F464079

General Info

Members Datasets Scaffolds Average Seq Length
563 333 1126 250

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1793690|Ga0436365_1793690_191_1075
Length 294
Sequence VFRPLFSVRSGASIDPSDREIAETVSRRNLEAKMKLDDTISAIVTGGASGLGEATARRLASHGVKVALLDMNRERGEKIADEIKGLFASCDVTQEGSVDEALKKARVAHGIERVLVNCAGIAAGKRVVAKKRDTGELLAHDLATFAKVVEINLIGTFHMIAKSAVAMAGLEPVTEDGGRGVIVATASVAAQDGQIGQAAYSASKGGVLGMTLPIARDLAQYGIRVMTILPGIFYTPMMDQITEEFRKSLAASIPFPSRLGKPDEYARLVEAIVDNDMLNGEAIRLDGAIRMAPR

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
202 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 2508501050 Microvirga lupini Lut6 Isolate Nodule
308 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
309 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
310 2643221569 Achromobacter sp. Root565 Isolate Unclassified
311 2643221641 Nocardioides sp. Root122 Isolate Unclassified
312 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
313 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
314 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
315 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
316 2738541280 Massilia sp. GV090 Isolate Unclassified
317 2738541295 Bacillus sp. OK085 Isolate Unclassified
318 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
319 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
320 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
321 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
322 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
323 2851153111 Caulobacter radicis 736 Isolate Unclassified
324 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
325 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
326 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
327 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
328 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
329 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
330 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
331 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
332 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
333 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0.18
Isolates 4.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 25.93
Nodule 0.89
Rhizoplane 1.78
Rhizosphere 58.79
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1793690 3300039437 Bacteria 1113
2 JGI25152J39213_1012979 3300002773 Bacteria 1757
3 JGI25152J39213_1013232 3300002773 Bacteria 1728
4 JGI25150J39212_1002332 3300002774 Bacteria 4770
5 JGI25159J45721_1010824 3300002987 Bacteria 2287
6 JGI25159J45721_1011618 3300002987 Bacteria 2146
7 JGI25151J46595_10000264 3300003187 Bacteria 60338
8 JGI25151J46595_10001530 3300003187 Bacteria 15453
9 JGI25151J46595_10002902 3300003187 Bacteria 9822
10 JGI25151J46595_10010099 3300003187 Bacteria 4416
11 JGI25153J46596_10025838 3300003215 Bacteria 2090
12 JGI25160J50197_1003335 3300003354 Bacteria 7224
13 JGI25160J50197_1021757 3300003354 Bacteria 1896
14 JGI25161J50226_1008913 3300003374 Bacteria 1489
15 JGI25161J50226_1012290 3300003374 Bacteria 1031
16 Ga0006562J51391_1031471 3300003578 Bacteria 940
17 Ga0055539_1000536 3300003752 Bacteria 11499
18 Ga0055535_1000289 3300003761 Bacteria 53058
19 Ga0055542_1000036 3300003762 Bacteria 227346
20 Ga0055526_1002439 3300003771 Bacteria 12600
21 Ga0055526_1025503 3300003771 Bacteria 1896
22 Ga0055526_1025571 3300003771 Bacteria 1891
23 Ga0055537_1005828 3300003773 Bacteria 3231
24 Ga0055537_1006436 3300003773 Bacteria 2982
25 Ga0055524_1000328 3300003775 Bacteria 44226
26 Ga0055524_1015379 3300003775 Bacteria 2792
27 Ga0055524_1024733 3300003775 Bacteria 1896
28 Ga0055536_1000313 3300003781 Bacteria 36453
29 Ga0055536_1001062 3300003781 Bacteria 17329
30 Ga0055534_1002809 3300003784 Bacteria 5809
31 Ga0055534_1006364 3300003784 Bacteria 2982
32 Ga0055528_1014096 3300003790 Bacteria 2982
33 Ga0055530_10000581 3300003791 Bacteria 31658
34 Ga0055530_10003045 3300003791 Bacteria 10005
35 Ga0055540_1000846 3300003792 Bacteria 20496
36 Ga0055540_1001158 3300003792 Bacteria 16415
37 Ga0055540_1002671 3300003792 Bacteria 9200
38 Ga0055540_1003510 3300003792 Bacteria 7542
39 Ga0055531_10001130 3300003794 Bacteria 20640
40 Ga0055531_10003833 3300003794 Bacteria 9417
41 Ga0055531_10028632 3300003794 Bacteria 1915
42 Ga0055531_10029311 3300003794 Bacteria 1876
43 Ga0055543_1002807 3300004625 Bacteria 5505
44 Ga0065165_1005193 3300005262 Bacteria 7504
45 Ga0065704_10279143 3300005289 Bacteria 926
46 Ga0065707_10086614 3300005295 Bacteria 5385
47 Ga0070661_100329061 3300005344 Bacteria 1195
48 Ga0070668_100007696 3300005347 Bacteria 7996
49 Ga0070668_100041773 3300005347 Bacteria 3514
50 Ga0070669_100119691 3300005353 Bacteria 2007
51 Ga0070669_100159554 3300005353 Bacteria 1751
52 Ga0070675_100021363 3300005354 Bacteria 5172
53 Ga0070659_100068624 3300005366 Bacteria 2812
54 Ga0070710_10060032 3300005437 Bacteria 2162
55 Ga0070705_100094634 3300005440 Bacteria 1871
56 Ga0070700_100207568 3300005441 Bacteria 1380
57 Ga0070694_100037184 3300005444 Bacteria 3228
58 Ga0070663_100279577 3300005455 Bacteria 1330
59 Ga0070662_100078206 3300005457 Bacteria 2457
60 Ga0070706_100000109 3300005467 Bacteria 100476
61 Ga0070706_100846272 3300005467 Bacteria 846
62 Ga0070698_100022237 3300005471 Bacteria 6636
63 Ga0070697_100007034 3300005536 Bacteria 8745
64 Ga0068853_100004026 3300005539 Bacteria 11303
65 Ga0068853_100008120 3300005539 Bacteria 8425
66 Ga0068853_100042284 3300005539 Bacteria 3896
67 Ga0070696_100204291 3300005546 Bacteria 1476
68 Ga0070696_100276364 3300005546 Bacteria 1279
69 Ga0070665_100000852 3300005548 Bacteria 39685
70 Ga0070704_100116546 3300005549 Bacteria 2043
71 Ga0068855_100006888 3300005563 Bacteria 13787
72 Ga0070664_100040123 3300005564 Bacteria 3946
73 Ga0068857_100015961 3300005577 Bacteria 6578
74 Ga0068852_100005240 3300005616 Bacteria 9249
75 Ga0068852_100071741 3300005616 Bacteria 3042
76 Ga0068859_100042021 3300005617 Bacteria 4592
77 Ga0068859_100650793 3300005617 Bacteria 1146
78 Ga0068861_100000305 3300005719 Bacteria 27433
79 Ga0068851_10001862 3300005834 Bacteria 9259
80 Ga0068858_100001764 3300005842 Bacteria 22065
81 Ga0068860_100236354 3300005843 Bacteria 1777
82 Ga0068862_100024079 3300005844 Bacteria 5105
83 Ga0068862_100702873 3300005844 Bacteria 979
84 Ga0081455_10076476 3300005937 Bacteria 2758
85 Ga0081538_10000654 3300005981 Bacteria 38394
86 Ga0081540_1018524 3300005983 Bacteria 4266
87 Ga0070717_10006019 3300006028 Bacteria 8891
88 Ga0070717_10299221 3300006028 Bacteria 1430
89 Ga0075365_10128305 3300006038 Bacteria 1754
90 Ga0075368_10031565 3300006042 Bacteria 2055
91 Ga0075364_10127196 3300006051 Bacteria 1709
92 Ga0075367_10006047 3300006178 Bacteria 6079
93 Ga0075367_10007930 3300006178 Bacteria 5472
94 Ga0075367_10061422 3300006178 Bacteria 2243
95 Ga0075369_10105109 3300006186 Bacteria 1269
96 Ga0075370_10011861 3300006353 Bacteria 4589
97 Ga0075370_10035322 3300006353 Bacteria 2805
98 Ga0075370_10088936 3300006353 Bacteria 1781
99 Ga0075370_10155897 3300006353 Bacteria 1339
100 Ga0075370_10168100 3300006353 Bacteria 1288
101 Ga0075428_100004545 3300006844 Bacteria 15340
102 Ga0075430_100015484 3300006846 Bacteria 6492
103 Ga0075431_100003595 3300006847 Bacteria 15028
104 Ga0075431_100023423 3300006847 Bacteria 6317
105 Ga0075433_10000439 3300006852 Bacteria 26850
106 Ga0075433_10186280 3300006852 Bacteria 1847
107 Ga0075433_10230416 3300006852 Bacteria 1645
108 Ga0075433_10240932 3300006852 Bacteria 1605
109 Ga0075434_100000665 3300006871 Bacteria 26660
110 Ga0075434_100017542 3300006871 Bacteria 6900
111 Ga0075434_100152943 3300006871 Bacteria 2327
112 Ga0075429_100000410 3300006880 Bacteria 31789
113 Ga0075429_100001238 3300006880 Bacteria 20707
114 Ga0075429_100020306 3300006880 Bacteria 5762
115 Ga0068865_100049596 3300006881 Bacteria 2895
116 Ga0075436_100129131 3300006914 Bacteria 1772
117 Ga0097620_100042022 3300006931 Bacteria 4592
118 Ga0097620_100825692 3300006931 Bacteria 1014
119 Ga0075435_100001518 3300007076 Bacteria 14934
120 Ga0075435_100036394 3300007076 Bacteria 3912
121 Ga0075435_100252492 3300007076 Bacteria 1501
122 Ga0099794_10061712 3300007265 Bacteria 1822
123 Ga0105244_10003127 3300009036 Bacteria 12057
124 Ga0105244_10055519 3300009036 Bacteria 2006
125 Ga0105240_10164376 3300009093 Bacteria 2633
126 Ga0111539_10004569 3300009094 Bacteria 18092
127 Ga0111539_10007205 3300009094 Bacteria 14253
128 Ga0111539_10022584 3300009094 Bacteria 7729
129 Ga0111539_10358844 3300009094 Bacteria 1696
130 Ga0105245_10829937 3300009098 Bacteria 963
131 Ga0114129_10000987 3300009147 Bacteria 37193
132 Ga0114129_10001590 3300009147 Bacteria 30832
133 Ga0114129_10064661 3300009147 Bacteria 5105
134 Ga0114129_10202314 3300009147 Bacteria 2689
135 Ga0114129_10856486 3300009147 Bacteria 1155
136 Ga0114129_11094383 3300009147 Bacteria 998
137 Ga0105243_10000193 3300009148 Bacteria 71398
138 Ga0105243_10015937 3300009148 Bacteria 5684
139 Ga0105243_10029223 3300009148 Bacteria 4238
140 Ga0105248_10184856 3300009177 Bacteria 2349
141 Ga0105238_10025320 3300009551 Bacteria 6048
142 Ga0105238_10577242 3300009551 Bacteria 1130
143 Ga0105249_10003666 3300009553 Bacteria 13244
144 Ga0105246_10156367 3300011119 Bacteria 1732
145 Ga0157347_1005875 3300012502 Bacteria 1185
146 Ga0157371_10018276 3300013102 Bacteria 5185
147 Ga0157370_10005471 3300013104 Bacteria 14240
148 Ga0157369_10340840 3300013105 Bacteria 1557
149 Ga0157378_10102136 3300013297 Bacteria 2619
150 Ga0163162_10166243 3300013306 Bacteria 2330
151 Ga0163162_10486428 3300013306 Bacteria 1365
152 Ga0157375_10507768 3300013308 Bacteria 1369
153 Ga0157375_10531909 3300013308 Bacteria 1338
154 Ga0163163_10710430 3300014325 Unclassified 1069
155 Ga0182008_10017773 3300014497 Bacteria 3686
156 Ga0157377_10078418 3300014745 Bacteria 1925
157 Ga0157379_10169220 3300014968 Bacteria 1972
158 Ga0182006_1001149 3300015261 Bacteria 16762
159 Ga0182007_10001747 3300015262 Bacteria 11426
160 Ga0163161_10000244 3300017792 Bacteria 49165
161 Ga0213874_10013364 3300021377 Bacteria 2126
162 Ga0213876_10007469 3300021384 Bacteria 5946
163 Ga0213876_10013365 3300021384 Bacteria 4363
164 Ga0213876_10087769 3300021384 Bacteria 1647
165 Ga0213875_10003509 3300021388 Bacteria 8921
166 Ga0209566_100178 3300025225 Bacteria 69170
167 Ga0209672_100508 3300025228 Bacteria 21501
168 Ga0209147_100380 3300025229 Bacteria 30888
169 Ga0209258_100091 3300025242 Bacteria 227454
170 Ga0207425_1000183 3300025245 Bacteria 51638
171 Ga0207425_1014690 3300025245 Bacteria 1774
172 Ga0209026_1000784 3300025250 Bacteria 17581
173 Ga0209677_100060 3300025253 Bacteria 155728
174 Ga0209148_1000033 3300025254 Bacteria 555508
175 Ga0209129_1000091 3300025258 Bacteria 175716
176 Ga0209129_1000853 3300025258 Bacteria 19107
177 Ga0209565_1000270 3300025263 Bacteria 52764
178 Ga0209565_1000822 3300025263 Bacteria 17647
179 Ga0209565_1019622 3300025263 Bacteria 1440
180 Ga0209673_1000154 3300025273 Bacteria 146394
181 Ga0209673_1001319 3300025273 Bacteria 24986
182 Ga0209130_1000140 3300025284 Bacteria 115434
183 Ga0209130_1000203 3300025284 Bacteria 80023
184 Ga0209130_1004513 3300025284 Bacteria 5249
185 Ga0209675_1000447 3300025291 Bacteria 32004
186 Ga0209675_1000542 3300025291 Bacteria 27681
187 Ga0209675_1002415 3300025291 Bacteria 9634
188 Ga0209675_1007966 3300025291 Bacteria 3964
189 Ga0209676_1000088 3300025292 Bacteria 263010
190 Ga0209676_1000267 3300025292 Bacteria 109237
191 Ga0209676_1000966 3300025292 Bacteria 34669
192 Ga0209676_1006250 3300025292 Bacteria 5935
193 Ga0209676_1011364 3300025292 Bacteria 3598
194 Ga0209676_1042160 3300025292 Bacteria 1269
195 Ga0209025_1000207 3300025294 Bacteria 140774
196 Ga0209025_1000244 3300025294 Bacteria 127938
197 Ga0209025_1000356 3300025294 Bacteria 98547
198 Ga0209025_1000357 3300025294 Bacteria 98040
199 Ga0209025_1001327 3300025294 Bacteria 33484
200 Ga0209025_1002931 3300025294 Bacteria 16979
201 Ga0209025_1012924 3300025294 Bacteria 5298
202 Ga0209564_1000103 3300025295 Bacteria 221166
203 Ga0209564_1000530 3300025295 Bacteria 62121
204 Ga0209564_1000580 3300025295 Bacteria 58002
205 Ga0209758_1000092 3300025297 Bacteria 241910
206 Ga0209758_1010490 3300025297 Bacteria 5534
207 Ga0209050_1000110 3300025298 Bacteria 216664
208 Ga0209050_1000983 3300025298 Bacteria 36304
209 Ga0209050_1005989 3300025298 Bacteria 7378
210 Ga0209050_1006806 3300025298 Bacteria 6654
211 Ga0209050_1007210 3300025298 Bacteria 6312
212 Ga0209256_1000065 3300025299 Bacteria 248104
213 Ga0209256_1000094 3300025299 Bacteria 208177
214 Ga0209256_1000504 3300025299 Bacteria 57416
215 Ga0207426_1000084 3300025302 Bacteria 298123
216 Ga0207426_1000124 3300025302 Bacteria 218145
217 Ga0209051_1000069 3300025303 Bacteria 219208
218 Ga0209051_1000230 3300025303 Bacteria 94027
219 Ga0209051_1000685 3300025303 Bacteria 37585
220 Ga0209051_1003865 3300025303 Bacteria 9573
221 Ga0209051_1005092 3300025303 Bacteria 7811
222 Ga0209051_1013832 3300025303 Bacteria 3808
223 Ga0209257_1000093 3300025304 Bacteria 263088
224 Ga0209257_1000575 3300025304 Bacteria 61759
225 Ga0209257_1002147 3300025304 Bacteria 20535
226 Ga0209257_1004695 3300025304 Bacteria 10259
227 Ga0209257_1004876 3300025304 Bacteria 9909
228 Ga0209257_1007264 3300025304 Bacteria 6765
229 Ga0207656_10007312 3300025321 Bacteria 4015
230 Ga0207655_1001639 3300025728 Bacteria 19857
231 Ga0207688_10008589 3300025901 Bacteria 5560
232 Ga0207643_10080364 3300025908 Bacteria 1888
233 Ga0207705_10280807 3300025909 Bacteria 1275
234 Ga0207684_10000040 3300025910 Bacteria 262703
235 Ga0207684_10081190 3300025910 Bacteria 2759
236 Ga0207707_10043825 3300025912 Bacteria 3901
237 Ga0207695_10226988 3300025913 Bacteria 1773
238 Ga0207671_10217259 3300025914 Bacteria 1497
239 Ga0207671_10489186 3300025914 Bacteria 981
240 Ga0207660_10029707 3300025917 Bacteria 3753
241 Ga0207657_10249589 3300025919 Bacteria 1415
242 Ga0207646_10140693 3300025922 Bacteria 2173
243 Ga0207681_10016401 3300025923 Bacteria 4635
244 Ga0207681_10372716 3300025923 Bacteria 1147
245 Ga0207694_10095041 3300025924 Bacteria 2355
246 Ga0207694_10616134 3300025924 Bacteria 913
247 Ga0207659_10004207 3300025926 Bacteria 8692
248 Ga0207706_10005643 3300025933 Bacteria 11659
249 Ga0207706_10016992 3300025933 Bacteria 6565
250 Ga0207706_10074588 3300025933 Bacteria 2983
251 Ga0207686_10576797 3300025934 Bacteria 882
252 Ga0207709_10000076 3300025935 Bacteria 173292
253 Ga0207709_10001906 3300025935 Bacteria 13754
254 Ga0207709_10036558 3300025935 Bacteria 2911
255 Ga0207669_10240067 3300025937 Bacteria 1343
256 Ga0207669_10303603 3300025937 Bacteria 1214
257 Ga0207711_10403641 3300025941 Bacteria 1270
258 Ga0207679_10002533 3300025945 Bacteria 11260
259 Ga0207667_10214609 3300025949 Bacteria 1972
260 Ga0207712_10018160 3300025961 Bacteria 4577
261 Ga0207668_10012400 3300025972 Bacteria 5218
262 Ga0207640_10330507 3300025981 Bacteria 1217
263 Ga0207703_10004925 3300026035 Bacteria 10836
264 Ga0207639_10010595 3300026041 Bacteria 6387
265 Ga0207639_10218780 3300026041 Bacteria 1644
266 Ga0207639_10243471 3300026041 Bacteria 1565
267 Ga0207678_10045094 3300026067 Bacteria 3812
268 Ga0207678_10104024 3300026067 Bacteria 2423
269 Ga0207678_10292899 3300026067 Bacteria 1398
270 Ga0207708_10256978 3300026075 Bacteria 1409
271 Ga0207708_10670465 3300026075 Bacteria 884
272 Ga0207648_10112644 3300026089 Bacteria 2389
273 Ga0207674_10023449 3300026116 Bacteria 6610
274 Ga0207674_10146108 3300026116 Bacteria 2323
275 Ga0207674_10417368 3300026116 Bacteria 1297
276 Ga0207675_100005774 3300026118 Bacteria 11834
277 Ga0207675_100135832 3300026118 Bacteria 2333
278 Ga0207675_100592541 3300026118 Bacteria 1111
279 Ga0207675_100739824 3300026118 Bacteria 994
280 Ga0209813_10024293 3300027866 Bacteria 1732
281 Ga0209974_10012302 3300027876 Bacteria 2863
282 Ga0207428_10000036 3300027907 Bacteria 223539
283 Ga0207428_10038638 3300027907 Bacteria 3879
284 Ga0207428_10049936 3300027907 Bacteria 3349
285 Ga0207428_10258219 3300027907 Bacteria 1298
286 Ga0268266_10000854 3300028379 Bacteria 39711
287 Ga0268265_10002446 3300028380 Bacteria 13987
288 Ga0268265_10081699 3300028380 Bacteria 2553
289 Ga0268265_10098683 3300028380 Bacteria 2353
290 Ga0265318_10090694 3300028577 Bacteria 1126
291 Ga0307517_10043156 3300028786 Bacteria 4811
292 Ga0265327_10000524 3300031251 Bacteria 66279
293 Ga0265316_10051489 3300031344 Bacteria 3234
294 Ga0265316_10208758 3300031344 Bacteria 1445
295 Ga0307513_10076382 3300031456 Bacteria 3474
296 Ga0307513_10124302 3300031456 Bacteria 2540
297 Ga0307513_10382317 3300031456 Bacteria 1147
298 Ga0307408_100004374 3300031548 Bacteria 9607
299 Ga0307408_100011846 3300031548 Bacteria 5770
300 Ga0307408_100018851 3300031548 Bacteria 4639
301 Ga0307408_100056072 3300031548 Bacteria 2856
302 Ga0307408_100112981 3300031548 Bacteria 2090
303 Ga0307408_100137932 3300031548 Bacteria 1911
304 Ga0307408_100205370 3300031548 Bacteria 1597
305 Ga0307408_100446030 3300031548 Bacteria 1121
306 Ga0316575_10082954 3300031665 Bacteria 1294
307 Ga0265314_10000193 3300031711 Bacteria 90595
308 Ga0265342_10030705 3300031712 Bacteria 3327
309 Ga0307516_10264302 3300031730 Bacteria 1410
310 Ga0307405_10014118 3300031731 Bacteria 4285
311 Ga0307405_10197166 3300031731 Bacteria 1459
312 Ga0307413_10050577 3300031824 Bacteria 2498
313 Ga0307413_10120369 3300031824 Bacteria 1777
314 Ga0307410_10101224 3300031852 Bacteria 2065
315 Ga0307412_10000141 3300031911 Bacteria 51794
316 Ga0307412_10008447 3300031911 Bacteria 5878
317 Ga0307412_10039162 3300031911 Bacteria 3058
318 Ga0307412_10303348 3300031911 Bacteria 1263
319 Ga0307412_10649058 3300031911 Bacteria 900
320 Ga0307409_100203549 3300031995 Bacteria 1773
321 Ga0307409_100274030 3300031995 Bacteria 1556
322 Ga0307416_100021906 3300032002 Bacteria 4600
323 Ga0307416_100079529 3300032002 Bacteria 2763
324 Ga0307416_100294353 3300032002 Bacteria 1609
325 Ga0307416_100448360 3300032002 Bacteria 1342
326 Ga0307416_100486225 3300032002 Bacteria 1295
327 Ga0307416_100524431 3300032002 Bacteria 1253
328 Ga0307411_10105286 3300032005 Bacteria 2005
329 Ga0307415_100841392 3300032126 Bacteria 841
330 Ga0307510_10000476 3300033180 Bacteria 39237
331 Ga0307510_10003115 3300033180 Bacteria 19199
332 Ga0307510_10035629 3300033180 Bacteria 5553
333 Ga0373939_0066062 3300035114 Bacteria 1165
334 Ga0373943_0003007 3300035170 Bacteria 7654
335 Ga0373946_0023585 3300035171 Bacteria 2406
336 Ga0316574_0164575 3300035398 Bacteria 1428
337 Ga0373931_0072767 3300035691 Bacteria 1880
338 Ga0373935_0011561 3300035692 Bacteria 5300
339 Ga0373927_0008692 3300035695 Bacteria 6824
340 Ga0373947_0164233 3300035725 Bacteria 1437
341 Ga0373947_0199009 3300035725 Bacteria 1310
342 Ga0373925_0000199 3300037068 Bacteria 65400
343 Ga0395899_0141750 3300037312 Bacteria 1709
344 Ga0395899_0199904 3300037312 Bacteria 1394
345 Ga0395900_0063657 3300037418 Bacteria 3791
346 Ga0395900_0642637 3300037418 Bacteria 998
347 Ga0395898_0005188 3300037466 Bacteria 14089
348 Ga0395905_0100196 3300037471 Bacteria 2720
349 Ga0395905_0101655 3300037471 Bacteria 2698
350 Ga0436364_0221502 3300037853 Bacteria 2181
351 Ga0436364_0499456 3300037853 Bacteria 6120
352 Ga0436364_0923361 3300037853 Bacteria 18486
353 Ga0436364_0935252 3300037853 Bacteria 887
354 Ga0395901_0036788 3300038443 Bacteria 5061
355 Ga0395901_0045283 3300038443 Bacteria 4565
356 Ga0395901_0243450 3300038443 Bacteria 1875
357 Ga0436365_1141016 3300039437 Bacteria 2243
358 Ga0436365_1569498 3300039437 Bacteria 7296
359 Ga0436363_0089430 3300039450 Bacteria 7493
360 Ga0436363_0161687 3300039450 Bacteria 12768
361 Ga0436363_1004894 3300039450 Bacteria 14280
362 Ga0436362_0088640 3300039453 Bacteria 10868
363 Ga0436362_1138892 3300039453 Bacteria 2305
364 Ga0451793_0753453 3300041452 Bacteria 934
365 Ga0451807_0239534 3300041486 Bacteria 964
366 Ga0451833_1342921 3300041491 Bacteria 1028
367 Ga0439448_0008886 3300042005 Bacteria 2949
368 Ga0439448_0040830 3300042005 Bacteria 1499
369 Ga0439448_0067799 3300042005 Bacteria 1185
370 Ga0439450_020352 3300042008 Bacteria 1415
371 Ga0439454_005230 3300042011 Bacteria 1540
372 Ga0439455_0018833 3300042012 Bacteria 1623
373 Ga0439463_024756 3300042016 Bacteria 1504
374 Ga0439444_0010125 3300042437 Bacteria 1501
375 Ga0439464_0079245 3300042439 Bacteria 979
376 Ga0439440_0004575 3300042993 Bacteria 2721
377 Ga0466972_0132317 3300044658 Bacteria 1175
378 Ga0466964_0060599 3300044706 Bacteria 1574
379 Ga0466968_0008201 3300044735 Bacteria 3995
380 Ga0466957_0182141 3300044842 Bacteria 1372
381 Ga0466960_0000006 3300044901 Bacteria 71878
382 Ga0466960_0152336 3300044901 Bacteria 1236
383 Ga0466960_0230063 3300044901 Bacteria 1023
384 Ga0466960_0272210 3300044901 Bacteria 947
385 Ga0451576_0051675 3300045051 Bacteria 4308
386 Ga0495592_0034864 3300046454 Bacteria 3792
387 Ga0495603_0027238 3300046455 Bacteria 3449
388 Ga0495638_0018846 3300046460 Bacteria 4576
389 Ga0495650_0000080 3300046471 Bacteria 241533
390 Ga0495580_0000950 3300046472 Bacteria 25328
391 Ga0495664_0065472 3300046477 Bacteria 2167
392 Ga0495584_0143022 3300046491 Bacteria 1215
393 Ga0495616_0000021 3300046513 Bacteria 160303
394 Ga0495616_0000288 3300046513 Bacteria 40663
395 Ga0495620_0004327 3300046515 Bacteria 8025
396 Ga0495628_0000323 3300046516 Bacteria 43212
397 Ga0495631_0000187 3300046518 Bacteria 42155
398 Ga0495663_0004816 3300046525 Bacteria 3775
399 Ga0495652_0003139 3300046529 Bacteria 16503
400 Ga0495654_0050796 3300046530 Bacteria 2025
401 Ga0495621_0015650 3300046539 Bacteria 2422
402 Ga0495597_0012526 3300046542 Bacteria 4090
403 Ga0495645_0396019 3300046543 Bacteria 881
404 Ga0495668_0012025 3300046616 Bacteria 5152
405 Ga0495668_0021248 3300046616 Bacteria 3724
406 Ga0495625_0097501 3300046660 Bacteria 2023
407 Ga0495659_0000001 3300046664 Bacteria 325846
408 Ga0495659_0082447 3300046664 Bacteria 1223
409 Ga0495588_0041441 3300046674 Bacteria 2351
410 Ga0495657_0441728 3300046675 Bacteria 762
411 Ga0495623_0029770 3300046679 Bacteria 3513
412 Ga0495658_0027252 3300046683 Bacteria 3072
413 Ga0495658_0081287 3300046683 Bacteria 1902
414 Ga0495669_0141382 3300046684 Bacteria 1136
415 Ga0495671_0000035 3300046692 Bacteria 188543
416 Ga0495671_0002335 3300046692 Bacteria 12049
417 Ga0495604_0008090 3300047317 Bacteria 8328
418 Ga0495674_0024251 3300047319 Bacteria 5577
419 Ga0495672_0000919 3300047320 Bacteria 30793
420 Ga0495672_0009186 3300047320 Bacteria 7199
421 Ga0495602_0161319 3300048088 Bacteria 1750
422 Ga0495614_0040198 3300048089 Bacteria 2007
423 Ga0496102_0147208 3300048905 Bacteria 2211
424 Ga0496103_0241258 3300048906 Bacteria 1163
425 Ga0496106_0001132 3300048909 Bacteria 19731
426 Ga0496107_0000140 3300048910 Bacteria 35910
427 Ga0496108_0609618 3300048911 Bacteria 951
428 Ga0496109_0053502 3300048912 Bacteria 3682
429 Ga0496114_0044327 3300048917 Bacteria 3690
430 Ga0496116_0001037 3300048919 Bacteria 33961
431 Ga0496116_0194023 3300048919 Bacteria 1071
432 Ga0496117_0014279 3300048920 Bacteria 6853
433 Ga0496117_0070802 3300048920 Bacteria 2340
434 Ga0496117_0098523 3300048920 Bacteria 1858
435 Ga0496117_0106254 3300048920 Bacteria 1762
436 Ga0496118_0005148 3300048921 Bacteria 14990
437 Ga0496118_0081668 3300048921 Bacteria 2268
438 Ga0496118_0143809 3300048921 Bacteria 1506
439 Ga0496119_0039256 3300048922 Bacteria 3044
440 Ga0496119_0091261 3300048922 Bacteria 1730
441 Ga0496121_0049145 3300048924 Bacteria 3580
442 Ga0496121_0134148 3300048924 Bacteria 1847
443 Ga0496121_0165453 3300048924 Bacteria 1612
444 Ga0496121_0249236 3300048924 Bacteria 1232
445 Ga0496122_0078093 3300048925 Bacteria 2320
446 Ga0496123_0034929 3300048926 Bacteria 3592
447 Ga0496123_0039017 3300048926 Bacteria 3327
448 Ga0496124_0000098 3300048927 Bacteria 183057
449 Ga0496124_0070343 3300048927 Bacteria 2903
450 Ga0496124_0346191 3300048927 Bacteria 1053
451 Ga0496125_0036981 3300048928 Bacteria 4251
452 Ga0496125_0056258 3300048928 Bacteria 3196
453 Ga0496126_0010096 3300048929 Bacteria 9959
454 Ga0496126_0108702 3300048929 Bacteria 2418
455 Ga0496126_0109143 3300048929 Bacteria 2412
456 Ga0496126_0320602 3300048929 Bacteria 1274
457 Ga0501034_0109517 3300049571 Bacteria 2753
458 Ga0501034_0338524 3300049571 Bacteria 1435
459 Ga0501038_0114044 3300049574 Bacteria 2236
460 Ga0501040_0706591 3300049576 Bacteria 729
461 Ga0501042_0086976 3300049578 Bacteria 2242
462 Ga0501043_0176363 3300049579 Bacteria 1666
463 Ga0501047_0091343 3300049581 Bacteria 2923
464 Ga0501067_0013073 3300049583 Bacteria 4594
465 Ga0501069_0322839 3300049585 Bacteria 907
466 Ga0501070_0284870 3300049586 Bacteria 1348
467 Ga0501072_0167855 3300049588 Bacteria 1751
468 Ga0501073_0091965 3300049589 Bacteria 2109
469 Ga0501074_0083743 3300049590 Bacteria 2286
470 Ga0501076_0215434 3300049592 Bacteria 1570
471 Ga0501249_000210 3300049679 Bacteria 17890
472 Ga0501080_0515334 3300049742 Bacteria 1067
473 Ga0501083_0001570 3300049744 Bacteria 15597
474 Ga0501204_000310 3300049850 Bacteria 4058
475 nmdc:mga06z11_189568_c1 3300050494 Bacteria 1190
476 nmdc:mga04h51_26292_c1 3300050495 Bacteria 1798
477 nmdc:mga07m45_12072_c1 3300050496 Bacteria 4557
478 nmdc:mga07m45_29517_c1 3300050496 Bacteria 3033
479 nmdc:mga07m45_380826_c1 3300050496 Bacteria 819
480 nmdc:mga07m45_840_c1 3300050496 Bacteria 13313
481 nmdc:mga05p37_104785_c1 3300050507 Bacteria 3480
482 nmdc:mga05p37_2110_c1 3300050507 Bacteria 23225
483 nmdc:mga05p37_817878_c1 3300050507 Bacteria 1017
484 nmdc:mga05p37_93626_c1 3300050507 Bacteria 3703
485 nmdc:mga09592_12415_c1 3300050508 Bacteria 6938
486 nmdc:mga09592_1286_c1 3300050508 Bacteria 20142
487 nmdc:mga09592_31656_c1 3300050508 Bacteria 4407
488 nmdc:mga09592_68600_c1 3300050508 Bacteria 3008
489 nmdc:mga0qj67_180066_c1 3300050509 Bacteria 1716
490 nmdc:mga0qj67_2658_c1 3300050509 Bacteria 12804
491 nmdc:mga0qj67_5127_c1 3300050509 Bacteria 9542
492 nmdc:mga06r32_160340_c1 3300050510 Bacteria 2231
493 nmdc:mga06r32_19187_c1 3300050510 Bacteria 6274
494 nmdc:mga06r32_304_c1 3300050510 Bacteria 40653
495 nmdc:mga06r32_727_c1 3300050510 Bacteria 28844
496 nmdc:mga08y16_1021_c1 3300050511 Bacteria 27435
497 nmdc:mga08y16_157398_c1 3300050511 Bacteria 2361
498 nmdc:mga08y16_194969_c1 3300050511 Bacteria 2100
499 nmdc:mga08y16_209735_c1 3300050511 Bacteria 2018
500 nmdc:mga08y16_29553_c1 3300050511 Bacteria 5773
501 nmdc:mga08y16_47833_c1 3300050511 Bacteria 4477
502 nmdc:mga0n895_109266_c1 3300050512 Bacteria 2781
503 nmdc:mga0n895_158858_c1 3300050512 Bacteria 2292
504 nmdc:mga0n895_3865_c1 3300050512 Bacteria 12159
505 nmdc:mga0rr50_145433_c1 3300050513 Bacteria 1911
506 nmdc:mga0rr50_29563_c1 3300050513 Bacteria 3867
507 nmdc:mga0rr50_577_c1 3300050513 Bacteria 19622
508 nmdc:mga0a205_132045_c1 3300050515 Bacteria 2398
509 nmdc:mga0a205_161667_c1 3300050515 Bacteria 2136
510 nmdc:mga0a205_2332_c1 3300050515 Bacteria 10222
511 nmdc:mga0a205_434045_c1 3300050515 Bacteria 1175
512 nmdc:mga0sz30_99587_c1 3300050516 Bacteria 1269
513 Ga0500610_0003413 3300053079 Bacteria 6092
514 Ga0500610_0026273 3300053079 Bacteria 2912
515 Ga0500643_002509 3300053087 Bacteria 9406
516 Ga0500651_0000267 3300053093 Bacteria 30991
517 Ga0500592_001394 3300053116 Bacteria 3909
518 Ga0500595_021920 3300053119 Bacteria 2273
519 Ga0500595_034178 3300053119 Bacteria 1683
520 Ga0500595_040950 3300053119 Bacteria 1491
521 Ga0500608_001188 3300053122 Bacteria 9292
522 Ga0500652_013413 3300053131 Bacteria 2901
523 Ga0500655_000384 3300053133 Bacteria 9482
524 Ga0500658_0000635 3300053134 Bacteria 14562
525 Ga0500568_0000194 3300053139 Bacteria 52981
526 Ga0500568_0001561 3300053139 Bacteria 14491
527 Ga0500568_0004721 3300053139 Bacteria 7227
528 Ga0500604_0007372 3300053151 Bacteria 2913
529 Ga0500616_0000198 3300053153 Bacteria 98023
530 Ga0500616_0004275 3300053153 Bacteria 10265
531 Ga0500616_0071223 3300053153 Bacteria 1771
532 Ga0500627_0003262 3300053158 Bacteria 4991
533 Ga0500634_0045226 3300053161 Bacteria 2383
534 Ga0500645_002293 3300053730 Bacteria 8661
535 Ga0501082_0003722 3300060353 Bacteria 13323
536 2508734735 2508501050 Bacteria 9633614
537 2509079380 2508501114 Bacteria 7082538
538 2599903765 2599185292 Bacteria 6290804
539 2643860272 2643221569 Bacteria 6064337
540 2644228650 2643221641 Bacteria 4490190
541 2644536408 2643221697 Bacteria 3575694
542 2672334259 2671180330 Bacteria 5521719
543 2691515853 2690315906 Bacteria 4517044
544 2738706667 2738541274 Bacteria 6909446
545 2738739880 2738541280 Bacteria 6630198
546 2738814595 2738541295 Bacteria 5730091
547 2738816202 2738541295 Bacteria 5730091
548 2739331960 2738543028 Bacteria 6917070
549 2753766408 2751185897 Bacteria 5322941
550 2776257592 2775506901 Bacteria 9631051
551 2831937708 2831935698 Bacteria 5963223
552 2835318398 2835312727 Bacteria 7413381
553 2851156484 2851153111 Bacteria 5542585
554 2884298497 2884298095 Bacteria 3823049
555 2894241854 2894232714 Bacteria 8834183
556 2904544186 2904541872 Bacteria 8915136
557 2939649221 2939647034 Bacteria 4681660
558 2984577839 2984576629 Bacteria 4248407
559 2990260190 2990256926 Bacteria 4252839
560 3001890325 3001889506 Bacteria 2975194
561 8003863217 8003856774 Bacteria 7675274
562 8054609957 8054609563 Bacteria 5170090
563 8056213249 8056207758 Bacteria 8639239
564 Ga0436365_1793690
565 JGI25152J39213_1012979
566 JGI25152J39213_1013232
567 JGI25150J39212_1002332
568 JGI25159J45721_1010824
569 JGI25159J45721_1011618
570 JGI25151J46595_10000264
571 JGI25151J46595_10001530
572 JGI25151J46595_10002902
573 JGI25151J46595_10010099
574 JGI25153J46596_10025838
575 JGI25160J50197_1003335
576 JGI25160J50197_1021757
577 JGI25161J50226_1008913
578 JGI25161J50226_1012290
579 Ga0006562J51391_1031471
580 Ga0055539_1000536
581 Ga0055535_1000289
582 Ga0055542_1000036
583 Ga0055526_1002439
584 Ga0055526_1025503
585 Ga0055526_1025571
586 Ga0055537_1005828
587 Ga0055537_1006436
588 Ga0055524_1000328
589 Ga0055524_1015379
590 Ga0055524_1024733
591 Ga0055536_1000313
592 Ga0055536_1001062
593 Ga0055534_1002809
594 Ga0055534_1006364
595 Ga0055528_1014096
596 Ga0055530_10000581
597 Ga0055530_10003045
598 Ga0055540_1000846
599 Ga0055540_1001158
600 Ga0055540_1002671
601 Ga0055540_1003510
602 Ga0055531_10001130
603 Ga0055531_10003833
604 Ga0055531_10028632
605 Ga0055531_10029311
606 Ga0055543_1002807
607 Ga0065165_1005193
608 Ga0065704_10279143
609 Ga0065707_10086614
610 Ga0070661_100329061
611 Ga0070668_100007696
612 Ga0070668_100041773
613 Ga0070669_100119691
614 Ga0070669_100159554
615 Ga0070675_100021363
616 Ga0070659_100068624
617 Ga0070710_10060032
618 Ga0070705_100094634
619 Ga0070700_100207568
620 Ga0070694_100037184
621 Ga0070663_100279577
622 Ga0070662_100078206
623 Ga0070706_100000109
624 Ga0070706_100846272
625 Ga0070698_100022237
626 Ga0070697_100007034
627 Ga0068853_100004026
628 Ga0068853_100008120
629 Ga0068853_100042284
630 Ga0070696_100204291
631 Ga0070696_100276364
632 Ga0070665_100000852
633 Ga0070704_100116546
634 Ga0068855_100006888
635 Ga0070664_100040123
636 Ga0068857_100015961
637 Ga0068852_100005240
638 Ga0068852_100071741
639 Ga0068859_100042021
640 Ga0068859_100650793
641 Ga0068861_100000305
642 Ga0068851_10001862
643 Ga0068858_100001764
644 Ga0068860_100236354
645 Ga0068862_100024079
646 Ga0068862_100702873
647 Ga0081455_10076476
648 Ga0081538_10000654
649 Ga0081540_1018524
650 Ga0070717_10006019
651 Ga0070717_10299221
652 Ga0075365_10128305
653 Ga0075368_10031565
654 Ga0075364_10127196
655 Ga0075367_10006047
656 Ga0075367_10007930
657 Ga0075367_10061422
658 Ga0075369_10105109
659 Ga0075370_10011861
660 Ga0075370_10035322
661 Ga0075370_10088936
662 Ga0075370_10155897
663 Ga0075370_10168100
664 Ga0075428_100004545
665 Ga0075430_100015484
666 Ga0075431_100003595
667 Ga0075431_100023423
668 Ga0075433_10000439
669 Ga0075433_10186280
670 Ga0075433_10230416
671 Ga0075433_10240932
672 Ga0075434_100000665
673 Ga0075434_100017542
674 Ga0075434_100152943
675 Ga0075429_100000410
676 Ga0075429_100001238
677 Ga0075429_100020306
678 Ga0068865_100049596
679 Ga0075436_100129131
680 Ga0097620_100042022
681 Ga0097620_100825692
682 Ga0075435_100001518
683 Ga0075435_100036394
684 Ga0075435_100252492
685 Ga0099794_10061712
686 Ga0105244_10003127
687 Ga0105244_10055519
688 Ga0105240_10164376
689 Ga0111539_10004569
690 Ga0111539_10007205
691 Ga0111539_10022584
692 Ga0111539_10358844
693 Ga0105245_10829937
694 Ga0114129_10000987
695 Ga0114129_10001590
696 Ga0114129_10064661
697 Ga0114129_10202314
698 Ga0114129_10856486
699 Ga0114129_11094383
700 Ga0105243_10000193
701 Ga0105243_10015937
702 Ga0105243_10029223
703 Ga0105248_10184856
704 Ga0105238_10025320
705 Ga0105238_10577242
706 Ga0105249_10003666
707 Ga0105246_10156367
708 Ga0157347_1005875
709 Ga0157371_10018276
710 Ga0157370_10005471
711 Ga0157369_10340840
712 Ga0157378_10102136
713 Ga0163162_10166243
714 Ga0163162_10486428
715 Ga0157375_10507768
716 Ga0157375_10531909
717 Ga0163163_10710430
718 Ga0182008_10017773
719 Ga0157377_10078418
720 Ga0157379_10169220
721 Ga0182006_1001149
722 Ga0182007_10001747
723 Ga0163161_10000244
724 Ga0213874_10013364
725 Ga0213876_10007469
726 Ga0213876_10013365
727 Ga0213876_10087769
728 Ga0213875_10003509
729 Ga0209566_100178
730 Ga0209672_100508
731 Ga0209147_100380
732 Ga0209258_100091
733 Ga0207425_1000183
734 Ga0207425_1014690
735 Ga0209026_1000784
736 Ga0209677_100060
737 Ga0209148_1000033
738 Ga0209129_1000091
739 Ga0209129_1000853
740 Ga0209565_1000270
741 Ga0209565_1000822
742 Ga0209565_1019622
743 Ga0209673_1000154
744 Ga0209673_1001319
745 Ga0209130_1000140
746 Ga0209130_1000203
747 Ga0209130_1004513
748 Ga0209675_1000447
749 Ga0209675_1000542
750 Ga0209675_1002415
751 Ga0209675_1007966
752 Ga0209676_1000088
753 Ga0209676_1000267
754 Ga0209676_1000966
755 Ga0209676_1006250
756 Ga0209676_1011364
757 Ga0209676_1042160
758 Ga0209025_1000207
759 Ga0209025_1000244
760 Ga0209025_1000356
761 Ga0209025_1000357
762 Ga0209025_1001327
763 Ga0209025_1002931
764 Ga0209025_1012924
765 Ga0209564_1000103
766 Ga0209564_1000530
767 Ga0209564_1000580
768 Ga0209758_1000092
769 Ga0209758_1010490
770 Ga0209050_1000110
771 Ga0209050_1000983
772 Ga0209050_1005989
773 Ga0209050_1006806
774 Ga0209050_1007210
775 Ga0209256_1000065
776 Ga0209256_1000094
777 Ga0209256_1000504
778 Ga0207426_1000084
779 Ga0207426_1000124
780 Ga0209051_1000069
781 Ga0209051_1000230
782 Ga0209051_1000685
783 Ga0209051_1003865
784 Ga0209051_1005092
785 Ga0209051_1013832
786 Ga0209257_1000093
787 Ga0209257_1000575
788 Ga0209257_1002147
789 Ga0209257_1004695
790 Ga0209257_1004876
791 Ga0209257_1007264
792 Ga0207656_10007312
793 Ga0207655_1001639
794 Ga0207688_10008589
795 Ga0207643_10080364
796 Ga0207705_10280807
797 Ga0207684_10000040
798 Ga0207684_10081190
799 Ga0207707_10043825
800 Ga0207695_10226988
801 Ga0207671_10217259
802 Ga0207671_10489186
803 Ga0207660_10029707
804 Ga0207657_10249589
805 Ga0207646_10140693
806 Ga0207681_10016401
807 Ga0207681_10372716
808 Ga0207694_10095041
809 Ga0207694_10616134
810 Ga0207659_10004207
811 Ga0207706_10005643
812 Ga0207706_10016992
813 Ga0207706_10074588
814 Ga0207686_10576797
815 Ga0207709_10000076
816 Ga0207709_10001906
817 Ga0207709_10036558
818 Ga0207669_10240067
819 Ga0207669_10303603
820 Ga0207711_10403641
821 Ga0207679_10002533
822 Ga0207667_10214609
823 Ga0207712_10018160
824 Ga0207668_10012400
825 Ga0207640_10330507
826 Ga0207703_10004925
827 Ga0207639_10010595
828 Ga0207639_10218780
829 Ga0207639_10243471
830 Ga0207678_10045094
831 Ga0207678_10104024
832 Ga0207678_10292899
833 Ga0207708_10256978
834 Ga0207708_10670465
835 Ga0207648_10112644
836 Ga0207674_10023449
837 Ga0207674_10146108
838 Ga0207674_10417368
839 Ga0207675_100005774
840 Ga0207675_100135832
841 Ga0207675_100592541
842 Ga0207675_100739824
843 Ga0209813_10024293
844 Ga0209974_10012302
845 Ga0207428_10000036
846 Ga0207428_10038638
847 Ga0207428_10049936
848 Ga0207428_10258219
849 Ga0268266_10000854
850 Ga0268265_10002446
851 Ga0268265_10081699
852 Ga0268265_10098683
853 Ga0265318_10090694
854 Ga0307517_10043156
855 Ga0265327_10000524
856 Ga0265316_10051489
857 Ga0265316_10208758
858 Ga0307513_10076382
859 Ga0307513_10124302
860 Ga0307513_10382317
861 Ga0307408_100004374
862 Ga0307408_100011846
863 Ga0307408_100018851
864 Ga0307408_100056072
865 Ga0307408_100112981
866 Ga0307408_100137932
867 Ga0307408_100205370
868 Ga0307408_100446030
869 Ga0316575_10082954
870 Ga0265314_10000193
871 Ga0265342_10030705
872 Ga0307516_10264302
873 Ga0307405_10014118
874 Ga0307405_10197166
875 Ga0307413_10050577
876 Ga0307413_10120369
877 Ga0307410_10101224
878 Ga0307412_10000141
879 Ga0307412_10008447
880 Ga0307412_10039162
881 Ga0307412_10303348
882 Ga0307412_10649058
883 Ga0307409_100203549
884 Ga0307409_100274030
885 Ga0307416_100021906
886 Ga0307416_100079529
887 Ga0307416_100294353
888 Ga0307416_100448360
889 Ga0307416_100486225
890 Ga0307416_100524431
891 Ga0307411_10105286
892 Ga0307415_100841392
893 Ga0307510_10000476
894 Ga0307510_10003115
895 Ga0307510_10035629
896 Ga0373939_0066062
897 Ga0373943_0003007
898 Ga0373946_0023585
899 Ga0316574_0164575
900 Ga0373931_0072767
901 Ga0373935_0011561
902 Ga0373927_0008692
903 Ga0373947_0164233
904 Ga0373947_0199009
905 Ga0373925_0000199
906 Ga0395899_0141750
907 Ga0395899_0199904
908 Ga0395900_0063657
909 Ga0395900_0642637
910 Ga0395898_0005188
911 Ga0395905_0100196
912 Ga0395905_0101655
913 Ga0436364_0221502
914 Ga0436364_0499456
915 Ga0436364_0923361
916 Ga0436364_0935252
917 Ga0395901_0036788
918 Ga0395901_0045283
919 Ga0395901_0243450
920 Ga0436365_1141016
921 Ga0436365_1569498
922 Ga0436363_0089430
923 Ga0436363_0161687
924 Ga0436363_1004894
925 Ga0436362_0088640
926 Ga0436362_1138892
927 Ga0451793_0753453
928 Ga0451807_0239534
929 Ga0451833_1342921
930 Ga0439448_0008886
931 Ga0439448_0040830
932 Ga0439448_0067799
933 Ga0439450_020352
934 Ga0439454_005230
935 Ga0439455_0018833
936 Ga0439463_024756
937 Ga0439444_0010125
938 Ga0439464_0079245
939 Ga0439440_0004575
940 Ga0466972_0132317
941 Ga0466964_0060599
942 Ga0466968_0008201
943 Ga0466957_0182141
944 Ga0466960_0000006
945 Ga0466960_0152336
946 Ga0466960_0230063
947 Ga0466960_0272210
948 Ga0451576_0051675
949 Ga0495592_0034864
950 Ga0495603_0027238
951 Ga0495638_0018846
952 Ga0495650_0000080
953 Ga0495580_0000950
954 Ga0495664_0065472
955 Ga0495584_0143022
956 Ga0495616_0000021
957 Ga0495616_0000288
958 Ga0495620_0004327
959 Ga0495628_0000323
960 Ga0495631_0000187
961 Ga0495663_0004816
962 Ga0495652_0003139
963 Ga0495654_0050796
964 Ga0495621_0015650
965 Ga0495597_0012526
966 Ga0495645_0396019
967 Ga0495668_0012025
968 Ga0495668_0021248
969 Ga0495625_0097501
970 Ga0495659_0000001
971 Ga0495659_0082447
972 Ga0495588_0041441
973 Ga0495657_0441728
974 Ga0495623_0029770
975 Ga0495658_0027252
976 Ga0495658_0081287
977 Ga0495669_0141382
978 Ga0495671_0000035
979 Ga0495671_0002335
980 Ga0495604_0008090
981 Ga0495674_0024251
982 Ga0495672_0000919
983 Ga0495672_0009186
984 Ga0495602_0161319
985 Ga0495614_0040198
986 Ga0496102_0147208
987 Ga0496103_0241258
988 Ga0496106_0001132
989 Ga0496107_0000140
990 Ga0496108_0609618
991 Ga0496109_0053502
992 Ga0496114_0044327
993 Ga0496116_0001037
994 Ga0496116_0194023
995 Ga0496117_0014279
996 Ga0496117_0070802
997 Ga0496117_0098523
998 Ga0496117_0106254
999 Ga0496118_0005148
1000 Ga0496118_0081668
1001 Ga0496118_0143809
1002 Ga0496119_0039256
1003 Ga0496119_0091261
1004 Ga0496121_0049145
1005 Ga0496121_0134148
1006 Ga0496121_0165453
1007 Ga0496121_0249236
1008 Ga0496122_0078093
1009 Ga0496123_0034929
1010 Ga0496123_0039017
1011 Ga0496124_0000098
1012 Ga0496124_0070343
1013 Ga0496124_0346191
1014 Ga0496125_0036981
1015 Ga0496125_0056258
1016 Ga0496126_0010096
1017 Ga0496126_0108702
1018 Ga0496126_0109143
1019 Ga0496126_0320602
1020 Ga0501034_0109517
1021 Ga0501034_0338524
1022 Ga0501038_0114044
1023 Ga0501040_0706591
1024 Ga0501042_0086976
1025 Ga0501043_0176363
1026 Ga0501047_0091343
1027 Ga0501067_0013073
1028 Ga0501069_0322839
1029 Ga0501070_0284870
1030 Ga0501072_0167855
1031 Ga0501073_0091965
1032 Ga0501074_0083743
1033 Ga0501076_0215434
1034 Ga0501249_000210
1035 Ga0501080_0515334
1036 Ga0501083_0001570
1037 Ga0501204_000310
1038 nmdc:mga06z11_189568_c1
1039 nmdc:mga04h51_26292_c1
1040 nmdc:mga07m45_12072_c1
1041 nmdc:mga07m45_29517_c1
1042 nmdc:mga07m45_380826_c1
1043 nmdc:mga07m45_840_c1
1044 nmdc:mga05p37_104785_c1
1045 nmdc:mga05p37_2110_c1
1046 nmdc:mga05p37_817878_c1
1047 nmdc:mga05p37_93626_c1
1048 nmdc:mga09592_12415_c1
1049 nmdc:mga09592_1286_c1
1050 nmdc:mga09592_31656_c1
1051 nmdc:mga09592_68600_c1
1052 nmdc:mga0qj67_180066_c1
1053 nmdc:mga0qj67_2658_c1
1054 nmdc:mga0qj67_5127_c1
1055 nmdc:mga06r32_160340_c1
1056 nmdc:mga06r32_19187_c1
1057 nmdc:mga06r32_304_c1
1058 nmdc:mga06r32_727_c1
1059 nmdc:mga08y16_1021_c1
1060 nmdc:mga08y16_157398_c1
1061 nmdc:mga08y16_194969_c1
1062 nmdc:mga08y16_209735_c1
1063 nmdc:mga08y16_29553_c1
1064 nmdc:mga08y16_47833_c1
1065 nmdc:mga0n895_109266_c1
1066 nmdc:mga0n895_158858_c1
1067 nmdc:mga0n895_3865_c1
1068 nmdc:mga0rr50_145433_c1
1069 nmdc:mga0rr50_29563_c1
1070 nmdc:mga0rr50_577_c1
1071 nmdc:mga0a205_132045_c1
1072 nmdc:mga0a205_161667_c1
1073 nmdc:mga0a205_2332_c1
1074 nmdc:mga0a205_434045_c1
1075 nmdc:mga0sz30_99587_c1
1076 Ga0500610_0003413
1077 Ga0500610_0026273
1078 Ga0500643_002509
1079 Ga0500651_0000267
1080 Ga0500592_001394
1081 Ga0500595_021920
1082 Ga0500595_034178
1083 Ga0500595_040950
1084 Ga0500608_001188
1085 Ga0500652_013413
1086 Ga0500655_000384
1087 Ga0500658_0000635
1088 Ga0500568_0000194
1089 Ga0500568_0001561
1090 Ga0500568_0004721
1091 Ga0500604_0007372
1092 Ga0500616_0000198
1093 Ga0500616_0004275
1094 Ga0500616_0071223
1095 Ga0500627_0003262
1096 Ga0500634_0045226
1097 Ga0500645_002293
1098 Ga0501082_0003722
1099 2508734735
1100 2509079380
1101 2599903765
1102 2643860272
1103 2644228650
1104 2644536408
1105 2672334259
1106 2691515853
1107 2738706667
1108 2738739880
1109 2738814595
1110 2738816202
1111 2739331960
1112 2753766408
1113 2776257592
1114 2831937708
1115 2835318398
1116 2851156484
1117 2884298497
1118 2894241854
1119 2904544186
1120 2939649221
1121 2984577839
1122 2990260190
1123 3001890325
1124 8003863217
1125 8054609957
1126 8056213249

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

246

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

288

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

42

178

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u7t-assembly1.cif.gz_B crystal structure of abad/hsd10 with a bound inhibitor 0.9321 7 243
7n09-assembly1.cif.gz_A structural basis for branched substrate selectivity in a ketoreductase from ascaris suum 0.9202 1 242
1e6w-assembly1.cif.gz_D rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol 0.9134 7 243
1e3w-assembly1.cif.gz_A rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate 0.9099 3 243
1e6w-assembly1.cif.gz_A rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol 0.9099 7 243
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9293 7 38 3.50.50.60
af_Q99714_1_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9281 1 243 3.40.50.720
af_Q99714_1_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9208 1 243 3.40.50.720
af_Q86JE3_1_263_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8967 1 242 3.40.50.720
4nbwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8908 7 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A352KFZ1-F1-model_v4 3-hydroxy-2-methylbutyryl-CoA dehydrogenase 0.9968 1 90 GO:0016491
AF-A0A4Q5X8K0-F1-model_v4 deleted 0.9928 1 150
AF-A0A3D2LBP7-F1-model_v4 3-hydroxy-2-methylbutyryl-CoA dehydrogenase 0.9845 1 135 GO:0016491
AF-A0A2R7IZT9-F1-model_v4 3-hydroxy-2-methylbutyryl-CoA dehydrogenase 0.982 1 124 GO:0016491
AF-A0A4Q5X8K0-F1-model_v4 deleted 0.9798 1 150

Map