F464060
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 563 | 353 | 558 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300025942|Ga0207689_10456732|Ga0207689_104567322 |
| Length | 298 |
| Sequence | MPRYKLTVEYDGRPFAGWQIQVNQLTVQGLLTSAIEALSGDKTLVQGAGRTDAGVHARGQVAHFDITSEKRPEEVRGALNFHLKPNPIAVPAVALAPPGFHARFSATARRYRYRILNRRSRPGIGAGLVWHVPVPLDERAMADAASVLVGTHDFNSFRSGSCQSKTSTKTLDVLSVHRDGEEIAIEVGARSFLHNQVRILVGTLQLVGRGQWRKADVEEALAARDRTRAGPTAPPVGLCLMEVVYGSDRVADLEESIDERWDRDASEAGRIEQQLGHALVAAMRDRAFHEIHPFDERT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 5 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 6 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 7 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 9 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 11 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 12 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 13 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 14 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 20 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 25 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 26 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 135 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 136 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 151 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 237 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 241 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 256 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 258 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 264 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 265 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 266 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 267 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 268 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 269 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 293 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 294 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 295 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 296 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 297 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 301 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 302 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 317 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 318 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 322 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 323 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 328 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 329 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 330 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 343 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 344 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 345 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 347 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 348 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 350 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 351 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.8 |
| Nodule | 0 |
| Rhizoplane | 3.73 |
| Rhizosphere | 87.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544925 | 2209111006 | Bacteria | 18798 |
| 2 | ARcpr5oldR_c000010 | 3300000041 | Bacteria | 39074 |
| 3 | ARSoilYngRDRAFT_c00060 | 3300000042 | Bacteria | 17969 |
| 4 | ARcpr5yngRDRAFT_c000016 | 3300000043 | Bacteria | 29226 |
| 5 | ARSoilOldRDRAFT_c000011 | 3300000044 | Bacteria | 42914 |
| 6 | ARCol0oldRDRAFT_c00012 | 3300000045 | Bacteria | 14081 |
| 7 | ARCol0yngRDRAFT_1000018 | 3300000652 | Bacteria | 30924 |
| 8 | JGI24032J14994_100108 | 3300001430 | Bacteria | 3758 |
| 9 | JGI24752J21851_1001641 | 3300001976 | Bacteria | 3001 |
| 10 | JGI24746J21847_1000298 | 3300001977 | Bacteria | 7092 |
| 11 | JGI24747J21853_1000086 | 3300001978 | Bacteria | 4031 |
| 12 | JGI24739J22299_10000724 | 3300001989 | Bacteria | 11949 |
| 13 | JGI24737J22298_10001113 | 3300001990 | Bacteria | 9446 |
| 14 | JGI24737J22298_10006046 | 3300001990 | Bacteria | 4152 |
| 15 | JGI24737J22298_10027610 | 3300001990 | Bacteria | 1789 |
| 16 | JGI24743J22301_10003623 | 3300001991 | Bacteria | 2458 |
| 17 | JGI24745J21846_1000147 | 3300002073 | Bacteria | 5541 |
| 18 | JGI24738J21930_10000997 | 3300002075 | Bacteria | 8121 |
| 19 | JGI24749J21850_1000462 | 3300002076 | Bacteria | 5997 |
| 20 | JGI24749J21850_1001104 | 3300002076 | Bacteria | 3832 |
| 21 | JGI24744J21845_10000153 | 3300002077 | Bacteria | 10102 |
| 22 | JGI24035J26624_1000923 | 3300002126 | Bacteria | 2781 |
| 23 | JGI24034J26672_10000533 | 3300002239 | Bacteria | 4876 |
| 24 | JGI24742J22300_10000137 | 3300002244 | Bacteria | 10780 |
| 25 | JGI24751J29686_10000081 | 3300002459 | Bacteria | 53804 |
| 26 | JGI24751J29686_10006955 | 3300002459 | Bacteria | 2308 |
| 27 | JGI25151J46595_10000199 | 3300003187 | Bacteria | 73941 |
| 28 | JGI25160J50197_1001785 | 3300003354 | Bacteria | 10415 |
| 29 | Ga0065704_10106197 | 3300005289 | Bacteria | 2090 |
| 30 | Ga0065712_10011139 | 3300005290 | Bacteria | 4292 |
| 31 | Ga0065712_10120505 | 3300005290 | Bacteria | 1673 |
| 32 | Ga0065707_10096262 | 3300005295 | Bacteria | 3287 |
| 33 | Ga0065707_10113486 | 3300005295 | Bacteria | 2326 |
| 34 | Ga0070676_10000506 | 3300005328 | Bacteria | 18658 |
| 35 | Ga0070676_10035991 | 3300005328 | Bacteria | 2850 |
| 36 | Ga0070683_100009453 | 3300005329 | Bacteria | 8336 |
| 37 | Ga0070683_100185374 | 3300005329 | Bacteria | 1975 |
| 38 | Ga0070690_100002629 | 3300005330 | Bacteria | 9678 |
| 39 | Ga0070690_100005686 | 3300005330 | Bacteria | 7019 |
| 40 | Ga0070690_100168761 | 3300005330 | Bacteria | 1505 |
| 41 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 42 | Ga0070670_100000021 | 3300005331 | Bacteria | 202776 |
| 43 | Ga0070670_100004573 | 3300005331 | Bacteria | 11607 |
| 44 | Ga0068869_100001832 | 3300005334 | Bacteria | 12767 |
| 45 | Ga0070666_10025905 | 3300005335 | Bacteria | 3826 |
| 46 | Ga0070666_10145779 | 3300005335 | Bacteria | 1650 |
| 47 | Ga0070680_100003424 | 3300005336 | Bacteria | 11842 |
| 48 | Ga0070680_100192361 | 3300005336 | Bacteria | 1719 |
| 49 | Ga0070682_100001699 | 3300005337 | Bacteria | 12232 |
| 50 | Ga0070682_100127114 | 3300005337 | Bacteria | 1720 |
| 51 | Ga0068868_100012331 | 3300005338 | Bacteria | 6246 |
| 52 | Ga0070660_100008125 | 3300005339 | Bacteria | 7333 |
| 53 | Ga0070660_100303627 | 3300005339 | Bacteria | 1309 |
| 54 | Ga0070689_100000668 | 3300005340 | Bacteria | 20748 |
| 55 | Ga0070689_100018827 | 3300005340 | Bacteria | 5096 |
| 56 | Ga0070691_10011670 | 3300005341 | Bacteria | 4017 |
| 57 | Ga0070691_10126822 | 3300005341 | Bacteria | 1289 |
| 58 | Ga0070687_100000527 | 3300005343 | Bacteria | 12848 |
| 59 | Ga0070687_100096954 | 3300005343 | Bacteria | 1643 |
| 60 | Ga0070661_100003238 | 3300005344 | Bacteria | 11222 |
| 61 | Ga0070692_10001083 | 3300005345 | Bacteria | 9454 |
| 62 | Ga0070692_10001570 | 3300005345 | Bacteria | 8386 |
| 63 | Ga0070692_10014904 | 3300005345 | Bacteria | 3663 |
| 64 | Ga0070668_100000055 | 3300005347 | Bacteria | 70835 |
| 65 | Ga0070668_100003117 | 3300005347 | Bacteria | 12247 |
| 66 | Ga0070668_100112166 | 3300005347 | Bacteria | 2171 |
| 67 | Ga0070669_100000044 | 3300005353 | Bacteria | 121087 |
| 68 | Ga0070669_100001315 | 3300005353 | Bacteria | 17944 |
| 69 | Ga0070669_100113249 | 3300005353 | Bacteria | 2061 |
| 70 | Ga0070675_100002954 | 3300005354 | Bacteria | 12826 |
| 71 | Ga0070675_100015172 | 3300005354 | Bacteria | 6084 |
| 72 | Ga0070675_100670546 | 3300005354 | Bacteria | 943 |
| 73 | Ga0070671_100000894 | 3300005355 | Bacteria | 21729 |
| 74 | Ga0070671_100035414 | 3300005355 | Bacteria | 4136 |
| 75 | Ga0070674_100002968 | 3300005356 | Bacteria | 9419 |
| 76 | Ga0070674_100154060 | 3300005356 | Bacteria | 1737 |
| 77 | Ga0070673_100001477 | 3300005364 | Bacteria | 13763 |
| 78 | Ga0070688_100001239 | 3300005365 | Bacteria | 12735 |
| 79 | Ga0070688_100006198 | 3300005365 | Bacteria | 6369 |
| 80 | Ga0070659_100002622 | 3300005366 | Bacteria | 12786 |
| 81 | Ga0070659_100015463 | 3300005366 | Bacteria | 5717 |
| 82 | Ga0070659_100227739 | 3300005366 | Bacteria | 1540 |
| 83 | Ga0070667_100000122 | 3300005367 | Bacteria | 99820 |
| 84 | Ga0070667_100005188 | 3300005367 | Bacteria | 10886 |
| 85 | Ga0070667_100005584 | 3300005367 | Bacteria | 10501 |
| 86 | Ga0070667_100015151 | 3300005367 | Bacteria | 6368 |
| 87 | Ga0070667_100171642 | 3300005367 | Bacteria | 1915 |
| 88 | Ga0070703_10006319 | 3300005406 | Bacteria | 3319 |
| 89 | Ga0070709_10005348 | 3300005434 | Bacteria | 6954 |
| 90 | Ga0070714_100017351 | 3300005435 | Bacteria | 5830 |
| 91 | Ga0070713_100015040 | 3300005436 | Bacteria | 5765 |
| 92 | Ga0070710_10045002 | 3300005437 | Bacteria | 2451 |
| 93 | Ga0070701_10002283 | 3300005438 | Bacteria | 7348 |
| 94 | Ga0070701_10008389 | 3300005438 | Bacteria | 4467 |
| 95 | Ga0070711_100011236 | 3300005439 | Bacteria | 5553 |
| 96 | Ga0070705_100001458 | 3300005440 | Bacteria | 12507 |
| 97 | Ga0070700_100001211 | 3300005441 | Bacteria | 12787 |
| 98 | Ga0070694_100001764 | 3300005444 | Bacteria | 12786 |
| 99 | Ga0070694_100155907 | 3300005444 | Bacteria | 1672 |
| 100 | Ga0070663_100000761 | 3300005455 | Bacteria | 17492 |
| 101 | Ga0070678_100000525 | 3300005456 | Bacteria | 18583 |
| 102 | Ga0070678_100008923 | 3300005456 | Bacteria | 6038 |
| 103 | Ga0070662_100002968 | 3300005457 | Bacteria | 10539 |
| 104 | Ga0070662_100050510 | 3300005457 | Bacteria | 3000 |
| 105 | Ga0070681_10004977 | 3300005458 | Bacteria | 12786 |
| 106 | Ga0070681_10033528 | 3300005458 | Bacteria | 5155 |
| 107 | Ga0068867_100002950 | 3300005459 | Bacteria | 11984 |
| 108 | Ga0070685_10003505 | 3300005466 | Bacteria | 7982 |
| 109 | Ga0070685_10229619 | 3300005466 | Bacteria | 1220 |
| 110 | Ga0070706_100557410 | 3300005467 | Bacteria | 1066 |
| 111 | Ga0070699_100145636 | 3300005518 | Bacteria | 2093 |
| 112 | Ga0070679_100015045 | 3300005530 | Bacteria | 7434 |
| 113 | Ga0070679_100157125 | 3300005530 | Bacteria | 2248 |
| 114 | Ga0070684_100005941 | 3300005535 | Bacteria | 9401 |
| 115 | Ga0068853_100003070 | 3300005539 | Bacteria | 12759 |
| 116 | Ga0068853_100050832 | 3300005539 | Bacteria | 3566 |
| 117 | Ga0070672_100002960 | 3300005543 | Bacteria | 10932 |
| 118 | Ga0070672_100464894 | 3300005543 | Bacteria | 1091 |
| 119 | Ga0070686_100001573 | 3300005544 | Bacteria | 12811 |
| 120 | Ga0070686_100008797 | 3300005544 | Bacteria | 5658 |
| 121 | Ga0070695_100002369 | 3300005545 | Bacteria | 10826 |
| 122 | Ga0070695_100091328 | 3300005545 | Bacteria | 2033 |
| 123 | Ga0070696_100028599 | 3300005546 | Bacteria | 3804 |
| 124 | Ga0070693_100000880 | 3300005547 | Bacteria | 13363 |
| 125 | Ga0070693_100282566 | 3300005547 | Bacteria | 1112 |
| 126 | Ga0070665_100025279 | 3300005548 | Bacteria | 5983 |
| 127 | Ga0070704_100001917 | 3300005549 | Bacteria | 11493 |
| 128 | Ga0068855_100009051 | 3300005563 | Bacteria | 12031 |
| 129 | Ga0068855_100111759 | 3300005563 | Bacteria | 3136 |
| 130 | Ga0070664_100002934 | 3300005564 | Bacteria | 13792 |
| 131 | Ga0070664_100379526 | 3300005564 | Bacteria | 1290 |
| 132 | Ga0068857_100000358 | 3300005577 | Bacteria | 31869 |
| 133 | Ga0068857_100015287 | 3300005577 | Bacteria | 6700 |
| 134 | Ga0068857_100086207 | 3300005577 | Bacteria | 2807 |
| 135 | Ga0068857_100163221 | 3300005577 | Bacteria | 2022 |
| 136 | Ga0068854_100003080 | 3300005578 | Bacteria | 10382 |
| 137 | Ga0068856_100065216 | 3300005614 | Bacteria | 3598 |
| 138 | Ga0068856_100069199 | 3300005614 | Bacteria | 3490 |
| 139 | Ga0070702_100000526 | 3300005615 | Bacteria | 13792 |
| 140 | Ga0068852_101152709 | 3300005616 | Bacteria | 796 |
| 141 | Ga0068859_100005591 | 3300005617 | Bacteria | 12805 |
| 142 | Ga0068859_100014466 | 3300005617 | Bacteria | 7921 |
| 143 | Ga0068859_100018845 | 3300005617 | Bacteria | 6934 |
| 144 | Ga0068859_100065369 | 3300005617 | Bacteria | 3671 |
| 145 | Ga0068859_100488010 | 3300005617 | Bacteria | 1327 |
| 146 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 147 | Ga0068864_100000158 | 3300005618 | Bacteria | 62676 |
| 148 | Ga0068864_100001988 | 3300005618 | Bacteria | 16835 |
| 149 | Ga0068861_100001805 | 3300005719 | Bacteria | 13785 |
| 150 | Ga0068861_100011624 | 3300005719 | Bacteria | 6125 |
| 151 | Ga0068861_100040005 | 3300005719 | Bacteria | 3503 |
| 152 | Ga0068861_100041488 | 3300005719 | Bacteria | 3447 |
| 153 | Ga0068870_10000025 | 3300005840 | Bacteria | 46848 |
| 154 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 155 | Ga0068863_100000030 | 3300005841 | Bacteria | 176023 |
| 156 | Ga0068863_100002964 | 3300005841 | Bacteria | 16783 |
| 157 | Ga0068863_100057811 | 3300005841 | Bacteria | 3670 |
| 158 | Ga0068858_100003227 | 3300005842 | Bacteria | 16273 |
| 159 | Ga0068860_100000152 | 3300005843 | Bacteria | 112187 |
| 160 | Ga0068860_100007120 | 3300005843 | Bacteria | 11192 |
| 161 | Ga0068860_100055285 | 3300005843 | Bacteria | 3773 |
| 162 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 163 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 164 | Ga0068862_100032289 | 3300005844 | Bacteria | 4423 |
| 165 | Ga0081455_10000276 | 3300005937 | Bacteria | 68055 |
| 166 | Ga0081455_10000545 | 3300005937 | Bacteria | 48941 |
| 167 | Ga0081538_10086861 | 3300005981 | Bacteria | 1635 |
| 168 | Ga0081540_1004944 | 3300005983 | Bacteria | 10022 |
| 169 | Ga0075365_10047707 | 3300006038 | Bacteria | 2816 |
| 170 | Ga0075432_10011268 | 3300006058 | Bacteria | 3039 |
| 171 | Ga0075432_10085603 | 3300006058 | Bacteria | 1148 |
| 172 | Ga0070715_10000196 | 3300006163 | Bacteria | 14161 |
| 173 | Ga0075367_10208140 | 3300006178 | Bacteria | 1223 |
| 174 | Ga0097621_100000456 | 3300006237 | Bacteria | 28666 |
| 175 | Ga0075370_10060370 | 3300006353 | Bacteria | 2160 |
| 176 | Ga0068871_100000269 | 3300006358 | Bacteria | 35773 |
| 177 | Ga0075428_100136861 | 3300006844 | Bacteria | 2663 |
| 178 | Ga0075430_100243354 | 3300006846 | Bacteria | 1491 |
| 179 | Ga0075431_100030106 | 3300006847 | Bacteria | 5589 |
| 180 | Ga0075433_10021666 | 3300006852 | Bacteria | 5391 |
| 181 | Ga0075434_100011399 | 3300006871 | Bacteria | 8385 |
| 182 | Ga0068865_100001731 | 3300006881 | Bacteria | 12818 |
| 183 | Ga0068865_100055301 | 3300006881 | Bacteria | 2761 |
| 184 | Ga0075436_100444135 | 3300006914 | Bacteria | 944 |
| 185 | Ga0097620_100005590 | 3300006931 | Bacteria | 12805 |
| 186 | Ga0097620_100014466 | 3300006931 | Bacteria | 7921 |
| 187 | Ga0097620_100018845 | 3300006931 | Bacteria | 6934 |
| 188 | Ga0097620_100065370 | 3300006931 | Bacteria | 3671 |
| 189 | Ga0097620_100488013 | 3300006931 | Bacteria | 1327 |
| 190 | Ga0075435_100139121 | 3300007076 | Bacteria | 2036 |
| 191 | Ga0105251_10022538 | 3300009011 | Bacteria | 3268 |
| 192 | Ga0105250_10025819 | 3300009092 | Bacteria | 2367 |
| 193 | Ga0111539_10003217 | 3300009094 | Bacteria | 21607 |
| 194 | Ga0111539_10007321 | 3300009094 | Bacteria | 14133 |
| 195 | Ga0105245_10000183 | 3300009098 | Bacteria | 59105 |
| 196 | Ga0105247_10009563 | 3300009101 | Bacteria | 5882 |
| 197 | Ga0105247_10076689 | 3300009101 | Bacteria | 2099 |
| 198 | Ga0105247_10566023 | 3300009101 | Bacteria | 838 |
| 199 | Ga0114129_10020394 | 3300009147 | Bacteria | 9429 |
| 200 | Ga0105243_10001561 | 3300009148 | Bacteria | 20018 |
| 201 | Ga0105243_10064823 | 3300009148 | Bacteria | 2933 |
| 202 | Ga0105243_10581004 | 3300009148 | Bacteria | 1075 |
| 203 | Ga0105241_10003567 | 3300009174 | Bacteria | 11569 |
| 204 | Ga0105242_10000701 | 3300009176 | Bacteria | 26184 |
| 205 | Ga0105248_10000010 | 3300009177 | Bacteria | 344314 |
| 206 | Ga0105248_10000287 | 3300009177 | Bacteria | 59537 |
| 207 | Ga0105248_10010394 | 3300009177 | Bacteria | 10250 |
| 208 | Ga0105248_10048525 | 3300009177 | Bacteria | 4763 |
| 209 | Ga0105237_10072251 | 3300009545 | Bacteria | 3444 |
| 210 | Ga0105237_10248367 | 3300009545 | Bacteria | 1781 |
| 211 | Ga0105238_10404069 | 3300009551 | Bacteria | 1359 |
| 212 | Ga0105249_10000041 | 3300009553 | Bacteria | 195999 |
| 213 | Ga0105249_10007674 | 3300009553 | Bacteria | 9406 |
| 214 | Ga0105249_10009795 | 3300009553 | Bacteria | 8397 |
| 215 | Ga0105249_10037419 | 3300009553 | Bacteria | 4404 |
| 216 | Ga0105249_10157328 | 3300009553 | Bacteria | 2193 |
| 217 | Ga0105249_10499013 | 3300009553 | Bacteria | 1262 |
| 218 | Ga0105239_10170015 | 3300010375 | Bacteria | 2437 |
| 219 | Ga0105246_10002447 | 3300011119 | Bacteria | 11209 |
| 220 | Ga0157337_1000504 | 3300012483 | Bacteria | 1801 |
| 221 | Ga0157342_1001861 | 3300012507 | Bacteria | 1635 |
| 222 | Ga0157326_1000433 | 3300012513 | Bacteria | 4960 |
| 223 | Ga0157371_10018807 | 3300013102 | Bacteria | 5103 |
| 224 | Ga0157369_10631810 | 3300013105 | Bacteria | 1105 |
| 225 | Ga0157374_10000463 | 3300013296 | Bacteria | 36848 |
| 226 | Ga0157378_10000613 | 3300013297 | Bacteria | 33512 |
| 227 | Ga0157378_10078681 | 3300013297 | Bacteria | 2975 |
| 228 | Ga0157378_10189118 | 3300013297 | Bacteria | 1941 |
| 229 | Ga0163162_10020966 | 3300013306 | Bacteria | 6429 |
| 230 | Ga0163162_10514426 | 3300013306 | Bacteria | 1327 |
| 231 | Ga0157372_10010921 | 3300013307 | Bacteria | 9665 |
| 232 | Ga0157372_10458495 | 3300013307 | Bacteria | 1486 |
| 233 | Ga0157375_10004786 | 3300013308 | Bacteria | 11768 |
| 234 | Ga0157375_10639127 | 3300013308 | Bacteria | 1221 |
| 235 | Ga0163163_10201970 | 3300014325 | Bacteria | 2036 |
| 236 | Ga0157380_10004641 | 3300014326 | Bacteria | 9554 |
| 237 | Ga0157380_10164250 | 3300014326 | Bacteria | 1933 |
| 238 | Ga0182008_10151350 | 3300014497 | Bacteria | 1164 |
| 239 | Ga0157379_10003902 | 3300014968 | Bacteria | 12714 |
| 240 | Ga0157379_10146649 | 3300014968 | Bacteria | 2128 |
| 241 | Ga0157376_10003730 | 3300014969 | Bacteria | 10526 |
| 242 | Ga0157376_10435195 | 3300014969 | Bacteria | 1276 |
| 243 | Ga0206353_11997182 | 3300020082 | Bacteria | 20195 |
| 244 | Ga0213875_10004900 | 3300021388 | Bacteria | 7267 |
| 245 | Ga0207666_1000140 | 3300025271 | Bacteria | 11329 |
| 246 | Ga0209130_1000749 | 3300025284 | Bacteria | 28197 |
| 247 | Ga0207673_1000039 | 3300025290 | Bacteria | 10384 |
| 248 | Ga0209025_1000847 | 3300025294 | Bacteria | 48445 |
| 249 | Ga0209758_1002804 | 3300025297 | Bacteria | 17007 |
| 250 | Ga0207426_1000616 | 3300025302 | Bacteria | 45569 |
| 251 | Ga0207697_10000763 | 3300025315 | Bacteria | 18220 |
| 252 | Ga0207696_1022621 | 3300025711 | Bacteria | 1994 |
| 253 | Ga0207713_1019929 | 3300025735 | Bacteria | 3266 |
| 254 | Ga0207653_10001778 | 3300025885 | Bacteria | 6892 |
| 255 | Ga0207692_10056041 | 3300025898 | Bacteria | 2020 |
| 256 | Ga0207710_10004068 | 3300025900 | Bacteria | 6431 |
| 257 | Ga0207688_10001992 | 3300025901 | Bacteria | 10954 |
| 258 | Ga0207688_10086237 | 3300025901 | Bacteria | 1799 |
| 259 | Ga0207680_10028054 | 3300025903 | Bacteria | 3144 |
| 260 | Ga0207680_10127284 | 3300025903 | Bacteria | 1674 |
| 261 | Ga0207680_10135703 | 3300025903 | Bacteria | 1626 |
| 262 | Ga0207647_10003504 | 3300025904 | Bacteria | 11767 |
| 263 | Ga0207685_10106615 | 3300025905 | Bacteria | 1208 |
| 264 | Ga0207699_10048618 | 3300025906 | Bacteria | 2492 |
| 265 | Ga0207645_10000248 | 3300025907 | Bacteria | 44949 |
| 266 | Ga0207643_10000064 | 3300025908 | Bacteria | 70490 |
| 267 | Ga0207705_10143274 | 3300025909 | Bacteria | 1786 |
| 268 | Ga0207654_10001623 | 3300025911 | Bacteria | 11742 |
| 269 | Ga0207707_10002084 | 3300025912 | Bacteria | 18100 |
| 270 | Ga0207707_10523957 | 3300025912 | Bacteria | 1009 |
| 271 | Ga0207671_10007347 | 3300025914 | Bacteria | 9567 |
| 272 | Ga0207671_10016982 | 3300025914 | Bacteria | 5633 |
| 273 | Ga0207693_10031950 | 3300025915 | Bacteria | 4159 |
| 274 | Ga0207660_10000194 | 3300025917 | Bacteria | 38742 |
| 275 | Ga0207662_10001637 | 3300025918 | Bacteria | 10959 |
| 276 | Ga0207662_10062873 | 3300025918 | Bacteria | 2231 |
| 277 | Ga0207657_10006919 | 3300025919 | Bacteria | 11695 |
| 278 | Ga0207657_10424603 | 3300025919 | Bacteria | 1044 |
| 279 | Ga0207649_10000234 | 3300025920 | Bacteria | 45397 |
| 280 | Ga0207649_10072825 | 3300025920 | Bacteria | 2199 |
| 281 | Ga0207652_10001613 | 3300025921 | Bacteria | 19823 |
| 282 | Ga0207681_10000041 | 3300025923 | Bacteria | 140201 |
| 283 | Ga0207681_10000794 | 3300025923 | Bacteria | 20828 |
| 284 | Ga0207681_10061762 | 3300025923 | Bacteria | 2577 |
| 285 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 286 | Ga0207650_10000298 | 3300025925 | Bacteria | 49421 |
| 287 | Ga0207650_10010580 | 3300025925 | Bacteria | 6336 |
| 288 | Ga0207659_10000172 | 3300025926 | Bacteria | 38725 |
| 289 | Ga0207659_10396630 | 3300025926 | Bacteria | 1153 |
| 290 | Ga0207687_10008699 | 3300025927 | Bacteria | 6631 |
| 291 | Ga0207700_10006617 | 3300025928 | Bacteria | 7021 |
| 292 | Ga0207664_10078623 | 3300025929 | Bacteria | 2675 |
| 293 | Ga0207644_10000169 | 3300025931 | Bacteria | 46645 |
| 294 | Ga0207644_10000439 | 3300025931 | Bacteria | 26923 |
| 295 | Ga0207690_10000796 | 3300025932 | Bacteria | 20342 |
| 296 | Ga0207690_10056673 | 3300025932 | Bacteria | 2644 |
| 297 | Ga0207706_10005059 | 3300025933 | Bacteria | 12314 |
| 298 | Ga0207686_10001093 | 3300025934 | Bacteria | 15891 |
| 299 | Ga0207709_10001438 | 3300025935 | Bacteria | 16619 |
| 300 | Ga0207709_10012223 | 3300025935 | Bacteria | 4730 |
| 301 | Ga0207670_10000807 | 3300025936 | Bacteria | 16336 |
| 302 | Ga0207670_10131498 | 3300025936 | Bacteria | 1834 |
| 303 | Ga0207669_10000141 | 3300025937 | Bacteria | 34618 |
| 304 | Ga0207669_10130268 | 3300025937 | Bacteria | 1727 |
| 305 | Ga0207669_10303083 | 3300025937 | Bacteria | 1215 |
| 306 | Ga0207704_10000755 | 3300025938 | Bacteria | 14264 |
| 307 | Ga0207665_10002433 | 3300025939 | Bacteria | 12590 |
| 308 | Ga0207691_10006997 | 3300025940 | Bacteria | 10884 |
| 309 | Ga0207691_10210058 | 3300025940 | Bacteria | 1691 |
| 310 | Ga0207711_10000038 | 3300025941 | Bacteria | 163520 |
| 311 | Ga0207711_10000658 | 3300025941 | Bacteria | 34432 |
| 312 | Ga0207711_10006747 | 3300025941 | Bacteria | 9652 |
| 313 | Ga0207711_10035665 | 3300025941 | Bacteria | 4218 |
| 314 | Ga0207689_10456732 | 3300025942 | Bacteria | 1068 |
| 315 | Ga0207661_10000098 | 3300025944 | Bacteria | 55518 |
| 316 | Ga0207661_10138465 | 3300025944 | Bacteria | 2092 |
| 317 | Ga0207679_10000174 | 3300025945 | Bacteria | 53051 |
| 318 | Ga0207679_10097786 | 3300025945 | Bacteria | 2287 |
| 319 | Ga0207679_10680521 | 3300025945 | Bacteria | 932 |
| 320 | Ga0207667_10004743 | 3300025949 | Bacteria | 16630 |
| 321 | Ga0207667_10207178 | 3300025949 | Bacteria | 2010 |
| 322 | Ga0207651_10000782 | 3300025960 | Bacteria | 13684 |
| 323 | Ga0207712_10000659 | 3300025961 | Bacteria | 26800 |
| 324 | Ga0207712_10005928 | 3300025961 | Bacteria | 7703 |
| 325 | Ga0207668_10001107 | 3300025972 | Bacteria | 16030 |
| 326 | Ga0207668_10002109 | 3300025972 | Bacteria | 11604 |
| 327 | Ga0207668_10012828 | 3300025972 | Bacteria | 5142 |
| 328 | Ga0207640_10000846 | 3300025981 | Bacteria | 17376 |
| 329 | Ga0207640_10035208 | 3300025981 | Bacteria | 3131 |
| 330 | Ga0207658_10000092 | 3300025986 | Bacteria | 99965 |
| 331 | Ga0207658_10000474 | 3300025986 | Bacteria | 37159 |
| 332 | Ga0207658_10001843 | 3300025986 | Bacteria | 15875 |
| 333 | Ga0207658_10003847 | 3300025986 | Bacteria | 10575 |
| 334 | Ga0207658_10199433 | 3300025986 | Bacteria | 1670 |
| 335 | Ga0207677_10144090 | 3300026023 | Bacteria | 1828 |
| 336 | Ga0207703_10002433 | 3300026035 | Bacteria | 16135 |
| 337 | Ga0207639_10017221 | 3300026041 | Bacteria | 5123 |
| 338 | Ga0207639_10361416 | 3300026041 | Bacteria | 1299 |
| 339 | Ga0207678_10001059 | 3300026067 | Bacteria | 25176 |
| 340 | Ga0207708_10002793 | 3300026075 | Bacteria | 12833 |
| 341 | Ga0207702_10014464 | 3300026078 | Bacteria | 6553 |
| 342 | Ga0207702_10067037 | 3300026078 | Bacteria | 3079 |
| 343 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 344 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 345 | Ga0207641_10000622 | 3300026088 | Bacteria | 38657 |
| 346 | Ga0207641_10009974 | 3300026088 | Bacteria | 7815 |
| 347 | Ga0207641_10135165 | 3300026088 | Bacteria | 2219 |
| 348 | Ga0207648_10009300 | 3300026089 | Bacteria | 9423 |
| 349 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 350 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 351 | Ga0207676_10002696 | 3300026095 | Bacteria | 12630 |
| 352 | Ga0207674_10001342 | 3300026116 | Bacteria | 31848 |
| 353 | Ga0207674_10021817 | 3300026116 | Bacteria | 6892 |
| 354 | Ga0207674_10036947 | 3300026116 | Bacteria | 5083 |
| 355 | Ga0207674_10175278 | 3300026116 | Bacteria | 2097 |
| 356 | Ga0207675_100000309 | 3300026118 | Bacteria | 46765 |
| 357 | Ga0207675_100006706 | 3300026118 | Bacteria | 10886 |
| 358 | Ga0207675_100011711 | 3300026118 | Bacteria | 8203 |
| 359 | Ga0207675_100489763 | 3300026118 | Bacteria | 1223 |
| 360 | Ga0207683_10001193 | 3300026121 | Bacteria | 23509 |
| 361 | Ga0207683_10010913 | 3300026121 | Bacteria | 7748 |
| 362 | Ga0209973_1003691 | 3300027252 | Bacteria | 1525 |
| 363 | Ga0209982_1015579 | 3300027552 | Bacteria | 1154 |
| 364 | Ga0209971_1015247 | 3300027682 | Bacteria | 1822 |
| 365 | Ga0209966_1001072 | 3300027695 | Bacteria | 4995 |
| 366 | Ga0209966_1002975 | 3300027695 | Bacteria | 2842 |
| 367 | Ga0209998_10001333 | 3300027717 | Bacteria | 5996 |
| 368 | Ga0209998_10001362 | 3300027717 | Bacteria | 5937 |
| 369 | Ga0209974_10014808 | 3300027876 | Bacteria | 2590 |
| 370 | Ga0209974_10020958 | 3300027876 | Bacteria | 2166 |
| 371 | Ga0207428_10000513 | 3300027907 | Bacteria | 46311 |
| 372 | Ga0207428_10000626 | 3300027907 | Bacteria | 41522 |
| 373 | Ga0268266_10305765 | 3300028379 | Bacteria | 1485 |
| 374 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 375 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 376 | Ga0268265_10002370 | 3300028380 | Bacteria | 14256 |
| 377 | Ga0268265_10014719 | 3300028380 | Bacteria | 5337 |
| 378 | Ga0268264_10000111 | 3300028381 | Bacteria | 204718 |
| 379 | Ga0268264_10004444 | 3300028381 | Bacteria | 11961 |
| 380 | Ga0268264_10276778 | 3300028381 | Bacteria | 1570 |
| 381 | Ga0316576_10128314 | 3300031727 | Bacteria | 1907 |
| 382 | Ga0307405_10542773 | 3300031731 | Bacteria | 939 |
| 383 | Ga0307406_10018812 | 3300031901 | Bacteria | 4043 |
| 384 | Ga0307406_10145223 | 3300031901 | Bacteria | 1685 |
| 385 | Ga0307412_10001980 | 3300031911 | Bacteria | 11350 |
| 386 | Ga0307412_10015841 | 3300031911 | Bacteria | 4477 |
| 387 | Ga0307412_10043249 | 3300031911 | Bacteria | 2932 |
| 388 | Ga0307416_100191670 | 3300032002 | Bacteria | 1929 |
| 389 | Ga0316583_10079080 | 3300032133 | Bacteria | 1149 |
| 390 | Ga0307510_10119715 | 3300033180 | Bacteria | 2342 |
| 391 | Ga0373930_0004579 | 3300034816 | Bacteria | 2260 |
| 392 | Ga0373948_0000049 | 3300034817 | Bacteria | 12986 |
| 393 | Ga0373948_0010541 | 3300034817 | Bacteria | 1616 |
| 394 | Ga0373950_0000665 | 3300034818 | Bacteria | 4258 |
| 395 | Ga0373958_0000026 | 3300034819 | Bacteria | 16079 |
| 396 | Ga0373958_0000135 | 3300034819 | Bacteria | 8219 |
| 397 | Ga0373959_0001171 | 3300034820 | Bacteria | 4235 |
| 398 | Ga0373959_0002832 | 3300034820 | Bacteria | 2756 |
| 399 | Ga0373938_0000133 | 3300034957 | Bacteria | 10609 |
| 400 | Ga0373928_0007183 | 3300035084 | Bacteria | 2147 |
| 401 | Ga0373929_0000110 | 3300035085 | Bacteria | 13537 |
| 402 | Ga0373929_0004350 | 3300035085 | Bacteria | 2543 |
| 403 | Ga0373940_0002247 | 3300035088 | Bacteria | 3714 |
| 404 | Ga0373940_0006899 | 3300035088 | Bacteria | 2543 |
| 405 | Ga0373949_0000771 | 3300035090 | Bacteria | 10307 |
| 406 | Ga0373949_0001010 | 3300035090 | Bacteria | 8668 |
| 407 | Ga0373951_0003615 | 3300035091 | Bacteria | 3728 |
| 408 | Ga0373952_0000200 | 3300035092 | Bacteria | 9497 |
| 409 | Ga0373932_0000822 | 3300035112 | Bacteria | 9175 |
| 410 | Ga0373932_0001180 | 3300035112 | Bacteria | 7469 |
| 411 | Ga0373939_0003897 | 3300035114 | Bacteria | 3509 |
| 412 | Ga0373941_0000259 | 3300035115 | Bacteria | 10177 |
| 413 | Ga0373960_0000277 | 3300035121 | Bacteria | 9832 |
| 414 | Ga0373960_0001175 | 3300035121 | Bacteria | 5700 |
| 415 | Ga0373942_0029123 | 3300035207 | Bacteria | 1447 |
| 416 | Ga0373961_0001383 | 3300035241 | Bacteria | 7253 |
| 417 | Ga0373961_0001598 | 3300035241 | Bacteria | 6444 |
| 418 | Ga0373962_0000275 | 3300035242 | Bacteria | 11095 |
| 419 | Ga0373931_0002417 | 3300035691 | Bacteria | 8259 |
| 420 | Ga0373931_0007842 | 3300035691 | Bacteria | 5046 |
| 421 | Ga0373931_0032643 | 3300035691 | Bacteria | 2695 |
| 422 | Ga0373927_0197669 | 3300035695 | Bacteria | 1320 |
| 423 | Ga0373933_0130460 | 3300035724 | Unclassified | 1580 |
| 424 | Ga0316582_0108359 | 3300036647 | Bacteria | 1847 |
| 425 | Ga0395899_0218369 | 3300037312 | Bacteria | 1322 |
| 426 | Ga0395900_0002906 | 3300037418 | Bacteria | 18663 |
| 427 | Ga0395898_0125357 | 3300037466 | Bacteria | 2460 |
| 428 | Ga0436364_1309894 | 3300037853 | Bacteria | 49139 |
| 429 | Ga0395901_0006644 | 3300038443 | Bacteria | 11686 |
| 430 | Ga0395901_0190413 | 3300038443 | Bacteria | 2151 |
| 431 | Ga0242420_016335 | 3300038996 | Bacteria | 1292 |
| 432 | Ga0451806_525822 | 3300041462 | Bacteria | 1499 |
| 433 | Ga0439463_026003 | 3300042016 | Bacteria | 1470 |
| 434 | Ga0450907_005098 | 3300042146 | Bacteria | 2229 |
| 435 | Ga0439444_0022357 | 3300042437 | Bacteria | 1127 |
| 436 | Ga0439464_0011060 | 3300042439 | Bacteria | 2386 |
| 437 | Ga0466973_0110359 | 3300044659 | Bacteria | 2301 |
| 438 | Ga0451576_0013587 | 3300045051 | Bacteria | 9101 |
| 439 | Ga0495663_0035443 | 3300046525 | Bacteria | 1499 |
| 440 | Ga0495654_0008624 | 3300046530 | Bacteria | 5621 |
| 441 | Ga0495654_0034158 | 3300046530 | Bacteria | 2568 |
| 442 | Ga0495597_0010903 | 3300046542 | Bacteria | 4422 |
| 443 | Ga0495633_0187535 | 3300046558 | Bacteria | 951 |
| 444 | Ga0495668_0005443 | 3300046616 | Bacteria | 8636 |
| 445 | Ga0495668_0012118 | 3300046616 | Bacteria | 5128 |
| 446 | Ga0495668_0029780 | 3300046616 | Bacteria | 3084 |
| 447 | Ga0495625_0500182 | 3300046660 | Bacteria | 743 |
| 448 | Ga0495669_0194113 | 3300046684 | Bacteria | 969 |
| 449 | Ga0495677_0021568 | 3300047445 | Bacteria | 2334 |
| 450 | Ga0495686_0000302 | 3300047472 | Bacteria | 84826 |
| 451 | Ga0495686_0017645 | 3300047472 | Bacteria | 4802 |
| 452 | Ga0495686_0022875 | 3300047472 | Bacteria | 4130 |
| 453 | Ga0495686_0118679 | 3300047472 | Bacteria | 1579 |
| 454 | Ga0496100_0000447 | 3300048903 | Bacteria | 19924 |
| 455 | Ga0496101_0001349 | 3300048904 | Bacteria | 14712 |
| 456 | Ga0496101_0557092 | 3300048904 | Bacteria | 906 |
| 457 | Ga0496102_0002263 | 3300048905 | Bacteria | 16489 |
| 458 | Ga0496102_0002354 | 3300048905 | Bacteria | 16125 |
| 459 | Ga0496102_0344120 | 3300048905 | Bacteria | 1404 |
| 460 | Ga0496103_0000837 | 3300048906 | Bacteria | 22480 |
| 461 | Ga0496103_0001362 | 3300048906 | Bacteria | 16473 |
| 462 | Ga0496106_0001351 | 3300048909 | Bacteria | 18370 |
| 463 | Ga0496106_0150742 | 3300048909 | Bacteria | 1834 |
| 464 | Ga0496107_0001211 | 3300048910 | Bacteria | 15713 |
| 465 | Ga0496107_0154644 | 3300048910 | Bacteria | 1698 |
| 466 | Ga0496107_0246573 | 3300048910 | Bacteria | 1329 |
| 467 | Ga0496109_0005044 | 3300048912 | Bacteria | 11034 |
| 468 | Ga0496110_0030428 | 3300048913 | Bacteria | 4654 |
| 469 | Ga0496110_0030903 | 3300048913 | Bacteria | 4619 |
| 470 | Ga0496111_0060526 | 3300048914 | Bacteria | 2745 |
| 471 | Ga0496113_0192565 | 3300048916 | Bacteria | 1618 |
| 472 | Ga0496114_0001734 | 3300048917 | Bacteria | 16551 |
| 473 | Ga0496115_0000592 | 3300048918 | Bacteria | 27769 |
| 474 | Ga0496116_0003256 | 3300048919 | Bacteria | 16177 |
| 475 | Ga0496117_0004043 | 3300048920 | Bacteria | 16489 |
| 476 | Ga0496117_0004127 | 3300048920 | Bacteria | 16262 |
| 477 | Ga0496118_0000463 | 3300048921 | Bacteria | 67382 |
| 478 | Ga0496118_0004497 | 3300048921 | Bacteria | 16489 |
| 479 | Ga0496118_0027922 | 3300048921 | Bacteria | 4766 |
| 480 | Ga0496119_0016231 | 3300048922 | Bacteria | 5684 |
| 481 | Ga0496119_0164339 | 3300048922 | Bacteria | 1177 |
| 482 | Ga0496119_0164696 | 3300048922 | Bacteria | 1175 |
| 483 | Ga0496120_0131593 | 3300048923 | Bacteria | 1280 |
| 484 | Ga0496120_0175430 | 3300048923 | Bacteria | 1057 |
| 485 | Ga0496122_0389929 | 3300048925 | Bacteria | 711 |
| 486 | Ga0496124_0004389 | 3300048927 | Bacteria | 16489 |
| 487 | Ga0496124_0072061 | 3300048927 | Bacteria | 2862 |
| 488 | Ga0496126_0110561 | 3300048929 | Bacteria | 2394 |
| 489 | Ga0501290_000038 | 3300049513 | Bacteria | 17018 |
| 490 | Ga0501292_000038 | 3300049515 | Bacteria | 31848 |
| 491 | Ga0501294_000225 | 3300049517 | Bacteria | 6944 |
| 492 | Ga0501032_0015359 | 3300049569 | Bacteria | 5405 |
| 493 | Ga0501034_0097580 | 3300049571 | Bacteria | 2934 |
| 494 | Ga0501038_0020281 | 3300049574 | Bacteria | 5979 |
| 495 | Ga0501039_0227957 | 3300049575 | Bacteria | 1464 |
| 496 | Ga0501041_0231945 | 3300049577 | Bacteria | 1159 |
| 497 | Ga0501043_0010164 | 3300049579 | Bacteria | 7377 |
| 498 | Ga0501043_0150354 | 3300049579 | Bacteria | 1822 |
| 499 | Ga0501047_0000876 | 3300049581 | Bacteria | 30712 |
| 500 | Ga0501068_0219173 | 3300049584 | Bacteria | 1209 |
| 501 | Ga0501070_0264359 | 3300049586 | Bacteria | 1406 |
| 502 | Ga0501072_0392571 | 3300049588 | Bacteria | 1101 |
| 503 | Ga0501075_0233841 | 3300049591 | Bacteria | 1401 |
| 504 | Ga0501075_0317299 | 3300049591 | Bacteria | 1188 |
| 505 | Ga0501076_0098870 | 3300049592 | Bacteria | 2351 |
| 506 | Ga0501077_0033324 | 3300049593 | Bacteria | 3278 |
| 507 | Ga0501077_0185458 | 3300049593 | Bacteria | 1322 |
| 508 | Ga0501202_031880 | 3300049652 | Bacteria | 1104 |
| 509 | Ga0501206_001289 | 3300049653 | Bacteria | 3130 |
| 510 | Ga0501223_002886 | 3300049663 | Bacteria | 3770 |
| 511 | Ga0501224_003519 | 3300049664 | Bacteria | 2191 |
| 512 | Ga0501235_009139 | 3300049669 | Bacteria | 2165 |
| 513 | Ga0501249_000464 | 3300049679 | Bacteria | 10123 |
| 514 | Ga0501259_004554 | 3300049688 | Bacteria | 2205 |
| 515 | Ga0501261_000037 | 3300049690 | Bacteria | 27038 |
| 516 | Ga0501079_0102332 | 3300049741 | Bacteria | 2221 |
| 517 | Ga0501080_0068719 | 3300049742 | Bacteria | 3295 |
| 518 | Ga0501081_0382498 | 3300049743 | Bacteria | 1040 |
| 519 | Ga0501279_000016 | 3300049775 | Bacteria | 64067 |
| 520 | Ga0501280_000059 | 3300049776 | Bacteria | 31802 |
| 521 | Ga0501281_00345 | 3300049777 | Bacteria | 4757 |
| 522 | Ga0501282_000110 | 3300049778 | Bacteria | 9466 |
| 523 | Ga0501044_0240007 | 3300049823 | Bacteria | 1756 |
| 524 | Ga0501044_0384362 | 3300049823 | Bacteria | 1318 |
| 525 | Ga0501045_0177761 | 3300049824 | Bacteria | 1586 |
| 526 | nmdc:mga06z11_73418_c1 | 3300050494 | Bacteria | 1816 |
| 527 | nmdc:mga09592_281149_c1 | 3300050508 | Bacteria | 1443 |
| 528 | nmdc:mga0qj67_286469_c1 | 3300050509 | Bacteria | 1335 |
| 529 | nmdc:mga06r32_114169_c1 | 3300050510 | Bacteria | 2659 |
| 530 | nmdc:mga08y16_7407_c1 | 3300050511 | Bacteria | 11499 |
| 531 | nmdc:mga08y16_8959_c1 | 3300050511 | Bacteria | 10509 |
| 532 | nmdc:mga0n895_298486_c1 | 3300050512 | Bacteria | 1633 |
| 533 | nmdc:mga0n895_3698_c1 | 3300050512 | Bacteria | 12366 |
| 534 | nmdc:mga0rr50_227667_c1 | 3300050513 | Bacteria | 1541 |
| 535 | nmdc:mga0rr50_390810_c1 | 3300050513 | Bacteria | 1174 |
| 536 | nmdc:mga0rr50_401477_c1 | 3300050513 | Bacteria | 1158 |
| 537 | nmdc:mga0a205_1633_c1 | 3300050515 | Bacteria | 19288 |
| 538 | nmdc:mga0a205_94603_c1 | 3300050515 | Bacteria | 2886 |
| 539 | Ga0495619_0195583 | 3300053085 | Bacteria | 1400 |
| 540 | Ga0500643_000115 | 3300053087 | Bacteria | 84126 |
| 541 | Ga0500643_000326 | 3300053087 | Bacteria | 38307 |
| 542 | Ga0500643_001868 | 3300053087 | Bacteria | 11468 |
| 543 | Ga0500643_083140 | 3300053087 | Bacteria | 878 |
| 544 | Ga0500647_0032167 | 3300053091 | Bacteria | 2499 |
| 545 | Ga0500651_0002180 | 3300053093 | Bacteria | 10245 |
| 546 | Ga0500592_000019 | 3300053116 | Bacteria | 57900 |
| 547 | Ga0500614_023206 | 3300053123 | Bacteria | 1456 |
| 548 | Ga0500655_000162 | 3300053133 | Bacteria | 16347 |
| 549 | Ga0500577_0027326 | 3300053142 | Bacteria | 1953 |
| 550 | Ga0500590_000967 | 3300053148 | Bacteria | 11087 |
| 551 | Ga0500622_0006224 | 3300053156 | Bacteria | 6981 |
| 552 | Ga0500627_0000211 | 3300053158 | Bacteria | 16854 |
| 553 | Ga0500627_0003527 | 3300053158 | Bacteria | 4854 |
| 554 | Ga0500627_0036531 | 3300053158 | Bacteria | 2092 |
| 555 | Ga0500627_0052392 | 3300053158 | Bacteria | 1781 |
| 556 | Ga0500570_000414 | 3300053724 | Bacteria | 16236 |
| 557 | Ga0501084_0030992 | 3300054114 | Bacteria | 4472 |
| 558 | Ga0501084_0120232 | 3300054114 | Bacteria | 2209 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048925 | Ga0496122_0389929 | Ga0496122_0389929_31_693 | 219 |
| 2 | 3300053123 | Ga0500614_023206 | Ga0500614_023206_10_675 | 219 |
| 3 | 3300048922 | Ga0496119_0016231 | Ga0496119_0016231_3707_4447 | 226 |
| 4 | 3300048923 | Ga0496120_0175430 | Ga0496120_0175430_63_803 | 226 |
| 5 | 3300046660 | Ga0495625_0500182 | Ga0495625_0500182_11_709 | 230 |
| 6 | 3300048921 | Ga0496118_0027922 | Ga0496118_0027922_2188_2886 | 230 |
| 7 | 3300046616 | Ga0495668_0005443 | Ga0495668_0005443_1582_2349 | 232 |
| 8 | 3300047472 | Ga0495686_0000302 | Ga0495686_0000302_12017_12757 | 237 |
| 9 | 3300005328 | Ga0070676_10035991 | Ga0070676_100359912 | 239 |
| 10 | 3300005330 | Ga0070690_100168761 | Ga0070690_1001687612 | 239 |
| 11 | 3300005456 | Ga0070678_100008923 | Ga0070678_1000089234 | 239 |
| 12 | 3300013297 | Ga0157378_10189118 | Ga0157378_101891182 | 239 |
| 13 | 3300014969 | Ga0157376_10435195 | Ga0157376_104351952 | 239 |
| 14 | 3300025937 | Ga0207669_10130268 | Ga0207669_101302683 | 239 |
| 15 | 3300026121 | Ga0207683_10010913 | Ga0207683_100109135 | 239 |
| 16 | iso_pu_bacteria | 2582581305 | 2585260207 | 241 |
| 17 | iso_pu_bacteria | 2643221541 | 2643730016 | 241 |
| 18 | iso_pu_bacteria | 2643221605 | 2644039801 | 241 |
| 19 | iso_pu_bacteria | 2643221606 | 2644045502 | 241 |
| 20 | iso_pu_bacteria | 2643221671 | 2644392872 | 241 |
| 21 | 3300031727 | Ga0316576_10128314 | Ga0316576_101283143 | 244 |
| 22 | 2209111006 | 2214544925 | 2213593502 | 245 |
| 23 | 3300000041 | ARcpr5oldR_c000010 | ARcpr5oldR_00001015 | 245 |
| 24 | 3300000042 | ARSoilYngRDRAFT_c00060 | ARSoilYngRDRAFT_0006017 | 245 |
| 25 | 3300000043 | ARcpr5yngRDRAFT_c000016 | ARcpr5yngRDRAFT_0000164 | 245 |
| 26 | 3300000044 | ARSoilOldRDRAFT_c000011 | ARSoilOldRDRAFT_00001129 | 245 |
| 27 | 3300000045 | ARCol0oldRDRAFT_c00012 | ARCol0oldRDRAFT_0001212 | 245 |
| 28 | 3300000652 | ARCol0yngRDRAFT_1000018 | ARCol0yngRDRAFT_100001829 | 245 |
| 29 | 3300001430 | JGI24032J14994_100108 | JGI24032J14994_1001084 | 245 |
| 30 | 3300001976 | JGI24752J21851_1001641 | JGI24752J21851_10016412 | 245 |
| 31 | 3300001977 | JGI24746J21847_1000298 | JGI24746J21847_10002982 | 245 |
| 32 | 3300001978 | JGI24747J21853_1000086 | JGI24747J21853_10000864 | 245 |
| 33 | 3300001989 | JGI24739J22299_10000724 | JGI24739J22299_100007244 | 245 |
| 34 | 3300001990 | JGI24737J22298_10001113 | JGI24737J22298_100011135 | 245 |
| 35 | 3300001990 | JGI24737J22298_10006046 | JGI24737J22298_100060465 | 245 |
| 36 | 3300001990 | JGI24737J22298_10027610 | JGI24737J22298_100276102 | 245 |
| 37 | 3300001991 | JGI24743J22301_10003623 | JGI24743J22301_100036232 | 245 |
| 38 | 3300002073 | JGI24745J21846_1000147 | JGI24745J21846_10001473 | 245 |
| 39 | 3300002075 | JGI24738J21930_10000997 | JGI24738J21930_100009977 | 245 |
| 40 | 3300002076 | JGI24749J21850_1000462 | JGI24749J21850_10004626 | 245 |
| 41 | 3300002076 | JGI24749J21850_1001104 | JGI24749J21850_10011043 | 245 |
| 42 | 3300002077 | JGI24744J21845_10000153 | JGI24744J21845_100001534 | 245 |
| 43 | 3300002126 | JGI24035J26624_1000923 | JGI24035J26624_10009233 | 245 |
| 44 | 3300002239 | JGI24034J26672_10000533 | JGI24034J26672_100005332 | 245 |
| 45 | 3300002244 | JGI24742J22300_10000137 | JGI24742J22300_100001379 | 245 |
| 46 | 3300002459 | JGI24751J29686_10000081 | JGI24751J29686_1000008166 | 245 |
| 47 | 3300002459 | JGI24751J29686_10006955 | JGI24751J29686_100069552 | 245 |
| 48 | 3300003187 | JGI25151J46595_10000199 | JGI25151J46595_1000019935 | 245 |
| 49 | 3300003354 | JGI25160J50197_1001785 | JGI25160J50197_100178511 | 245 |
| 50 | 3300005289 | Ga0065704_10106197 | Ga0065704_101061972 | 245 |
| 51 | 3300005290 | Ga0065712_10011139 | Ga0065712_100111392 | 245 |
| 52 | 3300005290 | Ga0065712_10120505 | Ga0065712_101205052 | 245 |
| 53 | 3300005295 | Ga0065707_10096262 | Ga0065707_100962623 | 245 |
| 54 | 3300005295 | Ga0065707_10113486 | Ga0065707_101134862 | 245 |
| 55 | 3300005328 | Ga0070676_10000506 | Ga0070676_1000050613 | 245 |
| 56 | 3300005329 | Ga0070683_100009453 | Ga0070683_1000094538 | 245 |
| 57 | 3300005329 | Ga0070683_100185374 | Ga0070683_1001853742 | 245 |
| 58 | 3300005330 | Ga0070690_100002629 | Ga0070690_1000026293 | 245 |
| 59 | 3300005330 | Ga0070690_100005686 | Ga0070690_1000056865 | 245 |
| 60 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003124 | 245 |
| 61 | 3300005331 | Ga0070670_100000021 | Ga0070670_100000021132 | 245 |
| 62 | 3300005331 | Ga0070670_100004573 | Ga0070670_1000045734 | 245 |
| 63 | 3300005334 | Ga0068869_100001832 | Ga0068869_1000018327 | 245 |
| 64 | 3300005335 | Ga0070666_10025905 | Ga0070666_100259052 | 245 |
| 65 | 3300005335 | Ga0070666_10145779 | Ga0070666_101457792 | 245 |
| 66 | 3300005336 | Ga0070680_100003424 | Ga0070680_1000034246 | 245 |
| 67 | 3300005336 | Ga0070680_100192361 | Ga0070680_1001923612 | 245 |
| 68 | 3300005337 | Ga0070682_100001699 | Ga0070682_1000016996 | 245 |
| 69 | 3300005337 | Ga0070682_100127114 | Ga0070682_1001271141 | 245 |
| 70 | 3300005338 | Ga0068868_100012331 | Ga0068868_1000123312 | 245 |
| 71 | 3300005339 | Ga0070660_100008125 | Ga0070660_1000081256 | 245 |
| 72 | 3300005339 | Ga0070660_100303627 | Ga0070660_1003036271 | 245 |
| 73 | 3300005340 | Ga0070689_100000668 | Ga0070689_1000006688 | 245 |
| 74 | 3300005340 | Ga0070689_100018827 | Ga0070689_1000188272 | 245 |
| 75 | 3300005341 | Ga0070691_10011670 | Ga0070691_100116703 | 245 |
| 76 | 3300005341 | Ga0070691_10126822 | Ga0070691_101268222 | 245 |
| 77 | 3300005343 | Ga0070687_100000527 | Ga0070687_1000005277 | 245 |
| 78 | 3300005343 | Ga0070687_100096954 | Ga0070687_1000969541 | 245 |
| 79 | 3300005344 | Ga0070661_100003238 | Ga0070661_1000032385 | 245 |
| 80 | 3300005345 | Ga0070692_10001083 | Ga0070692_100010837 | 245 |
| 81 | 3300005345 | Ga0070692_10001570 | Ga0070692_100015704 | 245 |
| 82 | 3300005345 | Ga0070692_10014904 | Ga0070692_100149044 | 245 |
| 83 | 3300005347 | Ga0070668_100000055 | Ga0070668_10000005549 | 245 |
| 84 | 3300005347 | Ga0070668_100003117 | Ga0070668_1000031178 | 245 |
| 85 | 3300005347 | Ga0070668_100112166 | Ga0070668_1001121662 | 245 |
| 86 | 3300005353 | Ga0070669_100000044 | Ga0070669_10000004456 | 245 |
| 87 | 3300005353 | Ga0070669_100001315 | Ga0070669_1000013158 | 245 |
| 88 | 3300005353 | Ga0070669_100113249 | Ga0070669_1001132492 | 245 |
| 89 | 3300005354 | Ga0070675_100002954 | Ga0070675_1000029547 | 245 |
| 90 | 3300005354 | Ga0070675_100015172 | Ga0070675_1000151722 | 245 |
| 91 | 3300005354 | Ga0070675_100670546 | Ga0070675_1006705461 | 245 |
| 92 | 3300005355 | Ga0070671_100000894 | Ga0070671_10000089414 | 245 |
| 93 | 3300005355 | Ga0070671_100035414 | Ga0070671_1000354144 | 245 |
| 94 | 3300005356 | Ga0070674_100002968 | Ga0070674_1000029683 | 245 |
| 95 | 3300005356 | Ga0070674_100154060 | Ga0070674_1001540601 | 245 |
| 96 | 3300005364 | Ga0070673_100001477 | Ga0070673_1000014778 | 245 |
| 97 | 3300005365 | Ga0070688_100001239 | Ga0070688_1000012398 | 245 |
| 98 | 3300005365 | Ga0070688_100006198 | Ga0070688_1000061981 | 245 |
| 99 | 3300005366 | Ga0070659_100002622 | Ga0070659_1000026228 | 245 |
| 100 | 3300005366 | Ga0070659_100015463 | Ga0070659_1000154631 | 245 |
| 101 | 3300005366 | Ga0070659_100227739 | Ga0070659_1002277392 | 245 |
| 102 | 3300005367 | Ga0070667_100000122 | Ga0070667_10000012237 | 245 |
| 103 | 3300005367 | Ga0070667_100005188 | Ga0070667_1000051885 | 245 |
| 104 | 3300005367 | Ga0070667_100005584 | Ga0070667_1000055843 | 245 |
| 105 | 3300005367 | Ga0070667_100015151 | Ga0070667_1000151516 | 245 |
| 106 | 3300005367 | Ga0070667_100171642 | Ga0070667_1001716422 | 245 |
| 107 | 3300005406 | Ga0070703_10006319 | Ga0070703_100063194 | 245 |
| 108 | 3300005434 | Ga0070709_10005348 | Ga0070709_100053484 | 245 |
| 109 | 3300005435 | Ga0070714_100017351 | Ga0070714_1000173512 | 245 |
| 110 | 3300005436 | Ga0070713_100015040 | Ga0070713_1000150402 | 245 |
| 111 | 3300005437 | Ga0070710_10045002 | Ga0070710_100450022 | 245 |
| 112 | 3300005438 | Ga0070701_10002283 | Ga0070701_100022833 | 245 |
| 113 | 3300005438 | Ga0070701_10008389 | Ga0070701_100083892 | 245 |
| 114 | 3300005439 | Ga0070711_100011236 | Ga0070711_1000112365 | 245 |
| 115 | 3300005440 | Ga0070705_100001458 | Ga0070705_1000014587 | 245 |
| 116 | 3300005441 | Ga0070700_100001211 | Ga0070700_1000012117 | 245 |
| 117 | 3300005444 | Ga0070694_100001764 | Ga0070694_1000017647 | 245 |
| 118 | 3300005444 | Ga0070694_100155907 | Ga0070694_1001559072 | 245 |
| 119 | 3300005455 | Ga0070663_100000761 | Ga0070663_1000007618 | 245 |
| 120 | 3300005456 | Ga0070678_100000525 | Ga0070678_10000052513 | 245 |
| 121 | 3300005457 | Ga0070662_100002968 | Ga0070662_1000029686 | 245 |
| 122 | 3300005457 | Ga0070662_100050510 | Ga0070662_1000505101 | 245 |
| 123 | 3300005458 | Ga0070681_10004977 | Ga0070681_100049778 | 245 |
| 124 | 3300005458 | Ga0070681_10033528 | Ga0070681_100335283 | 245 |
| 125 | 3300005459 | Ga0068867_100002950 | Ga0068867_1000029509 | 245 |
| 126 | 3300005466 | Ga0070685_10003505 | Ga0070685_100035051 | 245 |
| 127 | 3300005466 | Ga0070685_10229619 | Ga0070685_102296191 | 245 |
| 128 | 3300005467 | Ga0070706_100557410 | Ga0070706_1005574101 | 245 |
| 129 | 3300005518 | Ga0070699_100145636 | Ga0070699_1001456362 | 245 |
| 130 | 3300005530 | Ga0070679_100015045 | Ga0070679_1000150457 | 245 |
| 131 | 3300005530 | Ga0070679_100157125 | Ga0070679_1001571253 | 245 |
| 132 | 3300005535 | Ga0070684_100005941 | Ga0070684_1000059413 | 245 |
| 133 | 3300005539 | Ga0068853_100003070 | Ga0068853_1000030707 | 245 |
| 134 | 3300005539 | Ga0068853_100050832 | Ga0068853_1000508322 | 245 |
| 135 | 3300005543 | Ga0070672_100002960 | Ga0070672_1000029605 | 245 |
| 136 | 3300005543 | Ga0070672_100464894 | Ga0070672_1004648941 | 245 |
| 137 | 3300005544 | Ga0070686_100001573 | Ga0070686_1000015737 | 245 |
| 138 | 3300005544 | Ga0070686_100008797 | Ga0070686_1000087977 | 245 |
| 139 | 3300005545 | Ga0070695_100002369 | Ga0070695_1000023698 | 245 |
| 140 | 3300005545 | Ga0070695_100091328 | Ga0070695_1000913282 | 245 |
| 141 | 3300005546 | Ga0070696_100028599 | Ga0070696_1000285994 | 245 |
| 142 | 3300005547 | Ga0070693_100000880 | Ga0070693_1000008807 | 245 |
| 143 | 3300005547 | Ga0070693_100282566 | Ga0070693_1002825661 | 245 |
| 144 | 3300005548 | Ga0070665_100025279 | Ga0070665_1000252792 | 245 |
| 145 | 3300005549 | Ga0070704_100001917 | Ga0070704_1000019176 | 245 |
| 146 | 3300005563 | Ga0068855_100009051 | Ga0068855_1000090514 | 245 |
| 147 | 3300005563 | Ga0068855_100111759 | Ga0068855_1001117593 | 245 |
| 148 | 3300005564 | Ga0070664_100002934 | Ga0070664_1000029348 | 245 |
| 149 | 3300005564 | Ga0070664_100379526 | Ga0070664_1003795261 | 245 |
| 150 | 3300005577 | Ga0068857_100000358 | Ga0068857_1000003588 | 245 |
| 151 | 3300005577 | Ga0068857_100015287 | Ga0068857_1000152878 | 245 |
| 152 | 3300005577 | Ga0068857_100086207 | Ga0068857_1000862072 | 245 |
| 153 | 3300005577 | Ga0068857_100163221 | Ga0068857_1001632212 | 245 |
| 154 | 3300005578 | Ga0068854_100003080 | Ga0068854_1000030803 | 245 |
| 155 | 3300005614 | Ga0068856_100065216 | Ga0068856_1000652163 | 245 |
| 156 | 3300005614 | Ga0068856_100069199 | Ga0068856_1000691993 | 245 |
| 157 | 3300005615 | Ga0070702_100000526 | Ga0070702_1000005268 | 245 |
| 158 | 3300005616 | Ga0068852_101152709 | Ga0068852_1011527091 | 245 |
| 159 | 3300005617 | Ga0068859_100005591 | Ga0068859_1000055917 | 245 |
| 160 | 3300005617 | Ga0068859_100014466 | Ga0068859_1000144663 | 245 |
| 161 | 3300005617 | Ga0068859_100018845 | Ga0068859_1000188455 | 245 |
| 162 | 3300005617 | Ga0068859_100065369 | Ga0068859_1000653694 | 245 |
| 163 | 3300005617 | Ga0068859_100488010 | Ga0068859_1004880102 | 245 |
| 164 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004224 | 245 |
| 165 | 3300005618 | Ga0068864_100000158 | Ga0068864_10000015868 | 245 |
| 166 | 3300005618 | Ga0068864_100001988 | Ga0068864_10000198810 | 245 |
| 167 | 3300005719 | Ga0068861_100001805 | Ga0068861_1000018058 | 245 |
| 168 | 3300005719 | Ga0068861_100011624 | Ga0068861_1000116241 | 245 |
| 169 | 3300005719 | Ga0068861_100040005 | Ga0068861_1000400053 | 245 |
| 170 | 3300005719 | Ga0068861_100041488 | Ga0068861_1000414882 | 245 |
| 171 | 3300005840 | Ga0068870_10000025 | Ga0068870_1000002521 | 245 |
| 172 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002225 | 245 |
| 173 | 3300005841 | Ga0068863_100000030 | Ga0068863_10000003029 | 245 |
| 174 | 3300005841 | Ga0068863_100002964 | Ga0068863_1000029647 | 245 |
| 175 | 3300005841 | Ga0068863_100057811 | Ga0068863_1000578113 | 245 |
| 176 | 3300005842 | Ga0068858_100003227 | Ga0068858_1000032278 | 245 |
| 177 | 3300005843 | Ga0068860_100000152 | Ga0068860_10000015277 | 245 |
| 178 | 3300005843 | Ga0068860_100007120 | Ga0068860_1000071208 | 245 |
| 179 | 3300005843 | Ga0068860_100055285 | Ga0068860_1000552853 | 245 |
| 180 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001480 | 245 |
| 181 | 3300005844 | Ga0068862_100000002 | Ga0068862_100000002277 | 245 |
| 182 | 3300005844 | Ga0068862_100032289 | Ga0068862_1000322892 | 245 |
| 183 | 3300005937 | Ga0081455_10000276 | Ga0081455_1000027659 | 245 |
| 184 | 3300005937 | Ga0081455_10000545 | Ga0081455_1000054513 | 245 |
| 185 | 3300005981 | Ga0081538_10086861 | Ga0081538_100868612 | 245 |
| 186 | 3300005983 | Ga0081540_1004944 | Ga0081540_10049449 | 245 |
| 187 | 3300006038 | Ga0075365_10047707 | Ga0075365_100477073 | 245 |
| 188 | 3300006058 | Ga0075432_10011268 | Ga0075432_100112684 | 245 |
| 189 | 3300006058 | Ga0075432_10085603 | Ga0075432_100856032 | 245 |
| 190 | 3300006163 | Ga0070715_10000196 | Ga0070715_100001969 | 245 |
| 191 | 3300006178 | Ga0075367_10208140 | Ga0075367_102081402 | 245 |
| 192 | 3300006237 | Ga0097621_100000456 | Ga0097621_10000045615 | 245 |
| 193 | 3300006353 | Ga0075370_10060370 | Ga0075370_100603702 | 245 |
| 194 | 3300006358 | Ga0068871_100000269 | Ga0068871_1000002692 | 245 |
| 195 | 3300006844 | Ga0075428_100136861 | Ga0075428_1001368613 | 245 |
| 196 | 3300006846 | Ga0075430_100243354 | Ga0075430_1002433542 | 245 |
| 197 | 3300006847 | Ga0075431_100030106 | Ga0075431_1000301064 | 245 |
| 198 | 3300006852 | Ga0075433_10021666 | Ga0075433_100216665 | 245 |
| 199 | 3300006871 | Ga0075434_100011399 | Ga0075434_1000113998 | 245 |
| 200 | 3300006881 | Ga0068865_100001731 | Ga0068865_1000017318 | 245 |
| 201 | 3300006881 | Ga0068865_100055301 | Ga0068865_1000553014 | 245 |
| 202 | 3300006914 | Ga0075436_100444135 | Ga0075436_1004441352 | 245 |
| 203 | 3300006931 | Ga0097620_100005590 | Ga0097620_1000055908 | 245 |
| 204 | 3300006931 | Ga0097620_100014466 | Ga0097620_1000144663 | 245 |
| 205 | 3300006931 | Ga0097620_100018845 | Ga0097620_1000188455 | 245 |
| 206 | 3300006931 | Ga0097620_100065370 | Ga0097620_1000653702 | 245 |
| 207 | 3300006931 | Ga0097620_100488013 | Ga0097620_1004880132 | 245 |
| 208 | 3300007076 | Ga0075435_100139121 | Ga0075435_1001391212 | 245 |
| 209 | 3300009011 | Ga0105251_10022538 | Ga0105251_100225383 | 245 |
| 210 | 3300009092 | Ga0105250_10025819 | Ga0105250_100258192 | 245 |
| 211 | 3300009094 | Ga0111539_10003217 | Ga0111539_100032179 | 245 |
| 212 | 3300009094 | Ga0111539_10007321 | Ga0111539_100073218 | 245 |
| 213 | 3300009098 | Ga0105245_10000183 | Ga0105245_1000018340 | 245 |
| 214 | 3300009101 | Ga0105247_10009563 | Ga0105247_100095633 | 245 |
| 215 | 3300009101 | Ga0105247_10076689 | Ga0105247_100766893 | 245 |
| 216 | 3300009101 | Ga0105247_10566023 | Ga0105247_105660231 | 245 |
| 217 | 3300009147 | Ga0114129_10020394 | Ga0114129_100203944 | 245 |
| 218 | 3300009148 | Ga0105243_10001561 | Ga0105243_100015617 | 245 |
| 219 | 3300009148 | Ga0105243_10064823 | Ga0105243_100648232 | 245 |
| 220 | 3300009148 | Ga0105243_10581004 | Ga0105243_105810042 | 245 |
| 221 | 3300009174 | Ga0105241_10003567 | Ga0105241_100035676 | 245 |
| 222 | 3300009176 | Ga0105242_10000701 | Ga0105242_100007017 | 245 |
| 223 | 3300009177 | Ga0105248_10000010 | Ga0105248_10000010120 | 245 |
| 224 | 3300009177 | Ga0105248_10000287 | Ga0105248_100002879 | 245 |
| 225 | 3300009177 | Ga0105248_10010394 | Ga0105248_100103946 | 245 |
| 226 | 3300009177 | Ga0105248_10048525 | Ga0105248_100485253 | 245 |
| 227 | 3300009545 | Ga0105237_10072251 | Ga0105237_100722512 | 245 |
| 228 | 3300009545 | Ga0105237_10248367 | Ga0105237_102483672 | 245 |
| 229 | 3300009551 | Ga0105238_10404069 | Ga0105238_104040692 | 245 |
| 230 | 3300009553 | Ga0105249_10000041 | Ga0105249_10000041192 | 245 |
| 231 | 3300009553 | Ga0105249_10007674 | Ga0105249_100076742 | 245 |
| 232 | 3300009553 | Ga0105249_10009795 | Ga0105249_100097952 | 245 |
| 233 | 3300009553 | Ga0105249_10037419 | Ga0105249_100374195 | 245 |
| 234 | 3300009553 | Ga0105249_10157328 | Ga0105249_101573282 | 245 |
| 235 | 3300009553 | Ga0105249_10499013 | Ga0105249_104990132 | 245 |
| 236 | 3300010375 | Ga0105239_10170015 | Ga0105239_101700152 | 245 |
| 237 | 3300011119 | Ga0105246_10002447 | Ga0105246_100024475 | 245 |
| 238 | 3300012483 | Ga0157337_1000504 | Ga0157337_10005042 | 245 |
| 239 | 3300012507 | Ga0157342_1001861 | Ga0157342_10018612 | 245 |
| 240 | 3300012513 | Ga0157326_1000433 | Ga0157326_10004333 | 245 |
| 241 | 3300013102 | Ga0157371_10018807 | Ga0157371_100188074 | 245 |
| 242 | 3300013105 | Ga0157369_10631810 | Ga0157369_106318102 | 245 |
| 243 | 3300013296 | Ga0157374_10000463 | Ga0157374_1000046311 | 245 |
| 244 | 3300013297 | Ga0157378_10000613 | Ga0157378_100006137 | 245 |
| 245 | 3300013297 | Ga0157378_10078681 | Ga0157378_100786814 | 245 |
| 246 | 3300013306 | Ga0163162_10020966 | Ga0163162_100209664 | 245 |
| 247 | 3300013306 | Ga0163162_10514426 | Ga0163162_105144262 | 245 |
| 248 | 3300013307 | Ga0157372_10010921 | Ga0157372_100109215 | 245 |
| 249 | 3300013307 | Ga0157372_10458495 | Ga0157372_104584952 | 245 |
| 250 | 3300013308 | Ga0157375_10004786 | Ga0157375_100047866 | 245 |
| 251 | 3300013308 | Ga0157375_10639127 | Ga0157375_106391271 | 245 |
| 252 | 3300014325 | Ga0163163_10201970 | Ga0163163_102019702 | 245 |
| 253 | 3300014326 | Ga0157380_10004641 | Ga0157380_100046416 | 245 |
| 254 | 3300014326 | Ga0157380_10164250 | Ga0157380_101642502 | 245 |
| 255 | 3300014497 | Ga0182008_10151350 | Ga0182008_101513502 | 245 |
| 256 | 3300014968 | Ga0157379_10003902 | Ga0157379_100039027 | 245 |
| 257 | 3300014968 | Ga0157379_10146649 | Ga0157379_101466493 | 245 |
| 258 | 3300014969 | Ga0157376_10003730 | Ga0157376_100037306 | 245 |
| 259 | 3300020082 | Ga0206353_11997182 | Ga0206353_1199718214 | 245 |
| 260 | 3300021388 | Ga0213875_10004900 | Ga0213875_100049002 | 245 |
| 261 | 3300025271 | Ga0207666_1000140 | Ga0207666_10001407 | 245 |
| 262 | 3300025284 | Ga0209130_1000749 | Ga0209130_100074928 | 245 |
| 263 | 3300025290 | Ga0207673_1000039 | Ga0207673_10000393 | 245 |
| 264 | 3300025294 | Ga0209025_1000847 | Ga0209025_10008474 | 245 |
| 265 | 3300025297 | Ga0209758_1002804 | Ga0209758_100280415 | 245 |
| 266 | 3300025302 | Ga0207426_1000616 | Ga0207426_100061612 | 245 |
| 267 | 3300025315 | Ga0207697_10000763 | Ga0207697_1000076316 | 245 |
| 268 | 3300025711 | Ga0207696_1022621 | Ga0207696_10226211 | 245 |
| 269 | 3300025735 | Ga0207713_1019929 | Ga0207713_10199293 | 245 |
| 270 | 3300025885 | Ga0207653_10001778 | Ga0207653_100017787 | 245 |
| 271 | 3300025898 | Ga0207692_10056041 | Ga0207692_100560412 | 245 |
| 272 | 3300025900 | Ga0207710_10004068 | Ga0207710_100040687 | 245 |
| 273 | 3300025901 | Ga0207688_10001992 | Ga0207688_100019928 | 245 |
| 274 | 3300025901 | Ga0207688_10086237 | Ga0207688_100862372 | 245 |
| 275 | 3300025903 | Ga0207680_10028054 | Ga0207680_100280544 | 245 |
| 276 | 3300025903 | Ga0207680_10127284 | Ga0207680_101272842 | 245 |
| 277 | 3300025903 | Ga0207680_10135703 | Ga0207680_101357032 | 245 |
| 278 | 3300025904 | Ga0207647_10003504 | Ga0207647_100035048 | 245 |
| 279 | 3300025905 | Ga0207685_10106615 | Ga0207685_101066152 | 245 |
| 280 | 3300025906 | Ga0207699_10048618 | Ga0207699_100486183 | 245 |
| 281 | 3300025907 | Ga0207645_10000248 | Ga0207645_100002486 | 245 |
| 282 | 3300025908 | Ga0207643_10000064 | Ga0207643_1000006459 | 245 |
| 283 | 3300025909 | Ga0207705_10143274 | Ga0207705_101432743 | 245 |
| 284 | 3300025911 | Ga0207654_10001623 | Ga0207654_100016236 | 245 |
| 285 | 3300025912 | Ga0207707_10002084 | Ga0207707_100020843 | 245 |
| 286 | 3300025912 | Ga0207707_10523957 | Ga0207707_105239572 | 245 |
| 287 | 3300025914 | Ga0207671_10007347 | Ga0207671_100073478 | 245 |
| 288 | 3300025914 | Ga0207671_10016982 | Ga0207671_100169827 | 245 |
| 289 | 3300025915 | Ga0207693_10031950 | Ga0207693_100319504 | 245 |
| 290 | 3300025917 | Ga0207660_10000194 | Ga0207660_1000019434 | 245 |
| 291 | 3300025918 | Ga0207662_10001637 | Ga0207662_100016378 | 245 |
| 292 | 3300025918 | Ga0207662_10062873 | Ga0207662_100628733 | 245 |
| 293 | 3300025919 | Ga0207657_10006919 | Ga0207657_100069198 | 245 |
| 294 | 3300025919 | Ga0207657_10424603 | Ga0207657_104246031 | 245 |
| 295 | 3300025920 | Ga0207649_10000234 | Ga0207649_1000023411 | 245 |
| 296 | 3300025920 | Ga0207649_10072825 | Ga0207649_100728253 | 245 |
| 297 | 3300025921 | Ga0207652_10001613 | Ga0207652_1000161317 | 245 |
| 298 | 3300025923 | Ga0207681_10000041 | Ga0207681_1000004175 | 245 |
| 299 | 3300025923 | Ga0207681_10000794 | Ga0207681_100007947 | 245 |
| 300 | 3300025923 | Ga0207681_10061762 | Ga0207681_100617622 | 245 |
| 301 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004121 | 245 |
| 302 | 3300025925 | Ga0207650_10000298 | Ga0207650_1000029812 | 245 |
| 303 | 3300025925 | Ga0207650_10010580 | Ga0207650_100105806 | 245 |
| 304 | 3300025926 | Ga0207659_10000172 | Ga0207659_1000017211 | 245 |
| 305 | 3300025926 | Ga0207659_10396630 | Ga0207659_103966302 | 245 |
| 306 | 3300025927 | Ga0207687_10008699 | Ga0207687_100086994 | 245 |
| 307 | 3300025928 | Ga0207700_10006617 | Ga0207700_100066175 | 245 |
| 308 | 3300025929 | Ga0207664_10078623 | Ga0207664_100786232 | 245 |
| 309 | 3300025931 | Ga0207644_10000169 | Ga0207644_1000016936 | 245 |
| 310 | 3300025931 | Ga0207644_10000439 | Ga0207644_100004398 | 245 |
| 311 | 3300025932 | Ga0207690_10000796 | Ga0207690_100007967 | 245 |
| 312 | 3300025932 | Ga0207690_10056673 | Ga0207690_100566733 | 245 |
| 313 | 3300025933 | Ga0207706_10005059 | Ga0207706_100050596 | 245 |
| 314 | 3300025934 | Ga0207686_10001093 | Ga0207686_100010936 | 245 |
| 315 | 3300025935 | Ga0207709_10001438 | Ga0207709_100014387 | 245 |
| 316 | 3300025935 | Ga0207709_10012223 | Ga0207709_100122235 | 245 |
| 317 | 3300025936 | Ga0207670_10000807 | Ga0207670_1000080713 | 245 |
| 318 | 3300025936 | Ga0207670_10131498 | Ga0207670_101314981 | 245 |
| 319 | 3300025937 | Ga0207669_10000141 | Ga0207669_1000014130 | 245 |
| 320 | 3300025937 | Ga0207669_10303083 | Ga0207669_103030831 | 245 |
| 321 | 3300025938 | Ga0207704_10000755 | Ga0207704_1000075512 | 245 |
| 322 | 3300025939 | Ga0207665_10002433 | Ga0207665_100024338 | 245 |
| 323 | 3300025940 | Ga0207691_10006997 | Ga0207691_100069978 | 245 |
| 324 | 3300025940 | Ga0207691_10210058 | Ga0207691_102100582 | 245 |
| 325 | 3300025941 | Ga0207711_10000038 | Ga0207711_10000038119 | 245 |
| 326 | 3300025941 | Ga0207711_10000658 | Ga0207711_1000065826 | 245 |
| 327 | 3300025941 | Ga0207711_10006747 | Ga0207711_100067476 | 245 |
| 328 | 3300025941 | Ga0207711_10035665 | Ga0207711_100356652 | 245 |
| 329 | 3300025942 | Ga0207689_10456732 | Ga0207689_104567322 | 245 |
| 330 | 3300025944 | Ga0207661_10000098 | Ga0207661_1000009813 | 245 |
| 331 | 3300025944 | Ga0207661_10138465 | Ga0207661_101384652 | 245 |
| 332 | 3300025945 | Ga0207679_10000174 | Ga0207679_1000017414 | 245 |
| 333 | 3300025945 | Ga0207679_10097786 | Ga0207679_100977862 | 245 |
| 334 | 3300025945 | Ga0207679_10680521 | Ga0207679_106805211 | 245 |
| 335 | 3300025949 | Ga0207667_10004743 | Ga0207667_100047433 | 245 |
| 336 | 3300025949 | Ga0207667_10207178 | Ga0207667_102071783 | 245 |
| 337 | 3300025960 | Ga0207651_10000782 | Ga0207651_100007828 | 245 |
| 338 | 3300025961 | Ga0207712_10000659 | Ga0207712_100006598 | 245 |
| 339 | 3300025961 | Ga0207712_10005928 | Ga0207712_100059286 | 245 |
| 340 | 3300025972 | Ga0207668_10001107 | Ga0207668_100011076 | 245 |
| 341 | 3300025972 | Ga0207668_10002109 | Ga0207668_100021093 | 245 |
| 342 | 3300025972 | Ga0207668_10012828 | Ga0207668_100128282 | 245 |
| 343 | 3300025981 | Ga0207640_10000846 | Ga0207640_100008466 | 245 |
| 344 | 3300025981 | Ga0207640_10035208 | Ga0207640_100352082 | 245 |
| 345 | 3300025986 | Ga0207658_10000092 | Ga0207658_1000009266 | 245 |
| 346 | 3300025986 | Ga0207658_10000474 | Ga0207658_100004745 | 245 |
| 347 | 3300025986 | Ga0207658_10001843 | Ga0207658_1000184314 | 245 |
| 348 | 3300025986 | Ga0207658_10003847 | Ga0207658_100038473 | 245 |
| 349 | 3300025986 | Ga0207658_10199433 | Ga0207658_101994332 | 245 |
| 350 | 3300026023 | Ga0207677_10144090 | Ga0207677_101440902 | 245 |
| 351 | 3300026035 | Ga0207703_10002433 | Ga0207703_100024338 | 245 |
| 352 | 3300026041 | Ga0207639_10017221 | Ga0207639_100172215 | 245 |
| 353 | 3300026041 | Ga0207639_10361416 | Ga0207639_103614161 | 245 |
| 354 | 3300026067 | Ga0207678_10001059 | Ga0207678_100010598 | 245 |
| 355 | 3300026075 | Ga0207708_10002793 | Ga0207708_100027938 | 245 |
| 356 | 3300026078 | Ga0207702_10014464 | Ga0207702_100144645 | 245 |
| 357 | 3300026078 | Ga0207702_10067037 | Ga0207702_100670373 | 245 |
| 358 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001254 | 245 |
| 359 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002705 | 245 |
| 360 | 3300026088 | Ga0207641_10000622 | Ga0207641_1000062211 | 245 |
| 361 | 3300026088 | Ga0207641_10009974 | Ga0207641_100099742 | 245 |
| 362 | 3300026088 | Ga0207641_10135165 | Ga0207641_101351652 | 245 |
| 363 | 3300026089 | Ga0207648_10009300 | Ga0207648_100093008 | 245 |
| 364 | 3300026095 | Ga0207676_10000005 | Ga0207676_10000005102 | 245 |
| 365 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006589 | 245 |
| 366 | 3300026095 | Ga0207676_10002696 | Ga0207676_100026969 | 245 |
| 367 | 3300026116 | Ga0207674_10001342 | Ga0207674_100013428 | 245 |
| 368 | 3300026116 | Ga0207674_10021817 | Ga0207674_100218173 | 245 |
| 369 | 3300026116 | Ga0207674_10036947 | Ga0207674_100369475 | 245 |
| 370 | 3300026116 | Ga0207674_10175278 | Ga0207674_101752783 | 245 |
| 371 | 3300026118 | Ga0207675_100000309 | Ga0207675_10000030953 | 245 |
| 372 | 3300026118 | Ga0207675_100006706 | Ga0207675_1000067065 | 245 |
| 373 | 3300026118 | Ga0207675_100011711 | Ga0207675_1000117112 | 245 |
| 374 | 3300026118 | Ga0207675_100489763 | Ga0207675_1004897632 | 245 |
| 375 | 3300026121 | Ga0207683_10001193 | Ga0207683_1000119318 | 245 |
| 376 | 3300027252 | Ga0209973_1003691 | Ga0209973_10036912 | 245 |
| 377 | 3300027552 | Ga0209982_1015579 | Ga0209982_10155792 | 245 |
| 378 | 3300027682 | Ga0209971_1015247 | Ga0209971_10152472 | 245 |
| 379 | 3300027695 | Ga0209966_1001072 | Ga0209966_10010725 | 245 |
| 380 | 3300027695 | Ga0209966_1002975 | Ga0209966_10029753 | 245 |
| 381 | 3300027717 | Ga0209998_10001333 | Ga0209998_100013335 | 245 |
| 382 | 3300027717 | Ga0209998_10001362 | Ga0209998_100013625 | 245 |
| 383 | 3300027876 | Ga0209974_10014808 | Ga0209974_100148082 | 245 |
| 384 | 3300027876 | Ga0209974_10020958 | Ga0209974_100209582 | 245 |
| 385 | 3300027907 | Ga0207428_10000513 | Ga0207428_1000051340 | 245 |
| 386 | 3300027907 | Ga0207428_10000626 | Ga0207428_1000062625 | 245 |
| 387 | 3300028379 | Ga0268266_10305765 | Ga0268266_103057652 | 245 |
| 388 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001556 | 245 |
| 389 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003284 | 245 |
| 390 | 3300028380 | Ga0268265_10002370 | Ga0268265_1000237012 | 245 |
| 391 | 3300028380 | Ga0268265_10014719 | Ga0268265_100147192 | 245 |
| 392 | 3300028381 | Ga0268264_10000111 | Ga0268264_1000011162 | 245 |
| 393 | 3300028381 | Ga0268264_10004444 | Ga0268264_100044448 | 245 |
| 394 | 3300028381 | Ga0268264_10276778 | Ga0268264_102767782 | 245 |
| 395 | 3300031731 | Ga0307405_10542773 | Ga0307405_105427732 | 245 |
| 396 | 3300031901 | Ga0307406_10018812 | Ga0307406_100188123 | 245 |
| 397 | 3300031901 | Ga0307406_10145223 | Ga0307406_101452232 | 245 |
| 398 | 3300031911 | Ga0307412_10001980 | Ga0307412_1000198013 | 245 |
| 399 | 3300031911 | Ga0307412_10015841 | Ga0307412_100158412 | 245 |
| 400 | 3300031911 | Ga0307412_10043249 | Ga0307412_100432493 | 245 |
| 401 | 3300032002 | Ga0307416_100191670 | Ga0307416_1001916702 | 245 |
| 402 | 3300032133 | Ga0316583_10079080 | Ga0316583_100790801 | 245 |
| 403 | 3300033180 | Ga0307510_10119715 | Ga0307510_101197152 | 245 |
| 404 | 3300034816 | Ga0373930_0004579 | Ga0373930_0004579_516_1253 | 245 |
| 405 | 3300034817 | Ga0373948_0000049 | Ga0373948_0000049_8717_9454 | 245 |
| 406 | 3300034817 | Ga0373948_0010541 | Ga0373948_0010541_752_1489 | 245 |
| 407 | 3300034818 | Ga0373950_0000665 | Ga0373950_0000665_195_932 | 245 |
| 408 | 3300034819 | Ga0373958_0000026 | Ga0373958_0000026_14662_15399 | 245 |
| 409 | 3300034819 | Ga0373958_0000135 | Ga0373958_0000135_4092_4829 | 245 |
| 410 | 3300034820 | Ga0373959_0001171 | Ga0373959_0001171_3312_4049 | 245 |
| 411 | 3300034820 | Ga0373959_0002832 | Ga0373959_0002832_895_1632 | 245 |
| 412 | 3300034957 | Ga0373938_0000133 | Ga0373938_0000133_8248_8985 | 245 |
| 413 | 3300035084 | Ga0373928_0007183 | Ga0373928_0007183_718_1455 | 245 |
| 414 | 3300035085 | Ga0373929_0000110 | Ga0373929_0000110_12655_13392 | 245 |
| 415 | 3300035085 | Ga0373929_0004350 | Ga0373929_0004350_667_1404 | 245 |
| 416 | 3300035088 | Ga0373940_0002247 | Ga0373940_0002247_297_1034 | 245 |
| 417 | 3300035088 | Ga0373940_0006899 | Ga0373940_0006899_314_1051 | 245 |
| 418 | 3300035090 | Ga0373949_0000771 | Ga0373949_0000771_8029_8766 | 245 |
| 419 | 3300035090 | Ga0373949_0001010 | Ga0373949_0001010_930_1667 | 245 |
| 420 | 3300035091 | Ga0373951_0003615 | Ga0373951_0003615_2372_3109 | 245 |
| 421 | 3300035092 | Ga0373952_0000200 | Ga0373952_0000200_7029_7766 | 245 |
| 422 | 3300035112 | Ga0373932_0000822 | Ga0373932_0000822_4953_5690 | 245 |
| 423 | 3300035112 | Ga0373932_0001180 | Ga0373932_0001180_3321_4058 | 245 |
| 424 | 3300035114 | Ga0373939_0003897 | Ga0373939_0003897_1232_1969 | 245 |
| 425 | 3300035115 | Ga0373941_0000259 | Ga0373941_0000259_5062_5799 | 245 |
| 426 | 3300035121 | Ga0373960_0000277 | Ga0373960_0000277_3793_4530 | 245 |
| 427 | 3300035121 | Ga0373960_0001175 | Ga0373960_0001175_212_949 | 245 |
| 428 | 3300035207 | Ga0373942_0029123 | Ga0373942_0029123_252_989 | 245 |
| 429 | 3300035241 | Ga0373961_0001383 | Ga0373961_0001383_1710_2447 | 245 |
| 430 | 3300035241 | Ga0373961_0001598 | Ga0373961_0001598_681_1418 | 245 |
| 431 | 3300035242 | Ga0373962_0000275 | Ga0373962_0000275_7014_7751 | 245 |
| 432 | 3300035691 | Ga0373931_0002417 | Ga0373931_0002417_7029_7766 | 245 |
| 433 | 3300035691 | Ga0373931_0007842 | Ga0373931_0007842_3287_4024 | 245 |
| 434 | 3300035691 | Ga0373931_0032643 | Ga0373931_0032643_24_764 | 245 |
| 435 | 3300035695 | Ga0373927_0197669 | Ga0373927_0197669_125_868 | 245 |
| 436 | 3300035724 | Ga0373933_0130460 | Ga0373933_0130460_184_921 | 245 |
| 437 | 3300036647 | Ga0316582_0108359 | Ga0316582_0108359_921_1658 | 245 |
| 438 | 3300037312 | Ga0395899_0218369 | Ga0395899_0218369_473_1261 | 245 |
| 439 | 3300037418 | Ga0395900_0002906 | Ga0395900_0002906_13038_13826 | 245 |
| 440 | 3300037466 | Ga0395898_0125357 | Ga0395898_0125357_1420_2208 | 245 |
| 441 | 3300037853 | Ga0436364_1309894 | Ga0436364_1309894_5251_5994 | 245 |
| 442 | 3300038443 | Ga0395901_0006644 | Ga0395901_0006644_8379_9167 | 245 |
| 443 | 3300038443 | Ga0395901_0190413 | Ga0395901_0190413_1322_2062 | 245 |
| 444 | 3300038996 | Ga0242420_016335 | Ga0242420_016335_34_771 | 245 |
| 445 | 3300041462 | Ga0451806_525822 | Ga0451806_525822_112_870 | 245 |
| 446 | 3300042016 | Ga0439463_026003 | Ga0439463_026003_199_936 | 245 |
| 447 | 3300042146 | Ga0450907_005098 | Ga0450907_005098_1044_1907 | 245 |
| 448 | 3300042437 | Ga0439444_0022357 | Ga0439444_0022357_166_903 | 245 |
| 449 | 3300042439 | Ga0439464_0011060 | Ga0439464_0011060_446_1183 | 245 |
| 450 | 3300044659 | Ga0466973_0110359 | Ga0466973_0110359_724_1488 | 245 |
| 451 | 3300045051 | Ga0451576_0013587 | Ga0451576_0013587_8214_8951 | 245 |
| 452 | 3300046525 | Ga0495663_0035443 | Ga0495663_0035443_132_896 | 245 |
| 453 | 3300046530 | Ga0495654_0008624 | Ga0495654_0008624_4617_5381 | 245 |
| 454 | 3300046530 | Ga0495654_0034158 | Ga0495654_0034158_998_1762 | 245 |
| 455 | 3300046542 | Ga0495597_0010903 | Ga0495597_0010903_2381_3124 | 245 |
| 456 | 3300046558 | Ga0495633_0187535 | Ga0495633_0187535_11_754 | 245 |
| 457 | 3300046616 | Ga0495668_0012118 | Ga0495668_0012118_1151_1915 | 245 |
| 458 | 3300046616 | Ga0495668_0029780 | Ga0495668_0029780_542_1285 | 245 |
| 459 | 3300046684 | Ga0495669_0194113 | Ga0495669_0194113_211_948 | 245 |
| 460 | 3300047445 | Ga0495677_0021568 | Ga0495677_0021568_729_1466 | 245 |
| 461 | 3300047472 | Ga0495686_0017645 | Ga0495686_0017645_2802_3539 | 245 |
| 462 | 3300047472 | Ga0495686_0022875 | Ga0495686_0022875_780_1517 | 245 |
| 463 | 3300047472 | Ga0495686_0118679 | Ga0495686_0118679_80_817 | 245 |
| 464 | 3300048903 | Ga0496100_0000447 | Ga0496100_0000447_15437_16174 | 245 |
| 465 | 3300048904 | Ga0496101_0001349 | Ga0496101_0001349_11638_12375 | 245 |
| 466 | 3300048904 | Ga0496101_0557092 | Ga0496101_0557092_106_876 | 245 |
| 467 | 3300048905 | Ga0496102_0002263 | Ga0496102_0002263_5884_6627 | 245 |
| 468 | 3300048905 | Ga0496102_0002354 | Ga0496102_0002354_11638_12375 | 245 |
| 469 | 3300048905 | Ga0496102_0344120 | Ga0496102_0344120_494_1231 | 245 |
| 470 | 3300048906 | Ga0496103_0000837 | Ga0496103_0000837_17467_18204 | 245 |
| 471 | 3300048906 | Ga0496103_0001362 | Ga0496103_0001362_5868_6611 | 245 |
| 472 | 3300048909 | Ga0496106_0001351 | Ga0496106_0001351_6249_6986 | 245 |
| 473 | 3300048909 | Ga0496106_0150742 | Ga0496106_0150742_555_1295 | 245 |
| 474 | 3300048910 | Ga0496107_0001211 | Ga0496107_0001211_4250_4987 | 245 |
| 475 | 3300048910 | Ga0496107_0154644 | Ga0496107_0154644_625_1365 | 245 |
| 476 | 3300048910 | Ga0496107_0246573 | Ga0496107_0246573_469_1206 | 245 |
| 477 | 3300048912 | Ga0496109_0005044 | Ga0496109_0005044_3877_4614 | 245 |
| 478 | 3300048913 | Ga0496110_0030428 | Ga0496110_0030428_3047_3784 | 245 |
| 479 | 3300048913 | Ga0496110_0030903 | Ga0496110_0030903_3741_4478 | 245 |
| 480 | 3300048914 | Ga0496111_0060526 | Ga0496111_0060526_400_1137 | 245 |
| 481 | 3300048916 | Ga0496113_0192565 | Ga0496113_0192565_669_1406 | 245 |
| 482 | 3300048917 | Ga0496114_0001734 | Ga0496114_0001734_11287_12024 | 245 |
| 483 | 3300048918 | Ga0496115_0000592 | Ga0496115_0000592_11175_11912 | 245 |
| 484 | 3300048919 | Ga0496116_0003256 | Ga0496116_0003256_5584_6327 | 245 |
| 485 | 3300048920 | Ga0496117_0004043 | Ga0496117_0004043_9863_10606 | 245 |
| 486 | 3300048920 | Ga0496117_0004127 | Ga0496117_0004127_10767_11537 | 245 |
| 487 | 3300048921 | Ga0496118_0000463 | Ga0496118_0000463_2596_3366 | 245 |
| 488 | 3300048921 | Ga0496118_0004497 | Ga0496118_0004497_9863_10606 | 245 |
| 489 | 3300048922 | Ga0496119_0164339 | Ga0496119_0164339_265_1008 | 245 |
| 490 | 3300048922 | Ga0496119_0164696 | Ga0496119_0164696_135_878 | 245 |
| 491 | 3300048923 | Ga0496120_0131593 | Ga0496120_0131593_202_945 | 245 |
| 492 | 3300048927 | Ga0496124_0004389 | Ga0496124_0004389_5884_6627 | 245 |
| 493 | 3300048927 | Ga0496124_0072061 | Ga0496124_0072061_418_1173 | 245 |
| 494 | 3300048929 | Ga0496126_0110561 | Ga0496126_0110561_1529_2272 | 245 |
| 495 | 3300049513 | Ga0501290_000038 | Ga0501290_000038_12690_13427 | 245 |
| 496 | 3300049515 | Ga0501292_000038 | Ga0501292_000038_26759_27496 | 245 |
| 497 | 3300049517 | Ga0501294_000225 | Ga0501294_000225_497_1234 | 245 |
| 498 | 3300049569 | Ga0501032_0015359 | Ga0501032_0015359_4334_5098 | 245 |
| 499 | 3300049571 | Ga0501034_0097580 | Ga0501034_0097580_352_1089 | 245 |
| 500 | 3300049574 | Ga0501038_0020281 | Ga0501038_0020281_1696_2433 | 245 |
| 501 | 3300049575 | Ga0501039_0227957 | Ga0501039_0227957_420_1157 | 245 |
| 502 | 3300049577 | Ga0501041_0231945 | Ga0501041_0231945_144_884 | 245 |
| 503 | 3300049579 | Ga0501043_0010164 | Ga0501043_0010164_5101_5865 | 245 |
| 504 | 3300049579 | Ga0501043_0150354 | Ga0501043_0150354_308_1045 | 245 |
| 505 | 3300049581 | Ga0501047_0000876 | Ga0501047_0000876_11487_12251 | 245 |
| 506 | 3300049584 | Ga0501068_0219173 | Ga0501068_0219173_404_1141 | 245 |
| 507 | 3300049586 | Ga0501070_0264359 | Ga0501070_0264359_175_939 | 245 |
| 508 | 3300049588 | Ga0501072_0392571 | Ga0501072_0392571_20_757 | 245 |
| 509 | 3300049591 | Ga0501075_0233841 | Ga0501075_0233841_178_918 | 245 |
| 510 | 3300049591 | Ga0501075_0317299 | Ga0501075_0317299_364_1104 | 245 |
| 511 | 3300049592 | Ga0501076_0098870 | Ga0501076_0098870_431_1171 | 245 |
| 512 | 3300049593 | Ga0501077_0033324 | Ga0501077_0033324_1268_2005 | 245 |
| 513 | 3300049593 | Ga0501077_0185458 | Ga0501077_0185458_358_1098 | 245 |
| 514 | 3300049652 | Ga0501202_031880 | Ga0501202_031880_103_840 | 245 |
| 515 | 3300049653 | Ga0501206_001289 | Ga0501206_001289_1685_2422 | 245 |
| 516 | 3300049663 | Ga0501223_002886 | Ga0501223_002886_481_1218 | 245 |
| 517 | 3300049664 | Ga0501224_003519 | Ga0501224_003519_928_1665 | 245 |
| 518 | 3300049669 | Ga0501235_009139 | Ga0501235_009139_1338_2075 | 245 |
| 519 | 3300049679 | Ga0501249_000464 | Ga0501249_000464_8501_9259 | 245 |
| 520 | 3300049688 | Ga0501259_004554 | Ga0501259_004554_588_1325 | 245 |
| 521 | 3300049690 | Ga0501261_000037 | Ga0501261_000037_1422_2159 | 245 |
| 522 | 3300049741 | Ga0501079_0102332 | Ga0501079_0102332_282_1022 | 245 |
| 523 | 3300049742 | Ga0501080_0068719 | Ga0501080_0068719_1881_2618 | 245 |
| 524 | 3300049743 | Ga0501081_0382498 | Ga0501081_0382498_288_1025 | 245 |
| 525 | 3300049775 | Ga0501279_000016 | Ga0501279_000016_2732_3469 | 245 |
| 526 | 3300049776 | Ga0501280_000059 | Ga0501280_000059_26634_27371 | 245 |
| 527 | 3300049777 | Ga0501281_00345 | Ga0501281_00345_2728_3465 | 245 |
| 528 | 3300049778 | Ga0501282_000110 | Ga0501282_000110_6056_6793 | 245 |
| 529 | 3300049823 | Ga0501044_0240007 | Ga0501044_0240007_956_1693 | 245 |
| 530 | 3300049823 | Ga0501044_0384362 | Ga0501044_0384362_129_893 | 245 |
| 531 | 3300049824 | Ga0501045_0177761 | Ga0501045_0177761_186_929 | 245 |
| 532 | 3300050494 | nmdc:mga06z11_73418_c1 | nmdc:mga06z11_73418_c1_727_1464 | 245 |
| 533 | 3300050508 | nmdc:mga09592_281149_c1 | nmdc:mga09592_281149_c1_582_1322 | 245 |
| 534 | 3300050509 | nmdc:mga0qj67_286469_c1 | nmdc:mga0qj67_286469_c1_111_851 | 245 |
| 535 | 3300050510 | nmdc:mga06r32_114169_c1 | nmdc:mga06r32_114169_c1_196_936 | 245 |
| 536 | 3300050511 | nmdc:mga08y16_7407_c1 | nmdc:mga08y16_7407_c1_3437_4174 | 245 |
| 537 | 3300050511 | nmdc:mga08y16_8959_c1 | nmdc:mga08y16_8959_c1_6237_6974 | 245 |
| 538 | 3300050512 | nmdc:mga0n895_298486_c1 | nmdc:mga0n895_298486_c1_497_1237 | 245 |
| 539 | 3300050512 | nmdc:mga0n895_3698_c1 | nmdc:mga0n895_3698_c1_4601_5338 | 245 |
| 540 | 3300050513 | nmdc:mga0rr50_227667_c1 | nmdc:mga0rr50_227667_c1_591_1331 | 245 |
| 541 | 3300050513 | nmdc:mga0rr50_390810_c1 | nmdc:mga0rr50_390810_c1_31_768 | 245 |
| 542 | 3300050513 | nmdc:mga0rr50_401477_c1 | nmdc:mga0rr50_401477_c1_315_1055 | 245 |
| 543 | 3300050515 | nmdc:mga0a205_1633_c1 | nmdc:mga0a205_1633_c1_15333_16070 | 245 |
| 544 | 3300050515 | nmdc:mga0a205_94603_c1 | nmdc:mga0a205_94603_c1_1615_2355 | 245 |
| 545 | 3300053085 | Ga0495619_0195583 | Ga0495619_0195583_645_1385 | 245 |
| 546 | 3300053087 | Ga0500643_000115 | Ga0500643_000115_59056_59796 | 245 |
| 547 | 3300053087 | Ga0500643_000326 | Ga0500643_000326_4773_5516 | 245 |
| 548 | 3300053087 | Ga0500643_001868 | Ga0500643_001868_9606_10349 | 245 |
| 549 | 3300053087 | Ga0500643_083140 | Ga0500643_083140_83_868 | 245 |
| 550 | 3300053091 | Ga0500647_0032167 | Ga0500647_0032167_1539_2282 | 245 |
| 551 | 3300053093 | Ga0500651_0002180 | Ga0500651_0002180_5704_6447 | 245 |
| 552 | 3300053116 | Ga0500592_000019 | Ga0500592_000019_1912_2649 | 245 |
| 553 | 3300053133 | Ga0500655_000162 | Ga0500655_000162_3351_4094 | 245 |
| 554 | 3300053142 | Ga0500577_0027326 | Ga0500577_0027326_777_1514 | 245 |
| 555 | 3300053148 | Ga0500590_000967 | Ga0500590_000967_2941_3684 | 245 |
| 556 | 3300053156 | Ga0500622_0006224 | Ga0500622_0006224_3120_3863 | 245 |
| 557 | 3300053158 | Ga0500627_0000211 | Ga0500627_0000211_11474_12238 | 245 |
| 558 | 3300053158 | Ga0500627_0003527 | Ga0500627_0003527_3009_3746 | 245 |
| 559 | 3300053158 | Ga0500627_0036531 | Ga0500627_0036531_990_1754 | 245 |
| 560 | 3300053158 | Ga0500627_0052392 | Ga0500627_0052392_918_1655 | 245 |
| 561 | 3300053724 | Ga0500570_000414 | Ga0500570_000414_14950_15693 | 245 |
| 562 | 3300054114 | Ga0501084_0030992 | Ga0501084_0030992_1502_2242 | 245 |
| 563 | 3300054114 | Ga0501084_0120232 | Ga0501084_0120232_167_907 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nr0-assembly1.cif.gz_B | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9682 | 2 | 245 |
| 2nre-assembly1.cif.gz_A-2 | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9613 | 2 | 245 |
| 2nr0-assembly1.cif.gz_B | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9566 | 2 | 245 |
| 2nre-assembly1.cif.gz_A-2 | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9308 | 2 | 245 |
| 1vs3-assembly1.cif.gz_B | crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 | 0.9237 | 1 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nqpB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9642 | 2 | 106 | 3.30.70.580 |
| af_Q2FW37_106_241_3.30.70.660 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain | 0.9608 | 109 | 242 | 3.30.70.660 |
| 2nreA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain | 0.9574 | 108 | 244 | 3.30.70.660 |
| af_Q2FW37_1_104_3.30.70.580 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9548 | 3 | 105 | 3.30.70.580 |
| af_A0A0R0F7R0_40_148_3.30.70.580 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9506 | 1 | 106 | 3.30.70.580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T9B1G9-F1-model_v4 | deleted | 0.9915 | 1 | 245 |
|
| AF-A0A2S5LLN7-F1-model_v4 | tRNA pseudouridine synthase (EC 5.4.99.12) | 0.9914 | 87 | 245 |
GO:0003723
GO:0031119 GO:0160147 |
| AF-Q6G1G9-F1-model_v4 | tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) | 0.9913 | 1 | 245 |
GO:0003723
GO:0031119 GO:0160147 |
| AF-A0A3D3SK42-F1-model_v4 | deleted | 0.9911 | 35 | 245 |
|
| AF-A0A1I7NPD3-F1-model_v4 | tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) | 0.9909 | 1 | 245 |
GO:0003723
GO:0031119 GO:0160147 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar