F464074

General Info

Members Datasets Scaffolds Average Seq Length
563 265 1126 224

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0346772|Ga0395901_0346772_530_1264
Length 244
Sequence MSSPTGADSARLKQREKRPQSILFDVDGLLITTGGAGTRSWRWAFDELYGIPADIGEFTESGMTDPVVGRLTFTAVIGHEPSAEELARVVSHYLMRLPEEVAQSPGYRVLAGVEELLPRLCRDGFLLGITTGAVEAAAHIKLARANLNRFFSFGGYGSDSADRGELTRKAIARAGEILGAPLDPHRTLVVGDTPKDIAAAHAARAIGVGVASGHYSEDDLREAGADYVLASLEEELPGTAEAVA

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
149 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 9.24
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0346772 3300038443 Bacteria 1533
2 JGI24746J21847_1000015 3300001977 Bacteria 16109
3 JGI25407J50210_10016608 3300003373 Bacteria 1907
4 JGI25407J50210_10021877 3300003373 Bacteria 1662
5 Ga0070658_10000934 3300005327 Bacteria 25019
6 Ga0070658_10043238 3300005327 Bacteria 3640
7 Ga0070658_10501730 3300005327 Bacteria 1048
8 Ga0070676_10038219 3300005328 Bacteria 2772
9 Ga0070683_100081660 3300005329 Bacteria 3027
10 Ga0070670_100142333 3300005331 Bacteria 2074
11 Ga0070677_10000007 3300005333 Bacteria 74721
12 Ga0068869_100048730 3300005334 Bacteria 3065
13 Ga0070666_10151484 3300005335 Bacteria 1618
14 Ga0070666_10285617 3300005335 Bacteria 1173
15 Ga0070680_100001855 3300005336 Bacteria 15493
16 Ga0070680_100006862 3300005336 Bacteria 8684
17 Ga0070680_100071815 3300005336 Bacteria 2845
18 Ga0070680_100091186 3300005336 Bacteria 2523
19 Ga0070682_100302920 3300005337 Bacteria 1174
20 Ga0068868_100004176 3300005338 Bacteria 10099
21 Ga0068868_100113705 3300005338 Bacteria 2202
22 Ga0070660_100005733 3300005339 Bacteria 8600
23 Ga0070660_100013628 3300005339 Bacteria 5841
24 Ga0070660_100152950 3300005339 Bacteria 1856
25 Ga0070660_100348007 3300005339 Bacteria 1220
26 Ga0070660_100373176 3300005339 Bacteria 1177
27 Ga0070691_10344012 3300005341 Bacteria 826
28 Ga0070668_100135579 3300005347 Bacteria 1980
29 Ga0070674_100000001 3300005356 Bacteria 277173
30 Ga0070674_100000026 3300005356 Bacteria 77168
31 Ga0070674_100002750 3300005356 Bacteria 9724
32 Ga0070673_100002141 3300005364 Bacteria 11965
33 Ga0070659_100077795 3300005366 Bacteria 2646
34 Ga0070659_100211536 3300005366 Bacteria 1598
35 Ga0070667_100237984 3300005367 Bacteria 1625
36 Ga0070667_100359537 3300005367 Bacteria 1319
37 Ga0070667_100876028 3300005367 Bacteria 835
38 Ga0070709_10225314 3300005434 Bacteria 1339
39 Ga0070714_100093293 3300005435 Bacteria 2640
40 Ga0070714_100220842 3300005435 Bacteria 1741
41 Ga0070713_100000061 3300005436 Bacteria 68662
42 Ga0070713_100491856 3300005436 Bacteria 1157
43 Ga0070713_100524403 3300005436 Bacteria 1120
44 Ga0070710_10303411 3300005437 Bacteria 1043
45 Ga0070711_100008534 3300005439 Bacteria 6280
46 Ga0070711_100061938 3300005439 Bacteria 2606
47 Ga0070711_100186108 3300005439 Bacteria 1592
48 Ga0070711_100314583 3300005439 Bacteria 1249
49 Ga0070711_100541964 3300005439 Bacteria 964
50 Ga0070700_100048270 3300005441 Bacteria 2638
51 Ga0070700_100147404 3300005441 Bacteria 1606
52 Ga0070708_100459787 3300005445 Unclassified 1201
53 Ga0070678_100152316 3300005456 Bacteria 1864
54 Ga0070662_100252964 3300005457 Bacteria 1417
55 Ga0070681_10001085 3300005458 Bacteria 23213
56 Ga0070681_10002068 3300005458 Bacteria 18207
57 Ga0070681_10019014 3300005458 Bacteria 6875
58 Ga0070681_10171434 3300005458 Bacteria 2092
59 Ga0070681_10190448 3300005458 Bacteria 1971
60 Ga0070681_10211039 3300005458 Bacteria 1858
61 Ga0068867_100000246 3300005459 Bacteria 35737
62 Ga0068867_100233082 3300005459 Bacteria 1489
63 Ga0068867_100345379 3300005459 Bacteria 1240
64 Ga0070707_100020070 3300005468 Bacteria 6302
65 Ga0070698_100174397 3300005471 Bacteria 2090
66 Ga0070698_100225807 3300005471 Bacteria 1806
67 Ga0070699_100416938 3300005518 Bacteria 1215
68 Ga0070679_100000306 3300005530 Bacteria 41768
69 Ga0070679_100018146 3300005530 Bacteria 6823
70 Ga0070679_100081554 3300005530 Bacteria 3224
71 Ga0070679_100317292 3300005530 Bacteria 1508
72 Ga0070679_100424400 3300005530 Unclassified 1275
73 Ga0070684_100188777 3300005535 Bacteria 1875
74 Ga0070684_100401371 3300005535 Bacteria 1264
75 Ga0070686_100063556 3300005544 Bacteria 2391
76 Ga0070693_100018373 3300005547 Bacteria 3651
77 Ga0070665_100224310 3300005548 Bacteria 1880
78 Ga0070704_100077547 3300005549 Bacteria 2434
79 Ga0068855_100003430 3300005563 Bacteria 19392
80 Ga0068855_100027470 3300005563 Bacteria 6806
81 Ga0068855_100056716 3300005563 Bacteria 4594
82 Ga0068855_100098936 3300005563 Bacteria 3360
83 Ga0068856_100026694 3300005614 Bacteria 5631
84 Ga0068856_100091968 3300005614 Bacteria 3018
85 Ga0068856_100483625 3300005614 Bacteria 1259
86 Ga0068852_100494634 3300005616 Bacteria 1217
87 Ga0068866_10000006 3300005718 Bacteria 176129
88 Ga0068866_10000234 3300005718 Bacteria 26134
89 Ga0068866_10062302 3300005718 Bacteria 1940
90 Ga0068866_10140050 3300005718 Unclassified 1387
91 Ga0068861_100203822 3300005719 Unclassified 1662
92 Ga0068861_100220106 3300005719 Bacteria 1604
93 Ga0068861_100469883 3300005719 Bacteria 1131
94 Ga0068861_100519819 3300005719 Bacteria 1079
95 Ga0068860_100021006 3300005843 Bacteria 6326
96 Ga0081455_10098723 3300005937 Bacteria 2350
97 Ga0081455_10110329 3300005937 Bacteria 2187
98 Ga0081538_10000112 3300005981 Bacteria 81614
99 Ga0081540_1000733 3300005983 Bacteria 30225
100 Ga0081540_1009607 3300005983 Bacteria 6652
101 Ga0070717_10617476 3300006028 Bacteria 984
102 Ga0070715_10000003 3300006163 Bacteria 345282
103 Ga0070715_10176899 3300006163 Bacteria 1067
104 Ga0070716_100037546 3300006173 Bacteria 2678
105 Ga0070712_100252231 3300006175 Bacteria 1410
106 Ga0070712_100422922 3300006175 Bacteria 1104
107 Ga0075428_100102774 3300006844 Bacteria 3117
108 Ga0075428_101306980 3300006844 Unclassified 763
109 Ga0075430_100079612 3300006846 Unclassified 2745
110 Ga0075431_100010590 3300006847 Bacteria 9273
111 Ga0075431_100073969 3300006847 Bacteria 3516
112 Ga0068865_100267958 3300006881 Bacteria 1355
113 Ga0075436_100698370 3300006914 Bacteria 751
114 Ga0105240_10599493 3300009093 Bacteria 1213
115 Ga0105240_10786266 3300009093 Bacteria 1032
116 Ga0111539_10450121 3300009094 Bacteria 1499
117 Ga0111539_10593920 3300009094 Bacteria 1289
118 Ga0111539_10681842 3300009094 Bacteria 1196
119 Ga0105245_10000049 3300009098 Bacteria 128277
120 Ga0105245_10001823 3300009098 Bacteria 19389
121 Ga0105245_10029566 3300009098 Bacteria 4843
122 Ga0114129_10007822 3300009147 Bacteria 15209
123 Ga0114129_10055679 3300009147 Bacteria 5542
124 Ga0114129_10321796 3300009147 Bacteria 2056
125 Ga0105243_10154136 3300009148 Unclassified 1974
126 Ga0105241_10033253 3300009174 Bacteria 3870
127 Ga0105242_10000398 3300009176 Bacteria 34481
128 Ga0105242_10014838 3300009176 Bacteria 6035
129 Ga0105242_10148821 3300009176 Bacteria 2040
130 Ga0105237_10078260 3300009545 Bacteria 3296
131 Ga0105238_10007177 3300009551 Bacteria 11144
132 Ga0105238_10851365 3300009551 Unclassified 929
133 Ga0105249_10027692 3300009553 Bacteria 5114
134 Ga0105249_10311175 3300009553 Bacteria 1583
135 Ga0105239_10014659 3300010375 Bacteria 8693
136 Ga0105239_10095546 3300010375 Bacteria 3283
137 Ga0105239_10415241 3300010375 Bacteria 1524
138 Ga0105246_10002549 3300011119 Bacteria 11008
139 Ga0157335_1004012 3300012492 Unclassified 971
140 Ga0157371_10075907 3300013102 Bacteria 2380
141 Ga0157370_10037719 3300013104 Bacteria 4681
142 Ga0157370_10405716 3300013104 Bacteria 1254
143 Ga0157369_10194121 3300013105 Bacteria 2133
144 Ga0157369_10871225 3300013105 Bacteria 924
145 Ga0157374_10004554 3300013296 Bacteria 11630
146 Ga0157374_10371815 3300013296 Bacteria 1423
147 Ga0157374_10643213 3300013296 Bacteria 1072
148 Ga0163162_11174538 3300013306 Bacteria 871
149 Ga0157372_10014701 3300013307 Bacteria 8376
150 Ga0157372_10153595 3300013307 Bacteria 2658
151 Ga0157375_10003759 3300013308 Bacteria 13161
152 Ga0157375_10121481 3300013308 Bacteria 2722
153 Ga0157375_10173081 3300013308 Bacteria 2307
154 Ga0163163_10006317 3300014325 Bacteria 10347
155 Ga0157377_10010792 3300014745 Bacteria 4534
156 Ga0157377_10133049 3300014745 Bacteria 1521
157 Ga0157379_10020475 3300014968 Bacteria 5849
158 Ga0157379_10285928 3300014968 Bacteria 1501
159 Ga0157376_10003914 3300014969 Bacteria 10295
160 Ga0163161_10236937 3300017792 Bacteria 1418
161 Ga0206353_10014688 3300020082 Bacteria 15094
162 Ga0207682_10000007 3300025893 Bacteria 88967
163 Ga0207642_10000001 3300025899 Bacteria 714030
164 Ga0207642_10000003 3300025899 Bacteria 650651
165 Ga0207642_10000004 3300025899 Bacteria 407822
166 Ga0207642_10000022 3300025899 Bacteria 54810
167 Ga0207642_10017519 3300025899 Unclassified 2727
168 Ga0207642_10029023 3300025899 Bacteria 2286
169 Ga0207688_10003838 3300025901 Bacteria 8204
170 Ga0207680_10281489 3300025903 Bacteria 1155
171 Ga0207685_10000003 3300025905 Bacteria 344527
172 Ga0207699_10230664 3300025906 Bacteria 1268
173 Ga0207645_10039622 3300025907 Bacteria 3019
174 Ga0207705_10005819 3300025909 Bacteria 9182
175 Ga0207705_10026100 3300025909 Bacteria 4169
176 Ga0207705_10040098 3300025909 Bacteria 3357
177 Ga0207705_10408383 3300025909 Bacteria 1051
178 Ga0207654_10081555 3300025911 Bacteria 1948
179 Ga0207707_10000270 3300025912 Bacteria 55930
180 Ga0207707_10031073 3300025912 Bacteria 4672
181 Ga0207707_10066201 3300025912 Bacteria 3146
182 Ga0207707_10116602 3300025912 Bacteria 2334
183 Ga0207707_10172662 3300025912 Bacteria 1889
184 Ga0207693_10005370 3300025915 Bacteria 10708
185 Ga0207693_10362833 3300025915 Bacteria 1133
186 Ga0207663_10006177 3300025916 Bacteria 6105
187 Ga0207663_10041601 3300025916 Bacteria 2802
188 Ga0207663_10072500 3300025916 Bacteria 2226
189 Ga0207663_10190826 3300025916 Bacteria 1471
190 Ga0207660_10002517 3300025917 Bacteria 12045
191 Ga0207660_10060830 3300025917 Bacteria 2717
192 Ga0207660_10155748 3300025917 Bacteria 1759
193 Ga0207657_10011538 3300025919 Bacteria 8771
194 Ga0207657_10055165 3300025919 Bacteria 3434
195 Ga0207657_10255482 3300025919 Bacteria 1396
196 Ga0207657_10503964 3300025919 Bacteria 948
197 Ga0207652_10000251 3300025921 Bacteria 55866
198 Ga0207652_10018256 3300025921 Bacteria 5752
199 Ga0207652_10040359 3300025921 Bacteria 3964
200 Ga0207652_10204805 3300025921 Bacteria 1776
201 Ga0207646_10026800 3300025922 Bacteria 5257
202 Ga0207681_10087213 3300025923 Bacteria 2220
203 Ga0207694_10003513 3300025924 Bacteria 12440
204 Ga0207687_10000012 3300025927 Bacteria 370729
205 Ga0207687_10002016 3300025927 Bacteria 13927
206 Ga0207687_10352640 3300025927 Bacteria 1199
207 Ga0207700_10000016 3300025928 Bacteria 202434
208 Ga0207700_10586158 3300025928 Bacteria 992
209 Ga0207690_10012525 3300025932 Bacteria 5075
210 Ga0207690_10152442 3300025932 Bacteria 1714
211 Ga0207686_10000322 3300025934 Bacteria 34436
212 Ga0207686_10091146 3300025934 Bacteria 2013
213 Ga0207686_10116364 3300025934 Bacteria 1812
214 Ga0207709_10056748 3300025935 Unclassified 2425
215 Ga0207709_10105285 3300025935 Bacteria 1874
216 Ga0207669_10000002 3300025937 Bacteria 377651
217 Ga0207669_10000041 3300025937 Bacteria 67085
218 Ga0207704_10089894 3300025938 Bacteria 2013
219 Ga0207665_10025680 3300025939 Unclassified 3888
220 Ga0207689_10017336 3300025942 Bacteria 6095
221 Ga0207661_10087318 3300025944 Bacteria 2590
222 Ga0207661_10109187 3300025944 Bacteria 2337
223 Ga0207667_10004513 3300025949 Bacteria 17060
224 Ga0207667_10186384 3300025949 Bacteria 2130
225 Ga0207667_10324386 3300025949 Bacteria 1572
226 Ga0207651_10000172 3300025960 Bacteria 28069
227 Ga0207712_10000003 3300025961 Bacteria 615314
228 Ga0207712_10059553 3300025961 Bacteria 2703
229 Ga0207712_10438787 3300025961 Bacteria 1105
230 Ga0207668_10245948 3300025972 Bacteria 1450
231 Ga0207640_10004533 3300025981 Bacteria 7541
232 Ga0207640_10042098 3300025981 Bacteria 2910
233 Ga0207658_10215440 3300025986 Bacteria 1612
234 Ga0207658_10738164 3300025986 Bacteria 891
235 Ga0207677_10116935 3300026023 Bacteria 1997
236 Ga0207708_10047893 3300026075 Bacteria 3253
237 Ga0207708_10479351 3300026075 Bacteria 1040
238 Ga0207708_10552664 3300026075 Unclassified 971
239 Ga0207702_10001991 3300026078 Bacteria 19831
240 Ga0207702_10328217 3300026078 Unclassified 1459
241 Ga0207648_10000783 3300026089 Bacteria 35821
242 Ga0207648_10617344 3300026089 Bacteria 1000
243 Ga0207675_100572112 3300026118 Bacteria 1131
244 Ga0207683_10040970 3300026121 Bacteria 4043
245 Ga0207683_10119320 3300026121 Bacteria 2366
246 Ga0207698_10046126 3300026142 Bacteria 3288
247 Ga0207428_10010456 3300027907 Bacteria 8287
248 Ga0268264_10010113 3300028381 Bacteria 7807
249 Ga0316576_10348853 3300031727 Bacteria 1101
250 Ga0316578_10065920 3300031728 Bacteria 2139
251 Ga0316577_10307353 3300031733 Bacteria 898
252 Ga0307409_100112119 3300031995 Bacteria 2289
253 Ga0373926_0088052 3300035083 Bacteria 1153
254 Ga0373944_0022267 3300035089 Bacteria 1840
255 Ga0373945_0024561 3300035116 Bacteria 2089
256 Ga0373954_0233354 3300035118 Bacteria 905
257 Ga0373957_0152888 3300035120 Bacteria 948
258 Ga0373943_0022625 3300035170 Bacteria 2915
259 Ga0373943_0123061 3300035170 Bacteria 1380
260 Ga0373935_0114000 3300035692 Bacteria 1798
261 Ga0373935_0285140 3300035692 Bacteria 1163
262 Ga0373933_0131921 3300035724 Bacteria 1572
263 Ga0373947_0024750 3300035725 Bacteria 3500
264 Ga0373937_0006399 3300036401 Bacteria 10162
265 Ga0373937_0046858 3300036401 Bacteria 3954
266 Ga0373937_0060080 3300036401 Bacteria 3493
267 Ga0373937_0552434 3300036401 Bacteria 1094
268 Ga0316584_0006063 3300036712 Bacteria 8169
269 Ga0373925_0004969 3300037068 Bacteria 9985
270 Ga0395899_0019264 3300037312 Bacteria 5186
271 Ga0395899_0388015 3300037312 Bacteria 927
272 Ga0395900_0020881 3300037418 Bacteria 6691
273 Ga0395900_0062936 3300037418 Bacteria 3813
274 Ga0395900_0083778 3300037418 Bacteria 3276
275 Ga0395898_0003605 3300037466 Bacteria 17244
276 Ga0395898_0006312 3300037466 Bacteria 12666
277 Ga0395898_0143910 3300037466 Bacteria 2282
278 Ga0395905_0014086 3300037471 Bacteria 7645
279 Ga0395905_0066122 3300037471 Unclassified 3385
280 Ga0395905_0543463 3300037471 Unclassified 1063
281 Ga0395901_0034168 3300038443 Bacteria 5250
282 Ga0395901_0062527 3300038443 Bacteria 3874
283 Ga0395901_0132070 3300038443 Bacteria 2624
284 Ga0395901_0213510 3300038443 Unclassified 2019
285 Ga0395901_0569455 3300038443 Bacteria 1146
286 Ga0395901_0838526 3300038443 Bacteria 905
287 Ga0439439_0020967 3300041406 Bacteria 1626
288 Ga0439452_041283 3300042010 Bacteria 1086
289 Ga0439434_0020870 3300042435 Unclassified 1968
290 Ga0466963_0000025 3300044694 Bacteria 51171
291 Ga0466957_0252371 3300044842 Unclassified 1173
292 Ga0495592_0001399 3300046454 Bacteria 16721
293 Ga0495592_0002851 3300046454 Bacteria 12277
294 Ga0495592_0022941 3300046454 Bacteria 4749
295 Ga0495592_0045817 3300046454 Bacteria 3262
296 Ga0495592_0172763 3300046454 Bacteria 1478
297 Ga0495592_0356229 3300046454 Bacteria 937
298 Ga0495603_0000054 3300046455 Bacteria 49027
299 Ga0495603_0000431 3300046455 Bacteria 23265
300 Ga0495603_0131051 3300046455 Bacteria 1460
301 Ga0495629_0004923 3300046459 Bacteria 10027
302 Ga0495629_0009927 3300046459 Bacteria 6947
303 Ga0495629_0025267 3300046459 Bacteria 4225
304 Ga0495629_0029409 3300046459 Bacteria 3896
305 Ga0495629_0053774 3300046459 Bacteria 2816
306 Ga0495629_0076617 3300046459 Bacteria 2335
307 Ga0495641_0262515 3300046461 Bacteria 777
308 Ga0495651_0000097 3300046462 Bacteria 64676
309 Ga0495651_0018086 3300046462 Bacteria 5457
310 Ga0495651_0181444 3300046462 Bacteria 1489
311 Ga0495651_0235843 3300046462 Bacteria 1257
312 Ga0495653_0003612 3300046463 Bacteria 12475
313 Ga0495653_0011134 3300046463 Bacteria 7356
314 Ga0495653_0040546 3300046463 Bacteria 3639
315 Ga0495580_0060447 3300046472 Bacteria 2662
316 Ga0495582_0000082 3300046473 Bacteria 48118
317 Ga0495582_0005792 3300046473 Bacteria 6884
318 Ga0495639_0002352 3300046475 Bacteria 8264
319 Ga0495639_0033218 3300046475 Unclassified 2304
320 Ga0495662_0000727 3300046476 Bacteria 15735
321 Ga0495662_0002179 3300046476 Bacteria 9848
322 Ga0495662_0144580 3300046476 Bacteria 1171
323 Ga0495662_0144724 3300046476 Bacteria 1170
324 Ga0495594_0005831 3300046499 Bacteria 6327
325 Ga0495594_0032770 3300046499 Bacteria 2822
326 Ga0495608_0001079 3300046511 Bacteria 19249
327 Ga0495608_0002869 3300046511 Bacteria 12337
328 Ga0495608_0020928 3300046511 Bacteria 4493
329 Ga0495608_0045608 3300046511 Bacteria 2920
330 Ga0495608_0393194 3300046511 Bacteria 849
331 Ga0495620_0000158 3300046515 Bacteria 54704
332 Ga0495628_0001325 3300046516 Bacteria 22701
333 Ga0495628_0010085 3300046516 Bacteria 8037
334 Ga0495628_0086318 3300046516 Bacteria 2433
335 Ga0495628_0090637 3300046516 Bacteria 2367
336 Ga0495628_0100581 3300046516 Bacteria 2232
337 Ga0495630_0008554 3300046517 Bacteria 7343
338 Ga0495630_0011576 3300046517 Bacteria 6389
339 Ga0495630_0295700 3300046517 Bacteria 1237
340 Ga0495644_0152921 3300046523 Bacteria 883
341 Ga0495666_0045528 3300046526 Bacteria 2116
342 Ga0495652_0000023 3300046529 Bacteria 168049
343 Ga0495652_0001520 3300046529 Bacteria 25446
344 Ga0495652_0022568 3300046529 Bacteria 5584
345 Ga0495652_0054592 3300046529 Bacteria 3402
346 Ga0495665_0030061 3300046531 Bacteria 2907
347 Ga0495665_0234885 3300046531 Bacteria 946
348 Ga0495640_0006895 3300046533 Bacteria 8948
349 Ga0495586_0070148 3300046535 Bacteria 1913
350 Ga0495587_0000886 3300046536 Bacteria 19796
351 Ga0495587_0007418 3300046536 Bacteria 7102
352 Ga0495587_0140627 3300046536 Bacteria 1378
353 Ga0495587_0304955 3300046536 Bacteria 890
354 Ga0495587_0317867 3300046536 Bacteria 870
355 Ga0495598_0014796 3300046537 Bacteria 1957
356 Ga0495645_0000054 3300046543 Bacteria 84855
357 Ga0495645_0000186 3300046543 Bacteria 44324
358 Ga0495645_0018715 3300046543 Bacteria 4979
359 Ga0495645_0256951 3300046543 Bacteria 1159
360 Ga0495645_0313878 3300046543 Bacteria 1020
361 Ga0495667_0000053 3300046559 Bacteria 105370
362 Ga0495667_0004413 3300046559 Bacteria 9489
363 Ga0495667_0011319 3300046559 Bacteria 6039
364 Ga0495656_0004485 3300046615 Bacteria 4783
365 Ga0495668_0134819 3300046616 Bacteria 1351
366 Ga0495634_0000616 3300046642 Bacteria 34537
367 Ga0495634_0022292 3300046642 Bacteria 4463
368 Ga0495634_0030812 3300046642 Bacteria 3699
369 Ga0495635_0021508 3300046663 Bacteria 4496
370 Ga0495657_0008004 3300046675 Bacteria 8106
371 Ga0495657_0008769 3300046675 Bacteria 7710
372 Ga0495657_0009152 3300046675 Bacteria 7523
373 Ga0495599_0000344 3300046678 Bacteria 27562
374 Ga0495599_0445358 3300046678 Bacteria 767
375 Ga0495623_0000648 3300046679 Bacteria 23078
376 Ga0495623_0231971 3300046679 Bacteria 1046
377 Ga0495646_0067480 3300046680 Bacteria 2114
378 Ga0495646_0074807 3300046680 Bacteria 1987
379 Ga0495647_0003218 3300046681 Bacteria 5226
380 Ga0495647_0013505 3300046681 Bacteria 2830
381 Ga0495647_0019705 3300046681 Bacteria 2415
382 Ga0495647_0116766 3300046681 Bacteria 1119
383 Ga0495658_0000070 3300046683 Bacteria 52450
384 Ga0495658_0010633 3300046683 Bacteria 4606
385 Ga0495669_0000545 3300046684 Bacteria 16848
386 Ga0495613_0100308 3300046689 Bacteria 2091
387 Ga0495624_0035103 3300046690 Bacteria 3238
388 Ga0495624_0152496 3300046690 Bacteria 1413
389 Ga0495670_0002998 3300046691 Bacteria 8330
390 Ga0495600_0011743 3300046809 Bacteria 5466
391 Ga0495600_0020863 3300046809 Bacteria 4192
392 Ga0495600_0326492 3300046809 Bacteria 964
393 Ga0495600_0548771 3300046809 Bacteria 706
394 Ga0495581_0004699 3300047315 Bacteria 7887
395 Ga0495581_0006481 3300047315 Bacteria 6790
396 Ga0495581_0054915 3300047315 Bacteria 2299
397 Ga0495604_0000038 3300047317 Bacteria 123703
398 Ga0495604_0000085 3300047317 Bacteria 81234
399 Ga0495674_0002167 3300047319 Bacteria 19285
400 Ga0495674_0006179 3300047319 Bacteria 11491
401 Ga0495674_0028976 3300047319 Bacteria 5043
402 Ga0495674_0082368 3300047319 Bacteria 2759
403 Ga0495676_0033656 3300047321 Bacteria 4312
404 Ga0495676_0100337 3300047321 Bacteria 2143
405 Ga0495680_0000336 3300047322 Bacteria 52443
406 Ga0495680_0000364 3300047322 Bacteria 50773
407 Ga0495680_0003888 3300047322 Bacteria 14454
408 Ga0495680_0006854 3300047322 Bacteria 10525
409 Ga0495680_0007408 3300047322 Bacteria 10065
410 Ga0495680_0459443 3300047322 Bacteria 870
411 Ga0495675_0000041 3300047444 Bacteria 86087
412 Ga0495675_0141811 3300047444 Bacteria 1489
413 Ga0495679_007063 3300047446 Bacteria 4738
414 Ga0495685_021031 3300047447 Bacteria 2243
415 Ga0495673_0077711 3300047469 Unclassified 1382
416 Ga0495684_0018696 3300047471 Bacteria 5338
417 Ga0495684_0030704 3300047471 Bacteria 4126
418 Ga0495684_0037529 3300047471 Bacteria 3716
419 Ga0495593_0028080 3300047673 Bacteria 3092
420 Ga0495602_0004638 3300048088 Bacteria 14343
421 Ga0495602_0072020 3300048088 Bacteria 2949
422 Ga0495602_0131387 3300048088 Bacteria 1996
423 Ga0495602_0284343 3300048088 Bacteria 1217
424 Ga0495602_0360204 3300048088 Bacteria 1047
425 Ga0495614_0003290 3300048089 Bacteria 7226
426 Ga0496100_0000004 3300048903 Bacteria 321778
427 Ga0496100_0016461 3300048903 Bacteria 4343
428 Ga0496101_0000007 3300048904 Bacteria 321778
429 Ga0496101_0004462 3300048904 Bacteria 8820
430 Ga0496101_0027774 3300048904 Bacteria 3945
431 Ga0496102_0005468 3300048905 Bacteria 10773
432 Ga0496102_0005858 3300048905 Bacteria 10458
433 Ga0496102_0026528 3300048905 Bacteria 5169
434 Ga0496103_0006899 3300048906 Bacteria 6784
435 Ga0496103_0015560 3300048906 Bacteria 4530
436 Ga0496104_0000003 3300048907 Bacteria 669219
437 Ga0496104_0004031 3300048907 Bacteria 12737
438 Ga0496105_0000003 3300048908 Bacteria 713251
439 Ga0496105_0141180 3300048908 Bacteria 1982
440 Ga0496105_0360457 3300048908 Bacteria 1160
441 Ga0496105_0494005 3300048908 Bacteria 961
442 Ga0496106_0000004 3300048909 Bacteria 279896
443 Ga0496106_0010708 3300048909 Bacteria 6778
444 Ga0496106_0341196 3300048909 Unclassified 1203
445 Ga0496107_0000001 3300048910 Bacteria 321778
446 Ga0496107_0005067 3300048910 Bacteria 8978
447 Ga0496107_0023211 3300048910 Bacteria 4385
448 Ga0496107_0197570 3300048910 Bacteria 1495
449 Ga0496108_0000002 3300048911 Bacteria 700890
450 Ga0496108_0000202 3300048911 Bacteria 55115
451 Ga0496108_0012578 3300048911 Bacteria 6894
452 Ga0496108_0018506 3300048911 Bacteria 5704
453 Ga0496109_0000001 3300048912 Bacteria 700852
454 Ga0496109_0000131 3300048912 Bacteria 76860
455 Ga0496109_0032687 3300048912 Bacteria 4678
456 Ga0496109_0090011 3300048912 Bacteria 2838
457 Ga0496109_0251083 3300048912 Bacteria 1666
458 Ga0496110_0000228 3300048913 Bacteria 36482
459 Ga0496110_0037056 3300048913 Bacteria 4237
460 Ga0496110_0054320 3300048913 Bacteria 3523
461 Ga0496110_0498861 3300048913 Bacteria 1108
462 Ga0496111_0009891 3300048914 Bacteria 6373
463 Ga0496111_0016107 3300048914 Bacteria 5148
464 Ga0496111_0016627 3300048914 Bacteria 5073
465 Ga0496111_0370660 3300048914 Bacteria 1059
466 Ga0496112_0000002 3300048915 Bacteria 782039
467 Ga0496112_0008151 3300048915 Bacteria 9362
468 Ga0496112_0030614 3300048915 Bacteria 5210
469 Ga0496112_0258030 3300048915 Bacteria 1693
470 Ga0496112_0287831 3300048915 Bacteria 1589
471 Ga0496113_0000187 3300048916 Bacteria 28120
472 Ga0496113_0017926 3300048916 Bacteria 4923
473 Ga0496113_0041939 3300048916 Bacteria 3379
474 Ga0496113_0050814 3300048916 Bacteria 3092
475 Ga0496113_0430261 3300048916 Bacteria 1060
476 Ga0496114_0006943 3300048917 Bacteria 8920
477 Ga0496115_0038181 3300048918 Bacteria 3809
478 Ga0501031_0240787 3300049568 Bacteria 1176
479 Ga0501032_0000097 3300049569 Bacteria 74345
480 Ga0501032_0013188 3300049569 Bacteria 5881
481 Ga0501033_0000148 3300049570 Bacteria 67792
482 Ga0501033_0014702 3300049570 Bacteria 5941
483 Ga0501034_0000664 3300049571 Bacteria 52408
484 Ga0501036_0000062 3300049572 Bacteria 71065
485 Ga0501036_0006502 3300049572 Bacteria 9495
486 Ga0501036_0017449 3300049572 Bacteria 6000
487 Ga0501037_0002089 3300049573 Bacteria 14480
488 Ga0501037_0013318 3300049573 Bacteria 6061
489 Ga0501038_0000105 3300049574 Bacteria 70723
490 Ga0501038_0210293 3300049574 Unclassified 1556
491 Ga0501039_0026437 3300049575 Bacteria 4460
492 Ga0501039_0575216 3300049575 Bacteria 883
493 Ga0501040_0042578 3300049576 Bacteria 3093
494 Ga0501040_0072142 3300049576 Unclassified 2384
495 Ga0501041_0026731 3300049577 Bacteria 3473
496 Ga0501041_0031470 3300049577 Bacteria 3206
497 Ga0501042_0005176 3300049578 Bacteria 8382
498 Ga0501042_0048511 3300049578 Bacteria 3028
499 Ga0501043_0000117 3300049579 Bacteria 73761
500 Ga0501043_0094073 3300049579 Bacteria 2356
501 Ga0501046_0003133 3300049580 Bacteria 15271
502 Ga0501046_0012363 3300049580 Bacteria 7271
503 Ga0501046_0026657 3300049580 Bacteria 4720
504 Ga0501047_0000338 3300049581 Bacteria 53312
505 Ga0501048_0007705 3300049582 Bacteria 8161
506 Ga0501048_0028145 3300049582 Bacteria 4081
507 Ga0501048_0054351 3300049582 Unclassified 2844
508 Ga0501067_0001444 3300049583 Bacteria 12913
509 Ga0501068_0037714 3300049584 Bacteria 2893
510 Ga0501069_0016810 3300049585 Bacteria 3930
511 Ga0501070_0016060 3300049586 Bacteria 6292
512 Ga0501070_0039707 3300049586 Bacteria 3924
513 Ga0501070_0045856 3300049586 Bacteria 3635
514 Ga0501071_0011900 3300049587 Bacteria 5877
515 Ga0501071_0420019 3300049587 Unclassified 1022
516 Ga0501073_0012030 3300049589 Bacteria 6319
517 Ga0501074_0017107 3300049590 Bacteria 5260
518 Ga0501075_0085299 3300049591 Bacteria 2393
519 Ga0501076_0025922 3300049592 Bacteria 4539
520 Ga0501077_0011583 3300049593 Bacteria 5510
521 Ga0501079_0002250 3300049741 Bacteria 13922
522 Ga0501079_0578444 3300049741 Bacteria 883
523 Ga0501080_0037646 3300049742 Bacteria 4517
524 Ga0501080_0331062 3300049742 Bacteria 1377
525 Ga0501081_0025396 3300049743 Bacteria 3984
526 Ga0501081_0390153 3300049743 Bacteria 1030
527 Ga0501035_0000209 3300049822 Bacteria 70373
528 Ga0501035_0052829 3300049822 Bacteria 3635
529 Ga0501044_0000241 3300049823 Bacteria 69307
530 Ga0501044_0108214 3300049823 Unclassified 2790
531 Ga0501045_0001964 3300049824 Bacteria 13883
532 Ga0501045_0004336 3300049824 Bacteria 9780
533 Ga0501045_0092661 3300049824 Unclassified 2234
534 nmdc:mga05p37_27011_c1 3300050507 Bacteria 6986
535 nmdc:mga05p37_402911_c1 3300050507 Bacteria 1597
536 nmdc:mga0qj67_388471_c1 3300050509 Unclassified 1127
537 nmdc:mga06r32_160278_c1 3300050510 Bacteria 2232
538 nmdc:mga06r32_24414_c1 3300050510 Bacteria 5611
539 nmdc:mga08y16_6742_c1 3300050511 Bacteria 12042
540 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
541 Ga0495601_0000385 3300053077 Bacteria 23352
542 Ga0495601_0001834 3300053077 Bacteria 11795
543 Ga0495601_0142335 3300053077 Bacteria 1564
544 Ga0495601_0406350 3300053077 Bacteria 882
545 Ga0495612_0000024 3300053078 Bacteria 115718
546 Ga0495612_0009779 3300053078 Bacteria 3886
547 Ga0495612_0014406 3300053078 Bacteria 3179
548 Ga0495612_0102206 3300053078 Bacteria 1221
549 Ga0495612_0178076 3300053078 Bacteria 933
550 Ga0495595_0000262 3300053084 Bacteria 20924
551 Ga0495595_0097702 3300053084 Bacteria 1415
552 Ga0495595_0140873 3300053084 Bacteria 1183
553 Ga0495619_0000060 3300053085 Bacteria 89377
554 Ga0495619_0004736 3300053085 Bacteria 8656
555 Ga0495619_0005900 3300053085 Bacteria 7761
556 Ga0495619_0041328 3300053085 Bacteria 3015
557 Ga0495619_0127293 3300053085 Bacteria 1749
558 Ga0500566_0030339 3300053094 Bacteria 3153
559 Ga0500641_0004844 3300053096 Bacteria 4767
560 Ga0501084_0000665 3300054114 Bacteria 26214
561 Ga0530510_0008608 3300061734 Bacteria 7127
562 Ga0530510_0139216 3300061734 Unclassified 1787
563 Ga0530510_0295390 3300061734 Bacteria 1212
564 Ga0395901_0346772
565 JGI24746J21847_1000015
566 JGI25407J50210_10016608
567 JGI25407J50210_10021877
568 Ga0070658_10000934
569 Ga0070658_10043238
570 Ga0070658_10501730
571 Ga0070676_10038219
572 Ga0070683_100081660
573 Ga0070670_100142333
574 Ga0070677_10000007
575 Ga0068869_100048730
576 Ga0070666_10151484
577 Ga0070666_10285617
578 Ga0070680_100001855
579 Ga0070680_100006862
580 Ga0070680_100071815
581 Ga0070680_100091186
582 Ga0070682_100302920
583 Ga0068868_100004176
584 Ga0068868_100113705
585 Ga0070660_100005733
586 Ga0070660_100013628
587 Ga0070660_100152950
588 Ga0070660_100348007
589 Ga0070660_100373176
590 Ga0070691_10344012
591 Ga0070668_100135579
592 Ga0070674_100000001
593 Ga0070674_100000026
594 Ga0070674_100002750
595 Ga0070673_100002141
596 Ga0070659_100077795
597 Ga0070659_100211536
598 Ga0070667_100237984
599 Ga0070667_100359537
600 Ga0070667_100876028
601 Ga0070709_10225314
602 Ga0070714_100093293
603 Ga0070714_100220842
604 Ga0070713_100000061
605 Ga0070713_100491856
606 Ga0070713_100524403
607 Ga0070710_10303411
608 Ga0070711_100008534
609 Ga0070711_100061938
610 Ga0070711_100186108
611 Ga0070711_100314583
612 Ga0070711_100541964
613 Ga0070700_100048270
614 Ga0070700_100147404
615 Ga0070708_100459787
616 Ga0070678_100152316
617 Ga0070662_100252964
618 Ga0070681_10001085
619 Ga0070681_10002068
620 Ga0070681_10019014
621 Ga0070681_10171434
622 Ga0070681_10190448
623 Ga0070681_10211039
624 Ga0068867_100000246
625 Ga0068867_100233082
626 Ga0068867_100345379
627 Ga0070707_100020070
628 Ga0070698_100174397
629 Ga0070698_100225807
630 Ga0070699_100416938
631 Ga0070679_100000306
632 Ga0070679_100018146
633 Ga0070679_100081554
634 Ga0070679_100317292
635 Ga0070679_100424400
636 Ga0070684_100188777
637 Ga0070684_100401371
638 Ga0070686_100063556
639 Ga0070693_100018373
640 Ga0070665_100224310
641 Ga0070704_100077547
642 Ga0068855_100003430
643 Ga0068855_100027470
644 Ga0068855_100056716
645 Ga0068855_100098936
646 Ga0068856_100026694
647 Ga0068856_100091968
648 Ga0068856_100483625
649 Ga0068852_100494634
650 Ga0068866_10000006
651 Ga0068866_10000234
652 Ga0068866_10062302
653 Ga0068866_10140050
654 Ga0068861_100203822
655 Ga0068861_100220106
656 Ga0068861_100469883
657 Ga0068861_100519819
658 Ga0068860_100021006
659 Ga0081455_10098723
660 Ga0081455_10110329
661 Ga0081538_10000112
662 Ga0081540_1000733
663 Ga0081540_1009607
664 Ga0070717_10617476
665 Ga0070715_10000003
666 Ga0070715_10176899
667 Ga0070716_100037546
668 Ga0070712_100252231
669 Ga0070712_100422922
670 Ga0075428_100102774
671 Ga0075428_101306980
672 Ga0075430_100079612
673 Ga0075431_100010590
674 Ga0075431_100073969
675 Ga0068865_100267958
676 Ga0075436_100698370
677 Ga0105240_10599493
678 Ga0105240_10786266
679 Ga0111539_10450121
680 Ga0111539_10593920
681 Ga0111539_10681842
682 Ga0105245_10000049
683 Ga0105245_10001823
684 Ga0105245_10029566
685 Ga0114129_10007822
686 Ga0114129_10055679
687 Ga0114129_10321796
688 Ga0105243_10154136
689 Ga0105241_10033253
690 Ga0105242_10000398
691 Ga0105242_10014838
692 Ga0105242_10148821
693 Ga0105237_10078260
694 Ga0105238_10007177
695 Ga0105238_10851365
696 Ga0105249_10027692
697 Ga0105249_10311175
698 Ga0105239_10014659
699 Ga0105239_10095546
700 Ga0105239_10415241
701 Ga0105246_10002549
702 Ga0157335_1004012
703 Ga0157371_10075907
704 Ga0157370_10037719
705 Ga0157370_10405716
706 Ga0157369_10194121
707 Ga0157369_10871225
708 Ga0157374_10004554
709 Ga0157374_10371815
710 Ga0157374_10643213
711 Ga0163162_11174538
712 Ga0157372_10014701
713 Ga0157372_10153595
714 Ga0157375_10003759
715 Ga0157375_10121481
716 Ga0157375_10173081
717 Ga0163163_10006317
718 Ga0157377_10010792
719 Ga0157377_10133049
720 Ga0157379_10020475
721 Ga0157379_10285928
722 Ga0157376_10003914
723 Ga0163161_10236937
724 Ga0206353_10014688
725 Ga0207682_10000007
726 Ga0207642_10000001
727 Ga0207642_10000003
728 Ga0207642_10000004
729 Ga0207642_10000022
730 Ga0207642_10017519
731 Ga0207642_10029023
732 Ga0207688_10003838
733 Ga0207680_10281489
734 Ga0207685_10000003
735 Ga0207699_10230664
736 Ga0207645_10039622
737 Ga0207705_10005819
738 Ga0207705_10026100
739 Ga0207705_10040098
740 Ga0207705_10408383
741 Ga0207654_10081555
742 Ga0207707_10000270
743 Ga0207707_10031073
744 Ga0207707_10066201
745 Ga0207707_10116602
746 Ga0207707_10172662
747 Ga0207693_10005370
748 Ga0207693_10362833
749 Ga0207663_10006177
750 Ga0207663_10041601
751 Ga0207663_10072500
752 Ga0207663_10190826
753 Ga0207660_10002517
754 Ga0207660_10060830
755 Ga0207660_10155748
756 Ga0207657_10011538
757 Ga0207657_10055165
758 Ga0207657_10255482
759 Ga0207657_10503964
760 Ga0207652_10000251
761 Ga0207652_10018256
762 Ga0207652_10040359
763 Ga0207652_10204805
764 Ga0207646_10026800
765 Ga0207681_10087213
766 Ga0207694_10003513
767 Ga0207687_10000012
768 Ga0207687_10002016
769 Ga0207687_10352640
770 Ga0207700_10000016
771 Ga0207700_10586158
772 Ga0207690_10012525
773 Ga0207690_10152442
774 Ga0207686_10000322
775 Ga0207686_10091146
776 Ga0207686_10116364
777 Ga0207709_10056748
778 Ga0207709_10105285
779 Ga0207669_10000002
780 Ga0207669_10000041
781 Ga0207704_10089894
782 Ga0207665_10025680
783 Ga0207689_10017336
784 Ga0207661_10087318
785 Ga0207661_10109187
786 Ga0207667_10004513
787 Ga0207667_10186384
788 Ga0207667_10324386
789 Ga0207651_10000172
790 Ga0207712_10000003
791 Ga0207712_10059553
792 Ga0207712_10438787
793 Ga0207668_10245948
794 Ga0207640_10004533
795 Ga0207640_10042098
796 Ga0207658_10215440
797 Ga0207658_10738164
798 Ga0207677_10116935
799 Ga0207708_10047893
800 Ga0207708_10479351
801 Ga0207708_10552664
802 Ga0207702_10001991
803 Ga0207702_10328217
804 Ga0207648_10000783
805 Ga0207648_10617344
806 Ga0207675_100572112
807 Ga0207683_10040970
808 Ga0207683_10119320
809 Ga0207698_10046126
810 Ga0207428_10010456
811 Ga0268264_10010113
812 Ga0316576_10348853
813 Ga0316578_10065920
814 Ga0316577_10307353
815 Ga0307409_100112119
816 Ga0373926_0088052
817 Ga0373944_0022267
818 Ga0373945_0024561
819 Ga0373954_0233354
820 Ga0373957_0152888
821 Ga0373943_0022625
822 Ga0373943_0123061
823 Ga0373935_0114000
824 Ga0373935_0285140
825 Ga0373933_0131921
826 Ga0373947_0024750
827 Ga0373937_0006399
828 Ga0373937_0046858
829 Ga0373937_0060080
830 Ga0373937_0552434
831 Ga0316584_0006063
832 Ga0373925_0004969
833 Ga0395899_0019264
834 Ga0395899_0388015
835 Ga0395900_0020881
836 Ga0395900_0062936
837 Ga0395900_0083778
838 Ga0395898_0003605
839 Ga0395898_0006312
840 Ga0395898_0143910
841 Ga0395905_0014086
842 Ga0395905_0066122
843 Ga0395905_0543463
844 Ga0395901_0034168
845 Ga0395901_0062527
846 Ga0395901_0132070
847 Ga0395901_0213510
848 Ga0395901_0569455
849 Ga0395901_0838526
850 Ga0439439_0020967
851 Ga0439452_041283
852 Ga0439434_0020870
853 Ga0466963_0000025
854 Ga0466957_0252371
855 Ga0495592_0001399
856 Ga0495592_0002851
857 Ga0495592_0022941
858 Ga0495592_0045817
859 Ga0495592_0172763
860 Ga0495592_0356229
861 Ga0495603_0000054
862 Ga0495603_0000431
863 Ga0495603_0131051
864 Ga0495629_0004923
865 Ga0495629_0009927
866 Ga0495629_0025267
867 Ga0495629_0029409
868 Ga0495629_0053774
869 Ga0495629_0076617
870 Ga0495641_0262515
871 Ga0495651_0000097
872 Ga0495651_0018086
873 Ga0495651_0181444
874 Ga0495651_0235843
875 Ga0495653_0003612
876 Ga0495653_0011134
877 Ga0495653_0040546
878 Ga0495580_0060447
879 Ga0495582_0000082
880 Ga0495582_0005792
881 Ga0495639_0002352
882 Ga0495639_0033218
883 Ga0495662_0000727
884 Ga0495662_0002179
885 Ga0495662_0144580
886 Ga0495662_0144724
887 Ga0495594_0005831
888 Ga0495594_0032770
889 Ga0495608_0001079
890 Ga0495608_0002869
891 Ga0495608_0020928
892 Ga0495608_0045608
893 Ga0495608_0393194
894 Ga0495620_0000158
895 Ga0495628_0001325
896 Ga0495628_0010085
897 Ga0495628_0086318
898 Ga0495628_0090637
899 Ga0495628_0100581
900 Ga0495630_0008554
901 Ga0495630_0011576
902 Ga0495630_0295700
903 Ga0495644_0152921
904 Ga0495666_0045528
905 Ga0495652_0000023
906 Ga0495652_0001520
907 Ga0495652_0022568
908 Ga0495652_0054592
909 Ga0495665_0030061
910 Ga0495665_0234885
911 Ga0495640_0006895
912 Ga0495586_0070148
913 Ga0495587_0000886
914 Ga0495587_0007418
915 Ga0495587_0140627
916 Ga0495587_0304955
917 Ga0495587_0317867
918 Ga0495598_0014796
919 Ga0495645_0000054
920 Ga0495645_0000186
921 Ga0495645_0018715
922 Ga0495645_0256951
923 Ga0495645_0313878
924 Ga0495667_0000053
925 Ga0495667_0004413
926 Ga0495667_0011319
927 Ga0495656_0004485
928 Ga0495668_0134819
929 Ga0495634_0000616
930 Ga0495634_0022292
931 Ga0495634_0030812
932 Ga0495635_0021508
933 Ga0495657_0008004
934 Ga0495657_0008769
935 Ga0495657_0009152
936 Ga0495599_0000344
937 Ga0495599_0445358
938 Ga0495623_0000648
939 Ga0495623_0231971
940 Ga0495646_0067480
941 Ga0495646_0074807
942 Ga0495647_0003218
943 Ga0495647_0013505
944 Ga0495647_0019705
945 Ga0495647_0116766
946 Ga0495658_0000070
947 Ga0495658_0010633
948 Ga0495669_0000545
949 Ga0495613_0100308
950 Ga0495624_0035103
951 Ga0495624_0152496
952 Ga0495670_0002998
953 Ga0495600_0011743
954 Ga0495600_0020863
955 Ga0495600_0326492
956 Ga0495600_0548771
957 Ga0495581_0004699
958 Ga0495581_0006481
959 Ga0495581_0054915
960 Ga0495604_0000038
961 Ga0495604_0000085
962 Ga0495674_0002167
963 Ga0495674_0006179
964 Ga0495674_0028976
965 Ga0495674_0082368
966 Ga0495676_0033656
967 Ga0495676_0100337
968 Ga0495680_0000336
969 Ga0495680_0000364
970 Ga0495680_0003888
971 Ga0495680_0006854
972 Ga0495680_0007408
973 Ga0495680_0459443
974 Ga0495675_0000041
975 Ga0495675_0141811
976 Ga0495679_007063
977 Ga0495685_021031
978 Ga0495673_0077711
979 Ga0495684_0018696
980 Ga0495684_0030704
981 Ga0495684_0037529
982 Ga0495593_0028080
983 Ga0495602_0004638
984 Ga0495602_0072020
985 Ga0495602_0131387
986 Ga0495602_0284343
987 Ga0495602_0360204
988 Ga0495614_0003290
989 Ga0496100_0000004
990 Ga0496100_0016461
991 Ga0496101_0000007
992 Ga0496101_0004462
993 Ga0496101_0027774
994 Ga0496102_0005468
995 Ga0496102_0005858
996 Ga0496102_0026528
997 Ga0496103_0006899
998 Ga0496103_0015560
999 Ga0496104_0000003
1000 Ga0496104_0004031
1001 Ga0496105_0000003
1002 Ga0496105_0141180
1003 Ga0496105_0360457
1004 Ga0496105_0494005
1005 Ga0496106_0000004
1006 Ga0496106_0010708
1007 Ga0496106_0341196
1008 Ga0496107_0000001
1009 Ga0496107_0005067
1010 Ga0496107_0023211
1011 Ga0496107_0197570
1012 Ga0496108_0000002
1013 Ga0496108_0000202
1014 Ga0496108_0012578
1015 Ga0496108_0018506
1016 Ga0496109_0000001
1017 Ga0496109_0000131
1018 Ga0496109_0032687
1019 Ga0496109_0090011
1020 Ga0496109_0251083
1021 Ga0496110_0000228
1022 Ga0496110_0037056
1023 Ga0496110_0054320
1024 Ga0496110_0498861
1025 Ga0496111_0009891
1026 Ga0496111_0016107
1027 Ga0496111_0016627
1028 Ga0496111_0370660
1029 Ga0496112_0000002
1030 Ga0496112_0008151
1031 Ga0496112_0030614
1032 Ga0496112_0258030
1033 Ga0496112_0287831
1034 Ga0496113_0000187
1035 Ga0496113_0017926
1036 Ga0496113_0041939
1037 Ga0496113_0050814
1038 Ga0496113_0430261
1039 Ga0496114_0006943
1040 Ga0496115_0038181
1041 Ga0501031_0240787
1042 Ga0501032_0000097
1043 Ga0501032_0013188
1044 Ga0501033_0000148
1045 Ga0501033_0014702
1046 Ga0501034_0000664
1047 Ga0501036_0000062
1048 Ga0501036_0006502
1049 Ga0501036_0017449
1050 Ga0501037_0002089
1051 Ga0501037_0013318
1052 Ga0501038_0000105
1053 Ga0501038_0210293
1054 Ga0501039_0026437
1055 Ga0501039_0575216
1056 Ga0501040_0042578
1057 Ga0501040_0072142
1058 Ga0501041_0026731
1059 Ga0501041_0031470
1060 Ga0501042_0005176
1061 Ga0501042_0048511
1062 Ga0501043_0000117
1063 Ga0501043_0094073
1064 Ga0501046_0003133
1065 Ga0501046_0012363
1066 Ga0501046_0026657
1067 Ga0501047_0000338
1068 Ga0501048_0007705
1069 Ga0501048_0028145
1070 Ga0501048_0054351
1071 Ga0501067_0001444
1072 Ga0501068_0037714
1073 Ga0501069_0016810
1074 Ga0501070_0016060
1075 Ga0501070_0039707
1076 Ga0501070_0045856
1077 Ga0501071_0011900
1078 Ga0501071_0420019
1079 Ga0501073_0012030
1080 Ga0501074_0017107
1081 Ga0501075_0085299
1082 Ga0501076_0025922
1083 Ga0501077_0011583
1084 Ga0501079_0002250
1085 Ga0501079_0578444
1086 Ga0501080_0037646
1087 Ga0501080_0331062
1088 Ga0501081_0025396
1089 Ga0501081_0390153
1090 Ga0501035_0000209
1091 Ga0501035_0052829
1092 Ga0501044_0000241
1093 Ga0501044_0108214
1094 Ga0501045_0001964
1095 Ga0501045_0004336
1096 Ga0501045_0092661
1097 nmdc:mga05p37_27011_c1
1098 nmdc:mga05p37_402911_c1
1099 nmdc:mga0qj67_388471_c1
1100 nmdc:mga06r32_160278_c1
1101 nmdc:mga06r32_24414_c1
1102 nmdc:mga08y16_6742_c1
1103 nmdc:mga0a205_1_c2
1104 Ga0495601_0000385
1105 Ga0495601_0001834
1106 Ga0495601_0142335
1107 Ga0495601_0406350
1108 Ga0495612_0000024
1109 Ga0495612_0009779
1110 Ga0495612_0014406
1111 Ga0495612_0102206
1112 Ga0495612_0178076
1113 Ga0495595_0000262
1114 Ga0495595_0097702
1115 Ga0495595_0140873
1116 Ga0495619_0000060
1117 Ga0495619_0004736
1118 Ga0495619_0005900
1119 Ga0495619_0041328
1120 Ga0495619_0127293
1121 Ga0500566_0030339
1122 Ga0500641_0004844
1123 Ga0501084_0000665
1124 Ga0530510_0008608
1125 Ga0530510_0139216
1126 Ga0530510_0295390

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

19

204

0.83

PF13242

Hydrolase_like

HAD-hyrolase-like

163

235

0.83

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

22

210

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hcf-assembly1.cif.gz_A crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution 0.873 6 222
2hcf-assembly1.cif.gz_A crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution 0.8333 6 222
4uas-assembly2.cif.gz_B crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate 0.7844 7 222
7ocs-assembly2.cif.gz_B mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii 0.7777 6 219
2hsz-assembly2.cif.gz_B crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution 0.7775 6 221
ID Description Score Start End Superfamily
2hcfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9249 6 222 3.40.50.1000
3nasA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9037 98 221 3.40.50.1000
3kbbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8832 99 221 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8794 108 221 3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8742 96 219 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2W6BFJ8-F1-model_v4 Glutamate decarboxylase (EC 4.1.1.15) 0.9887 6 226 GO:0004351
GO:0005829
GO:0006538
GO:0030170
AF-A0A7W1N2G3-F1-model_v4 HAD family hydrolase 0.9839 7 226 GO:0005829
GO:0006281
GO:0008967
AF-X1T2G5-F1-model_v4 Hydrolase 0.9822 99 221 GO:0005829
GO:0006281
GO:0008967
AF-A0A6J4RNW6-F1-model_v4 Uncharacterized protein 0.9816 6 225 GO:0006281
GO:0008967
AF-A0A7V8BFP6-F1-model_v4 HAD hydrolase-like protein 0.9756 96 219 GO:0005829
GO:0006281
GO:0008967

Map