 245
172 3300005841 Ga0068863_100000002 Ga0068863_100000002225 245
173 3300005841 Ga0068863_100000030 Ga0068863_10000003029 245
174 3300005841 Ga0068863_100002964 Ga0068863_1000029647 245
175 3300005841 Ga0068863_100057811 Ga0068863_1000578113 245
176 3300005842 Ga0068858_100003227 Ga0068858_1000032278 245
177 3300005843 Ga0068860_100000152 Ga0068860_10000015277 245
178 3300005843 Ga0068860_100007120 Ga0068860_1000071208 245
179 3300005843 Ga0068860_100055285 Ga0068860_1000552853 245
180 3300005844 Ga0068862_100000001 Ga0068862_100000001480 245
181 3300005844 Ga0068862_100000002 Ga0068862_100000002277 245
182 3300005844 Ga0068862_100032289 Ga0068862_1000322892 245
183 3300005937 Ga0081455_10000276 Ga0081455_1000027659 245
184 3300005937 Ga0081455_10000545 Ga0081455_1000054513 245
185 3300005981 Ga0081538_10086861 Ga0081538_100868612 245
186 3300005983 Ga0081540_1004944 Ga0081540_10049449 245
187 3300006038 Ga0075365_10047707 Ga0075365_100477073 245
188 3300006058 Ga0075432_10011268 Ga0075432_100112684 245
189 3300006058 Ga0075432_10085603 Ga0075432_100856032 245
190 3300006163 Ga0070715_10000196 Ga0070715_100001969 245
191 3300006178 Ga0075367_10208140 Ga0075367_102081402 245
192 3300006237 Ga0097621_100000456 Ga0097621_10000045615 245
193 3300006353 Ga0075370_10060370 Ga0075370_100603702 245
194 3300006358 Ga0068871_100000269 Ga0068871_1000002692 245
195 3300006844 Ga0075428_100136861 Ga0075428_1001368613 245
196 3300006846 Ga0075430_100243354 Ga0075430_1002433542 245
197 3300006847 Ga0075431_100030106 Ga0075431_1000301064 245
198 3300006852 Ga0075433_10021666 Ga0075433_100216665 245
199 3300006871 Ga0075434_100011399 Ga0075434_1000113998 245
200 3300006881 Ga0068865_100001731 Ga0068865_1000017318 245
201 3300006881 Ga0068865_100055301 Ga0068865_1000553014 245
202 3300006914 Ga0075436_100444135 Ga0075436_1004441352 245
203 3300006931 Ga0097620_100005590 Ga0097620_1000055908 245
204 3300006931 Ga0097620_100014466 Ga0097620_1000144663 245
205 3300006931 Ga0097620_100018845 Ga0097620_1000188455 245
206 3300006931 Ga0097620_100065370 Ga0097620_1000653702 245
207 3300006931 Ga0097620_100488013 Ga0097620_1004880132 245
208 3300007076 Ga0075435_100139121 Ga0075435_1001391212 245
209 3300009011 Ga0105251_10022538 Ga0105251_100225383 245
210 3300009092 Ga0105250_10025819 Ga0105250_100258192 245
211 3300009094 Ga0111539_10003217 Ga0111539_100032179 245
212 3300009094 Ga0111539_10007321 Ga0111539_100073218 245
213 3300009098 Ga0105245_10000183 Ga0105245_1000018340 245
214 3300009101 Ga0105247_10009563 Ga0105247_100095633 245
215 3300009101 Ga0105247_10076689 Ga0105247_100766893 245
216 3300009101 Ga0105247_10566023 Ga0105247_105660231 245
217 3300009147 Ga0114129_10020394 Ga0114129_100203944 245
218 3300009148 Ga0105243_10001561 Ga0105243_100015617 245
219 3300009148 Ga0105243_10064823 Ga0105243_100648232 245
220 3300009148 Ga0105243_10581004 Ga0105243_105810042 245
221 3300009174 Ga0105241_10003567 Ga0105241_100035676 245
222 3300009176 Ga0105242_10000701 Ga0105242_100007017 245
223 3300009177 Ga0105248_10000010 Ga0105248_10000010120 245
224 3300009177 Ga0105248_10000287 Ga0105248_100002879 245
225 3300009177 Ga0105248_10010394 Ga0105248_100103946 245
226 3300009177 Ga0105248_10048525 Ga0105248_100485253 245
227 3300009545 Ga0105237_10072251 Ga0105237_100722512 245
228 3300009545 Ga0105237_10248367 Ga0105237_102483672 245
229 3300009551 Ga0105238_10404069 Ga0105238_104040692 245
230 3300009553 Ga0105249_10000041 Ga0105249_10000041192 245
231 3300009553 Ga0105249_10007674 Ga0105249_100076742 245
232 3300009553 Ga0105249_10009795 Ga0105249_100097952 245
233 3300009553 Ga0105249_10037419 Ga0105249_100374195 245
234 3300009553 Ga0105249_10157328 Ga0105249_101573282 245
235 3300009553 Ga0105249_10499013 Ga0105249_104990132 245
236 3300010375 Ga0105239_10170015 Ga0105239_101700152 245
237 3300011119 Ga0105246_10002447 Ga0105246_100024475 245
238 3300012483 Ga0157337_1000504 Ga0157337_10005042 245
239 3300012507 Ga0157342_1001861 Ga0157342_10018612 245
240 3300012513 Ga0157326_1000433 Ga0157326_10004333 245
241 3300013102 Ga0157371_10018807 Ga0157371_100188074 245
242 3300013105 Ga0157369_10631810 Ga0157369_106318102 245
243 3300013296 Ga0157374_10000463 Ga0157374_1000046311 245
244 3300013297 Ga0157378_10000613 Ga0157378_100006137 245
245 3300013297 Ga0157378_10078681 Ga0157378_100786814 245
246 3300013306 Ga0163162_10020966 Ga0163162_100209664 245
247 3300013306 Ga0163162_10514426 Ga0163162_105144262 245
248 3300013307 Ga0157372_10010921 Ga0157372_100109215 245
249 3300013307 Ga0157372_10458495 Ga0157372_104584952 245
250 3300013308 Ga0157375_10004786 Ga0157375_100047866 245
251 3300013308 Ga0157375_10639127 Ga0157375_106391271 245
252 3300014325 Ga0163163_10201970 Ga0163163_102019702 245
253 3300014326 Ga0157380_10004641 Ga0157380_100046416 245
254 3300014326 Ga0157380_10164250 Ga0157380_101642502 245
255 3300014497 Ga0182008_10151350 Ga0182008_101513502 245
256 3300014968 Ga0157379_10003902 Ga0157379_100039027 245
257 3300014968 Ga0157379_10146649 Ga0157379_101466493 245
258 3300014969 Ga0157376_10003730 Ga0157376_100037306 245
259 3300020082 Ga0206353_11997182 Ga0206353_1199718214 245
260 3300021388 Ga0213875_10004900 Ga0213875_100049002 245
261 3300025271 Ga0207666_1000140 Ga0207666_10001407 245
262 3300025284 Ga0209130_1000749 Ga0209130_100074928 245
263 3300025290 Ga0207673_1000039 Ga0207673_10000393 245
264 3300025294 Ga0209025_1000847 Ga0209025_10008474 245
265 3300025297 Ga0209758_1002804 Ga0209758_100280415 245
266 3300025302 Ga0207426_1000616 Ga0207426_100061612 245
267 3300025315 Ga0207697_10000763 Ga0207697_1000076316 245
268 3300025711 Ga0207696_1022621 Ga0207696_10226211 245
269 3300025735 Ga0207713_1019929 Ga0207713_10199293 245
270 3300025885 Ga0207653_10001778 Ga0207653_100017787 245
271 3300025898 Ga0207692_10056041 Ga0207692_100560412 245
272 3300025900 Ga0207710_10004068 Ga0207710_100040687 245
273 3300025901 Ga0207688_10001992 Ga0207688_100019928 245
274 3300025901 Ga0207688_10086237 Ga0207688_100862372 245
275 3300025903 Ga0207680_10028054 Ga0207680_100280544 245
276 3300025903 Ga0207680_10127284 Ga0207680_101272842 245
277 3300025903 Ga0207680_10135703 Ga0207680_101357032 245
278 3300025904 Ga0207647_10003504 Ga0207647_100035048 245
279 3300025905 Ga0207685_10106615 Ga0207685_101066152 245
280 3300025906 Ga0207699_10048618 Ga0207699_100486183 245
281 3300025907 Ga0207645_10000248 Ga0207645_100002486 245
282 3300025908 Ga0207643_10000064 Ga0207643_1000006459 245
283 3300025909 Ga0207705_10143274 Ga0207705_101432743 245
284 3300025911 Ga0207654_10001623 Ga0207654_100016236 245
285 3300025912 Ga0207707_10002084 Ga0207707_100020843 245
286 3300025912 Ga0207707_10523957 Ga0207707_105239572 245
287 3300025914 Ga0207671_10007347 Ga0207671_100073478 245
288 3300025914 Ga0207671_10016982 Ga0207671_100169827 245
289 3300025915 Ga0207693_10031950 Ga0207693_100319504 245
290 3300025917 Ga0207660_10000194 Ga0207660_1000019434 245
291 3300025918 Ga0207662_10001637 Ga0207662_100016378 245
292 3300025918 Ga0207662_10062873 Ga0207662_100628733 245
293 3300025919 Ga0207657_10006919 Ga0207657_100069198 245
294 3300025919 Ga0207657_10424603 Ga0207657_104246031 245
295 3300025920 Ga0207649_10000234 Ga0207649_1000023411 245
296 3300025920 Ga0207649_10072825 Ga0207649_100728253 245
297 3300025921 Ga0207652_10001613 Ga0207652_1000161317 245
298 3300025923 Ga0207681_10000041 Ga0207681_1000004175 245
299 3300025923 Ga0207681_10000794 Ga0207681_100007947 245
300 3300025923 Ga0207681_10061762 Ga0207681_100617622 245
301 3300025925 Ga0207650_10000004 Ga0207650_10000004121 245
302 3300025925 Ga0207650_10000298 Ga0207650_1000029812 245
303 3300025925 Ga0207650_10010580 Ga0207650_100105806 245
304 3300025926 Ga0207659_10000172 Ga0207659_1000017211 245
305 3300025926 Ga0207659_10396630 Ga0207659_103966302 245
306 3300025927 Ga0207687_10008699 Ga0207687_100086994 245
307 3300025928 Ga0207700_10006617 Ga0207700_100066175 245
308 3300025929 Ga0207664_10078623 Ga0207664_100786232 245
309 3300025931 Ga0207644_10000169 Ga0207644_1000016936 245
310 3300025931 Ga0207644_10000439 Ga0207644_100004398 245
311 3300025932 Ga0207690_10000796 Ga0207690_100007967 245
312 3300025932 Ga0207690_10056673 Ga0207690_100566733 245
313 3300025933 Ga0207706_10005059 Ga0207706_100050596 245
314 3300025934 Ga0207686_10001093 Ga0207686_100010936 245
315 3300025935 Ga0207709_10001438 Ga0207709_100014387 245
316 3300025935 Ga0207709_10012223 Ga0207709_100122235 245
317 3300025936 Ga0207670_10000807 Ga0207670_1000080713 245
318 3300025936 Ga0207670_10131498 Ga0207670_101314981 245
319 3300025937 Ga0207669_10000141 Ga0207669_1000014130 245
320 3300025937 Ga0207669_10303083 Ga0207669_103030831 245
321 3300025938 Ga0207704_10000755 Ga0207704_1000075512 245
322 3300025939 Ga0207665_10002433 Ga0207665_100024338 245
323 3300025940 Ga0207691_10006997 Ga0207691_100069978 245
324 3300025940 Ga0207691_10210058 Ga0207691_102100582 245
325 3300025941 Ga0207711_10000038 Ga0207711_10000038119 245
326 3300025941 Ga0207711_10000658 Ga0207711_1000065826 245
327 3300025941 Ga0207711_10006747 Ga0207711_100067476 245
328 3300025941 Ga0207711_10035665 Ga0207711_100356652 245
329 3300025942 Ga0207689_10456732 Ga0207689_104567322 245
330 3300025944 Ga0207661_10000098 Ga0207661_1000009813 245
331 3300025944 Ga0207661_10138465 Ga0207661_101384652 245
332 3300025945 Ga0207679_10000174 Ga0207679_1000017414 245
333 3300025945 Ga0207679_10097786 Ga0207679_100977862 245
334 3300025945 Ga0207679_10680521 Ga0207679_106805211 245
335 3300025949 Ga0207667_10004743 Ga0207667_100047433 245
336 3300025949 Ga0207667_10207178 Ga0207667_102071783 245
337 3300025960 Ga0207651_10000782 Ga0207651_100007828 245
338 3300025961 Ga0207712_10000659 Ga0207712_100006598 245
339 3300025961 Ga0207712_10005928 Ga0207712_100059286 245
340 3300025972 Ga0207668_10001107 Ga0207668_100011076 245
341 3300025972 Ga0207668_10002109 Ga0207668_100021093 245
342 3300025972 Ga0207668_10012828 Ga0207668_100128282 245
343 3300025981 Ga0207640_10000846 Ga0207640_100008466 245
344 3300025981 Ga0207640_10035208 Ga0207640_100352082 245
345 3300025986 Ga0207658_10000092 Ga0207658_1000009266 245
346 3300025986 Ga0207658_10000474 Ga0207658_100004745 245
347 3300025986 Ga0207658_10001843 Ga0207658_1000184314 245
348 3300025986 Ga0207658_10003847 Ga0207658_100038473 245
349 3300025986 Ga0207658_10199433 Ga0207658_101994332 245
350 3300026023 Ga0207677_10144090 Ga0207677_101440902 245
351 3300026035 Ga0207703_10002433 Ga0207703_100024338 245
352 3300026041 Ga0207639_10017221 Ga0207639_100172215 245
353 3300026041 Ga0207639_10361416 Ga0207639_103614161 245
354 3300026067 Ga0207678_10001059 Ga0207678_100010598 245
355 3300026075 Ga0207708_10002793 Ga0207708_100027938 245
356 3300026078 Ga0207702_10014464 Ga0207702_100144645 245
357 3300026078 Ga0207702_10067037 Ga0207702_100670373 245
358 3300026088 Ga0207641_10000001 Ga0207641_10000001254 245
359 3300026088 Ga0207641_10000002 Ga0207641_10000002705 245
360 3300026088 Ga0207641_10000622 Ga0207641_1000062211 245
361 3300026088 Ga0207641_10009974 Ga0207641_100099742 245
362 3300026088 Ga0207641_10135165 Ga0207641_101351652 245
363 3300026089 Ga0207648_10009300 Ga0207648_100093008 245
364 3300026095 Ga0207676_10000005 Ga0207676_10000005102 245
365 3300026095 Ga0207676_10000006 Ga0207676_10000006589 245
366 3300026095 Ga0207676_10002696 Ga0207676_100026969 245
367 3300026116 Ga0207674_10001342 Ga0207674_100013428 245
368 3300026116 Ga0207674_10021817 Ga0207674_100218173 245
369 3300026116 Ga0207674_10036947 Ga0207674_100369475 245
370 3300026116 Ga0207674_10175278 Ga0207674_101752783 245
371 3300026118 Ga0207675_100000309 Ga0207675_10000030953 245
372 3300026118 Ga0207675_100006706 Ga0207675_1000067065 245
373 3300026118 Ga0207675_100011711 Ga0207675_1000117112 245
374 3300026118 Ga0207675_100489763 Ga0207675_1004897632 245
375 3300026121 Ga0207683_10001193 Ga0207683_1000119318 245
376 3300027252 Ga0209973_1003691 Ga0209973_10036912 245
377 3300027552 Ga0209982_1015579 Ga0209982_10155792 245
378 3300027682 Ga0209971_1015247 Ga0209971_10152472 245
379 3300027695 Ga0209966_1001072 Ga0209966_10010725 245
380 3300027695 Ga0209966_1002975 Ga0209966_10029753 245
381 3300027717 Ga0209998_10001333 Ga0209998_100013335 245
382 3300027717 Ga0209998_10001362 Ga0209998_100013625 245
383 3300027876 Ga0209974_10014808 Ga0209974_100148082 245
384 3300027876 Ga0209974_10020958 Ga0209974_100209582 245
385 3300027907 Ga0207428_10000513 Ga0207428_1000051340 245
386 3300027907 Ga0207428_10000626 Ga0207428_1000062625 245
387 3300028379 Ga0268266_10305765 Ga0268266_103057652 245
388 3300028380 Ga0268265_10000001 Ga0268265_10000001556 245
389 3300028380 Ga0268265_10000003 Ga0268265_10000003284 245
390 3300028380 Ga0268265_10002370 Ga0268265_1000237012 245
391 3300028380 Ga0268265_10014719 Ga0268265_100147192 245
392 3300028381 Ga0268264_10000111 Ga0268264_1000011162 245
393 3300028381 Ga0268264_10004444 Ga0268264_100044448 245
394 3300028381 Ga0268264_10276778 Ga0268264_102767782 245
395 3300031731 Ga0307405_10542773 Ga0307405_105427732 245
396 3300031901 Ga0307406_10018812 Ga0307406_100188123 245
397 3300031901 Ga0307406_10145223 Ga0307406_101452232 245
398 3300031911 Ga0307412_10001980 Ga0307412_1000198013 245
399 3300031911 Ga0307412_10015841 Ga0307412_100158412 245
400 3300031911 Ga0307412_10043249 Ga0307412_100432493 245
401 3300032002 Ga0307416_100191670 Ga0307416_1001916702 245
402 3300032133 Ga0316583_10079080 Ga0316583_100790801 245
403 3300033180 Ga0307510_10119715 Ga0307510_101197152 245
404 3300034816 Ga0373930_0004579 Ga0373930_0004579_516_1253 245
405 3300034817 Ga0373948_0000049 Ga0373948_0000049_8717_9454 245
406 3300034817 Ga0373948_0010541 Ga0373948_0010541_752_1489 245
407 3300034818 Ga0373950_0000665 Ga0373950_0000665_195_932 245
408 3300034819 Ga0373958_0000026 Ga0373958_0000026_14662_15399 245
409 3300034819 Ga0373958_0000135 Ga0373958_0000135_4092_4829 245
410 3300034820 Ga0373959_0001171 Ga0373959_0001171_3312_4049 245
411 3300034820 Ga0373959_0002832 Ga0373959_0002832_895_1632 245
412 3300034957 Ga0373938_0000133 Ga0373938_0000133_8248_8985 245
413 3300035084 Ga0373928_0007183 Ga0373928_0007183_718_1455 245
414 3300035085 Ga0373929_0000110 Ga0373929_0000110_12655_13392 245
415 3300035085 Ga0373929_0004350 Ga0373929_0004350_667_1404 245
416 3300035088 Ga0373940_0002247 Ga0373940_0002247_297_1034 245
417 3300035088 Ga0373940_0006899 Ga0373940_0006899_314_1051 245
418 3300035090 Ga0373949_0000771 Ga0373949_0000771_8029_8766 245
419 3300035090 Ga0373949_0001010 Ga0373949_0001010_930_1667 245
420 3300035091 Ga0373951_0003615 Ga0373951_0003615_2372_3109 245
421 3300035092 Ga0373952_0000200 Ga0373952_0000200_7029_7766 245
422 3300035112 Ga0373932_0000822 Ga0373932_0000822_4953_5690 245
423 3300035112 Ga0373932_0001180 Ga0373932_0001180_3321_4058 245
424 3300035114 Ga0373939_0003897 Ga0373939_0003897_1232_1969 245
425 3300035115 Ga0373941_0000259 Ga0373941_0000259_5062_5799 245
426 3300035121 Ga0373960_0000277 Ga0373960_0000277_3793_4530 245
427 3300035121 Ga0373960_0001175 Ga0373960_0001175_212_949 245
428 3300035207 Ga0373942_0029123 Ga0373942_0029123_252_989 245
429 3300035241 Ga0373961_0001383 Ga0373961_0001383_1710_2447 245
430 3300035241 Ga0373961_0001598 Ga0373961_0001598_681_1418 245
431 3300035242 Ga0373962_0000275 Ga0373962_0000275_7014_7751 245
432 3300035691 Ga0373931_0002417 Ga0373931_0002417_7029_7766 245
433 3300035691 Ga0373931_0007842 Ga0373931_0007842_3287_4024 245
434 3300035691 Ga0373931_0032643 Ga0373931_0032643_24_764 245
435 3300035695 Ga0373927_0197669 Ga0373927_0197669_125_868 245
436 3300035724 Ga0373933_0130460 Ga0373933_0130460_184_921 245
437 3300036647 Ga0316582_0108359 Ga0316582_0108359_921_1658 245
438 3300037312 Ga0395899_0218369 Ga0395899_0218369_473_1261 245
439 3300037418 Ga0395900_0002906 Ga0395900_0002906_13038_13826 245
440 3300037466 Ga0395898_0125357 Ga0395898_0125357_1420_2208 245
441 3300037853 Ga0436364_1309894 Ga0436364_1309894_5251_5994 245
442 3300038443 Ga0395901_0006644 Ga0395901_0006644_8379_9167 245
443 3300038443 Ga0395901_0190413 Ga0395901_0190413_1322_2062 245
444 3300038996 Ga0242420_016335 Ga0242420_016335_34_771 245
445 3300041462 Ga0451806_525822 Ga0451806_525822_112_870 245
446 3300042016 Ga0439463_026003 Ga0439463_026003_199_936 245
447 3300042146 Ga0450907_005098 Ga0450907_005098_1044_1907 245
448 3300042437 Ga0439444_0022357 Ga0439444_0022357_166_903 245
449 3300042439 Ga0439464_0011060 Ga0439464_0011060_446_1183 245
450 3300044659 Ga0466973_0110359 Ga0466973_0110359_724_1488 245
451 3300045051 Ga0451576_0013587 Ga0451576_0013587_8214_8951 245
452 3300046525 Ga0495663_0035443 Ga0495663_0035443_132_896 245
453 3300046530 Ga0495654_0008624 Ga0495654_0008624_4617_5381 245
454 3300046530 Ga0495654_0034158 Ga0495654_0034158_998_1762 245
455 3300046542 Ga0495597_0010903 Ga0495597_0010903_2381_3124 245
456 3300046558 Ga0495633_0187535 Ga0495633_0187535_11_754 245
457 3300046616 Ga0495668_0012118 Ga0495668_0012118_1151_1915 245
458 3300046616 Ga0495668_0029780 Ga0495668_0029780_542_1285 245
459 3300046684 Ga0495669_0194113 Ga0495669_0194113_211_948 245
460 3300047445 Ga0495677_0021568 Ga0495677_0021568_729_1466 245
461 3300047472 Ga0495686_0017645 Ga0495686_0017645_2802_3539 245
462 3300047472 Ga0495686_0022875 Ga0495686_0022875_780_1517 245
463 3300047472 Ga0495686_0118679 Ga0495686_0118679_80_817 245
464 3300048903 Ga0496100_0000447 Ga0496100_0000447_15437_16174 245
465 3300048904 Ga0496101_0001349 Ga0496101_0001349_11638_12375 245
466 3300048904 Ga0496101_0557092 Ga0496101_0557092_106_876 245
467 3300048905 Ga0496102_0002263 Ga0496102_0002263_5884_6627 245
468 3300048905 Ga0496102_0002354 Ga0496102_0002354_11638_12375 245
469 3300048905 Ga0496102_0344120 Ga0496102_0344120_494_1231 245
470 3300048906 Ga0496103_0000837 Ga0496103_0000837_17467_18204 245
471 3300048906 Ga0496103_0001362 Ga0496103_0001362_5868_6611 245
472 3300048909 Ga0496106_0001351 Ga0496106_0001351_6249_6986 245
473 3300048909 Ga0496106_0150742 Ga0496106_0150742_555_1295 245
474 3300048910 Ga0496107_0001211 Ga0496107_0001211_4250_4987 245
475 3300048910 Ga0496107_0154644 Ga0496107_0154644_625_1365 245
476 3300048910 Ga0496107_0246573 Ga0496107_0246573_469_1206 245
477 3300048912 Ga0496109_0005044 Ga0496109_0005044_3877_4614 245
478 3300048913 Ga0496110_0030428 Ga0496110_0030428_3047_3784 245
479 3300048913 Ga0496110_0030903 Ga0496110_0030903_3741_4478 245
480 3300048914 Ga0496111_0060526 Ga0496111_0060526_400_1137 245
481 3300048916 Ga0496113_0192565 Ga0496113_0192565_669_1406 245
482 3300048917 Ga0496114_0001734 Ga0496114_0001734_11287_12024 245
483 3300048918 Ga0496115_0000592 Ga0496115_0000592_11175_11912 245
484 3300048919 Ga0496116_0003256 Ga0496116_0003256_5584_6327 245
485 3300048920 Ga0496117_0004043 Ga0496117_0004043_9863_10606 245
486 3300048920 Ga0496117_0004127 Ga0496117_0004127_10767_11537 245
487 3300048921 Ga0496118_0000463 Ga0496118_0000463_2596_3366 245
488 3300048921 Ga0496118_0004497 Ga0496118_0004497_9863_10606 245
489 3300048922 Ga0496119_0164339 Ga0496119_0164339_265_1008 245
490 3300048922 Ga0496119_0164696 Ga0496119_0164696_135_878 245
491 3300048923 Ga0496120_0131593 Ga0496120_0131593_202_945 245
492 3300048927 Ga0496124_0004389 Ga0496124_0004389_5884_6627 245
493 3300048927 Ga0496124_0072061 Ga0496124_0072061_418_1173 245
494 3300048929 Ga0496126_0110561 Ga0496126_0110561_1529_2272 245
495 3300049513 Ga0501290_000038 Ga0501290_000038_12690_13427 245
496 3300049515 Ga0501292_000038 Ga0501292_000038_26759_27496 245
497 3300049517 Ga0501294_000225 Ga0501294_000225_497_1234 245
498 3300049569 Ga0501032_0015359 Ga0501032_0015359_4334_5098 245
499 3300049571 Ga0501034_0097580 Ga0501034_0097580_352_1089 245
500 3300049574 Ga0501038_0020281 Ga0501038_0020281_1696_2433 245
501 3300049575 Ga0501039_0227957 Ga0501039_0227957_420_1157 245
502 3300049577 Ga0501041_0231945 Ga0501041_0231945_144_884 245
503 3300049579 Ga0501043_0010164 Ga0501043_0010164_5101_5865 245
504 3300049579 Ga0501043_0150354 Ga0501043_0150354_308_1045 245
505 3300049581 Ga0501047_0000876 Ga0501047_0000876_11487_12251 245
506 3300049584 Ga0501068_0219173 Ga0501068_0219173_404_1141 245
507 3300049586 Ga0501070_0264359 Ga0501070_0264359_175_939 245
508 3300049588 Ga0501072_0392571 Ga0501072_0392571_20_757 245
509 3300049591 Ga0501075_0233841 Ga0501075_0233841_178_918 245
510 3300049591 Ga0501075_0317299 Ga0501075_0317299_364_1104 245
511 3300049592 Ga0501076_0098870 Ga0501076_0098870_431_1171 245
512 3300049593 Ga0501077_0033324 Ga0501077_0033324_1268_2005 245
513 3300049593 Ga0501077_0185458 Ga0501077_0185458_358_1098 245
514 3300049652 Ga0501202_031880 Ga0501202_031880_103_840 245
515 3300049653 Ga0501206_001289 Ga0501206_001289_1685_2422 245
516 3300049663 Ga0501223_002886 Ga0501223_002886_481_1218 245
517 3300049664 Ga0501224_003519 Ga0501224_003519_928_1665 245
518 3300049669 Ga0501235_009139 Ga0501235_009139_1338_2075 245
519 3300049679 Ga0501249_000464 Ga0501249_000464_8501_9259 245
520 3300049688 Ga0501259_004554 Ga0501259_004554_588_1325 245
521 3300049690 Ga0501261_000037 Ga0501261_000037_1422_2159 245
522 3300049741 Ga0501079_0102332 Ga0501079_0102332_282_1022 245
523 3300049742 Ga0501080_0068719 Ga0501080_0068719_1881_2618 245
524 3300049743 Ga0501081_0382498 Ga0501081_0382498_288_1025 245
525 3300049775 Ga0501279_000016 Ga0501279_000016_2732_3469 245
526 3300049776 Ga0501280_000059 Ga0501280_000059_26634_27371 245
527 3300049777 Ga0501281_00345 Ga0501281_00345_2728_3465 245
528 3300049778 Ga0501282_000110 Ga0501282_000110_6056_6793 245
529 3300049823 Ga0501044_0240007 Ga0501044_0240007_956_1693 245
530 3300049823 Ga0501044_0384362 Ga0501044_0384362_129_893 245
531 3300049824 Ga0501045_0177761 Ga0501045_0177761_186_929 245
532 3300050494 nmdc:mga06z11_73418_c1 nmdc:mga06z11_73418_c1_727_1464 245
533 3300050508 nmdc:mga09592_281149_c1 nmdc:mga09592_281149_c1_582_1322 245
534 3300050509 nmdc:mga0qj67_286469_c1 nmdc:mga0qj67_286469_c1_111_851 245
535 3300050510 nmdc:mga06r32_114169_c1 nmdc:mga06r32_114169_c1_196_936 245
536 3300050511 nmdc:mga08y16_7407_c1 nmdc:mga08y16_7407_c1_3437_4174 245
537 3300050511 nmdc:mga08y16_8959_c1 nmdc:mga08y16_8959_c1_6237_6974 245
538 3300050512 nmdc:mga0n895_298486_c1 nmdc:mga0n895_298486_c1_497_1237 245
539 3300050512 nmdc:mga0n895_3698_c1 nmdc:mga0n895_3698_c1_4601_5338 245
540 3300050513 nmdc:mga0rr50_227667_c1 nmdc:mga0rr50_227667_c1_591_1331 245
541 3300050513 nmdc:mga0rr50_390810_c1 nmdc:mga0rr50_390810_c1_31_768 245
542 3300050513 nmdc:mga0rr50_401477_c1 nmdc:mga0rr50_401477_c1_315_1055 245
543 3300050515 nmdc:mga0a205_1633_c1 nmdc:mga0a205_1633_c1_15333_16070 245
544 3300050515 nmdc:mga0a205_94603_c1 nmdc:mga0a205_94603_c1_1615_2355 245
545 3300053085 Ga0495619_0195583 Ga0495619_0195583_645_1385 245
546 3300053087 Ga0500643_000115 Ga0500643_000115_59056_59796 245
547 3300053087 Ga0500643_000326 Ga0500643_000326_4773_5516 245
548 3300053087 Ga0500643_001868 Ga0500643_001868_9606_10349 245
549 3300053087 Ga0500643_083140 Ga0500643_083140_83_868 245
550 3300053091 Ga0500647_0032167 Ga0500647_0032167_1539_2282 245
551 3300053093 Ga0500651_0002180 Ga0500651_0002180_5704_6447 245
552 3300053116 Ga0500592_000019 Ga0500592_000019_1912_2649 245
553 3300053133 Ga0500655_000162 Ga0500655_000162_3351_4094 245
554 3300053142 Ga0500577_0027326 Ga0500577_0027326_777_1514 245
555 3300053148 Ga0500590_000967 Ga0500590_000967_2941_3684 245
556 3300053156 Ga0500622_0006224 Ga0500622_0006224_3120_3863 245
557 3300053158 Ga0500627_0000211 Ga0500627_0000211_11474_12238 245
558 3300053158 Ga0500627_0003527 Ga0500627_0003527_3009_3746 245
559 3300053158 Ga0500627_0036531 Ga0500627_0036531_990_1754 245
560 3300053158 Ga0500627_0052392 Ga0500627_0052392_918_1655 245
561 3300053724 Ga0500570_000414 Ga0500570_000414_14950_15693 245
562 3300054114 Ga0501084_0030992 Ga0501084_0030992_1502_2242 245
563 3300054114 Ga0501084_0120232 Ga0501084_0120232_167_907 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

144

246

0.98

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

6

105

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9682 2 245
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9613 2 245
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9566 2 245
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9308 2 245
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.9237 1 245
ID Description Score Start End Superfamily
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9642 2 106 3.30.70.580
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9608 109 242 3.30.70.660
2nreA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9574 108 244 3.30.70.660
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9548 3 105 3.30.70.580
af_A0A0R0F7R0_40_148_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9506 1 106 3.30.70.580
ID Description Score Start End GO Terms
AF-A0A7T9B1G9-F1-model_v4 deleted 0.9915 1 245
AF-A0A2S5LLN7-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9914 87 245 GO:0003723
GO:0031119
GO:0160147
AF-Q6G1G9-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9913 1 245 GO:0003723
GO:0031119
GO:0160147
AF-A0A3D3SK42-F1-model_v4 deleted 0.9911 35 245
AF-A0A1I7NPD3-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9909 1 245 GO:0003723
GO:0031119
GO:0160147

Feature Viewer

pLDDT pTM Quality
95.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map