F464083
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 563 | 245 | 1126 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0016330|Ga0466959_0016330_4473_5252 |
| Length | 259 |
| Sequence | MNPAQAAAGGASGRPRIGHSAAVPASTIRGARHPHRSWSEIVIERVHVIGSGRVGSAVAARLRERGVXXXVDDPDVVLLCVPDTAIADVSRCLTPGRAWVGHVSGATPLAALEPHERRFSLHPLQTFDRSGDPAQFDGAWAAVSGETDDALAIARELAEILGLQPFELADEDRTLYHAGAVFASNYLVTLERAAVRLGVPAEALVPLMTRTIENGFDLTGPIARGDWATVEAHKRAIHEAQPELEHLYETLAGATVALR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 120 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 121 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 129 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 130 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 131 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 132 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 133 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 245 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.88 |
| Rhizosphere | 90.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466959_0016330 | 3300045049 | Bacteria | 5423 |
| 2 | Ga0070658_10010313 | 3300005327 | Bacteria | 7498 |
| 3 | Ga0070658_10016021 | 3300005327 | Bacteria | 5996 |
| 4 | Ga0070683_100041457 | 3300005329 | Bacteria | 4235 |
| 5 | Ga0070683_100192959 | 3300005329 | Bacteria | 1934 |
| 6 | Ga0070683_100193260 | 3300005329 | Bacteria | 1933 |
| 7 | Ga0070670_100377520 | 3300005331 | Unclassified | 1248 |
| 8 | Ga0070677_10351284 | 3300005333 | Bacteria | 764 |
| 9 | Ga0070680_100332000 | 3300005336 | Bacteria | 1291 |
| 10 | Ga0070682_100121089 | 3300005337 | Bacteria | 1757 |
| 11 | Ga0070682_100209279 | 3300005337 | Bacteria | 1381 |
| 12 | Ga0068868_100004283 | 3300005338 | Bacteria | 9991 |
| 13 | Ga0068868_100257198 | 3300005338 | Unclassified | 1471 |
| 14 | Ga0070660_100061865 | 3300005339 | Bacteria | 2907 |
| 15 | Ga0070660_100141658 | 3300005339 | Bacteria | 1929 |
| 16 | Ga0070660_100195937 | 3300005339 | Bacteria | 1637 |
| 17 | Ga0070660_100438926 | 3300005339 | Bacteria | 1082 |
| 18 | Ga0070689_100065489 | 3300005340 | Bacteria | 2830 |
| 19 | Ga0070687_100367966 | 3300005343 | Bacteria | 933 |
| 20 | Ga0070661_100581575 | 3300005344 | Bacteria | 904 |
| 21 | Ga0070668_100139945 | 3300005347 | Bacteria | 1949 |
| 22 | Ga0070668_100771013 | 3300005347 | Bacteria | 853 |
| 23 | Ga0070671_100174569 | 3300005355 | Bacteria | 1818 |
| 24 | Ga0070671_100287221 | 3300005355 | Bacteria | 1400 |
| 25 | Ga0070714_100014293 | 3300005435 | Bacteria | 6374 |
| 26 | Ga0070714_100060585 | 3300005435 | Bacteria | 3248 |
| 27 | Ga0070714_100063992 | 3300005435 | Bacteria | 3165 |
| 28 | Ga0070714_100528531 | 3300005435 | Bacteria | 1127 |
| 29 | Ga0070710_10006454 | 3300005437 | Bacteria | 5636 |
| 30 | Ga0070710_10174144 | 3300005437 | Bacteria | 1343 |
| 31 | Ga0070710_10417852 | 3300005437 | Bacteria | 902 |
| 32 | Ga0070701_10167403 | 3300005438 | Unclassified | 1277 |
| 33 | Ga0070711_100002087 | 3300005439 | Bacteria | 11293 |
| 34 | Ga0070705_100432741 | 3300005440 | Archaea | 982 |
| 35 | Ga0070700_100091121 | 3300005441 | Unclassified | 1989 |
| 36 | Ga0070694_100070587 | 3300005444 | Bacteria | 2405 |
| 37 | Ga0070663_100184932 | 3300005455 | Unclassified | 1619 |
| 38 | Ga0070678_100045254 | 3300005456 | Bacteria | 3147 |
| 39 | Ga0070662_100136356 | 3300005457 | Bacteria | 1898 |
| 40 | Ga0070662_100261048 | 3300005457 | Bacteria | 1395 |
| 41 | Ga0070681_10302969 | 3300005458 | Bacteria | 1507 |
| 42 | Ga0068867_100034920 | 3300005459 | Bacteria | 3646 |
| 43 | Ga0070707_100001529 | 3300005468 | Bacteria | 22508 |
| 44 | Ga0070679_100036800 | 3300005530 | Bacteria | 4857 |
| 45 | Ga0070679_100079858 | 3300005530 | Bacteria | 3261 |
| 46 | Ga0070679_100157019 | 3300005530 | Unclassified | 2249 |
| 47 | Ga0070679_100270707 | 3300005530 | Bacteria | 1653 |
| 48 | Ga0070684_100382847 | 3300005535 | Bacteria | 1296 |
| 49 | Ga0070697_100337964 | 3300005536 | Bacteria | 1299 |
| 50 | Ga0068853_100099945 | 3300005539 | Bacteria | 2563 |
| 51 | Ga0068853_100472522 | 3300005539 | Bacteria | 1181 |
| 52 | Ga0070686_100102752 | 3300005544 | Bacteria | 1933 |
| 53 | Ga0070695_100000393 | 3300005545 | Bacteria | 22683 |
| 54 | Ga0070696_100207395 | 3300005546 | Bacteria | 1466 |
| 55 | Ga0070693_100116362 | 3300005547 | Unclassified | 1652 |
| 56 | Ga0070704_100365573 | 3300005549 | Unclassified | 1222 |
| 57 | Ga0068855_100040162 | 3300005563 | Bacteria | 5554 |
| 58 | Ga0070664_100618136 | 3300005564 | Bacteria | 1006 |
| 59 | Ga0068857_100583235 | 3300005577 | Bacteria | 1055 |
| 60 | Ga0068854_100253198 | 3300005578 | Bacteria | 1407 |
| 61 | Ga0068856_100067085 | 3300005614 | Bacteria | 3545 |
| 62 | Ga0068859_100480103 | 3300005617 | Archaea | 1338 |
| 63 | Ga0068864_100241633 | 3300005618 | Bacteria | 1673 |
| 64 | Ga0068861_100197183 | 3300005719 | Bacteria | 1687 |
| 65 | Ga0068870_10116039 | 3300005840 | Unclassified | 1535 |
| 66 | Ga0068870_10563988 | 3300005840 | Unclassified | 769 |
| 67 | Ga0068863_100206049 | 3300005841 | Bacteria | 1893 |
| 68 | Ga0068858_100118152 | 3300005842 | Bacteria | 2479 |
| 69 | Ga0068860_100635763 | 3300005843 | Bacteria | 1074 |
| 70 | Ga0081539_10000452 | 3300005985 | Bacteria | 87416 |
| 71 | Ga0070717_10020080 | 3300006028 | Bacteria | 5250 |
| 72 | Ga0070717_10035780 | 3300006028 | Bacteria | 4023 |
| 73 | Ga0070717_10050261 | 3300006028 | Bacteria | 3425 |
| 74 | Ga0075432_10117033 | 3300006058 | Bacteria | 998 |
| 75 | Ga0070715_10008398 | 3300006163 | Bacteria | 3596 |
| 76 | Ga0070716_100033263 | 3300006173 | Bacteria | 2818 |
| 77 | Ga0068871_100064871 | 3300006358 | Bacteria | 2990 |
| 78 | Ga0075434_100004162 | 3300006871 | Bacteria | 12965 |
| 79 | Ga0068865_100159879 | 3300006881 | Bacteria | 1717 |
| 80 | Ga0068865_100161828 | 3300006881 | Bacteria | 1708 |
| 81 | Ga0097620_100480106 | 3300006931 | Archaea | 1338 |
| 82 | Ga0097620_101017534 | 3300006931 | Bacteria | 910 |
| 83 | Ga0105240_10080227 | 3300009093 | Bacteria | 4014 |
| 84 | Ga0111539_10129457 | 3300009094 | Bacteria | 2955 |
| 85 | Ga0111539_10417988 | 3300009094 | Bacteria | 1562 |
| 86 | Ga0111539_10435949 | 3300009094 | Bacteria | 1526 |
| 87 | Ga0105245_10116191 | 3300009098 | Bacteria | 2495 |
| 88 | Ga0105245_10126474 | 3300009098 | Bacteria | 2393 |
| 89 | Ga0105245_10159326 | 3300009098 | Bacteria | 2140 |
| 90 | Ga0105245_10460277 | 3300009098 | Bacteria | 1282 |
| 91 | Ga0105243_10064215 | 3300009148 | Bacteria | 2945 |
| 92 | Ga0105243_10298539 | 3300009148 | Bacteria | 1459 |
| 93 | Ga0105242_10036840 | 3300009176 | Bacteria | 3927 |
| 94 | Ga0105248_10052290 | 3300009177 | Bacteria | 4584 |
| 95 | Ga0105248_10172047 | 3300009177 | Bacteria | 2441 |
| 96 | Ga0105248_11150368 | 3300009177 | Unclassified | 877 |
| 97 | Ga0105237_10026012 | 3300009545 | Bacteria | 5982 |
| 98 | Ga0105238_10456885 | 3300009551 | Unclassified | 1274 |
| 99 | Ga0105249_10318177 | 3300009553 | Bacteria | 1567 |
| 100 | Ga0105239_10205963 | 3300010375 | Bacteria | 2204 |
| 101 | Ga0157371_10040626 | 3300013102 | Bacteria | 3321 |
| 102 | Ga0157369_10421336 | 3300013105 | Bacteria | 1384 |
| 103 | Ga0157374_10057521 | 3300013296 | Bacteria | 3632 |
| 104 | Ga0157374_10161448 | 3300013296 | Bacteria | 2183 |
| 105 | Ga0157378_10333925 | 3300013297 | Bacteria | 1476 |
| 106 | Ga0163162_10200975 | 3300013306 | Bacteria | 2122 |
| 107 | Ga0157372_10010768 | 3300013307 | Bacteria | 9736 |
| 108 | Ga0157372_10021043 | 3300013307 | Bacteria | 7044 |
| 109 | Ga0157372_10024334 | 3300013307 | Bacteria | 6576 |
| 110 | Ga0157372_10040888 | 3300013307 | Bacteria | 5124 |
| 111 | Ga0157372_10316420 | 3300013307 | Bacteria | 1817 |
| 112 | Ga0157372_10538827 | 3300013307 | Bacteria | 1361 |
| 113 | Ga0157372_10857721 | 3300013307 | Bacteria | 1054 |
| 114 | Ga0157375_10361331 | 3300013308 | Bacteria | 1618 |
| 115 | Ga0163163_10472068 | 3300014325 | Bacteria | 1315 |
| 116 | Ga0182008_10130111 | 3300014497 | Bacteria | 1255 |
| 117 | Ga0157379_10122474 | 3300014968 | Bacteria | 2340 |
| 118 | Ga0206354_11692940 | 3300020081 | Bacteria | 1097 |
| 119 | Ga0224712_10009473 | 3300022467 | Bacteria | 2937 |
| 120 | Ga0207692_10016984 | 3300025898 | Bacteria | 3236 |
| 121 | Ga0207692_10129437 | 3300025898 | Bacteria | 1423 |
| 122 | Ga0207692_10467422 | 3300025898 | Bacteria | 796 |
| 123 | Ga0207685_10038831 | 3300025905 | Bacteria | 1763 |
| 124 | Ga0207645_10058818 | 3300025907 | Bacteria | 2454 |
| 125 | Ga0207643_10010675 | 3300025908 | Bacteria | 4950 |
| 126 | Ga0207643_10153494 | 3300025908 | Archaea | 1382 |
| 127 | Ga0207695_10171399 | 3300025913 | Bacteria | 2096 |
| 128 | Ga0207693_10000222 | 3300025915 | Bacteria | 51803 |
| 129 | Ga0207693_10000964 | 3300025915 | Bacteria | 25831 |
| 130 | Ga0207693_10496888 | 3300025915 | Unclassified | 952 |
| 131 | Ga0207663_10316814 | 3300025916 | Bacteria | 1171 |
| 132 | Ga0207662_10030248 | 3300025918 | Bacteria | 3141 |
| 133 | Ga0207657_10007527 | 3300025919 | Bacteria | 11158 |
| 134 | Ga0207657_10029136 | 3300025919 | Bacteria | 5029 |
| 135 | Ga0207657_10118569 | 3300025919 | Bacteria | 2179 |
| 136 | Ga0207652_10053007 | 3300025921 | Bacteria | 3483 |
| 137 | Ga0207646_10044724 | 3300025922 | Bacteria | 3974 |
| 138 | Ga0207646_10368398 | 3300025922 | Bacteria | 1298 |
| 139 | Ga0207694_10590108 | 3300025924 | Bacteria | 934 |
| 140 | Ga0207659_10048518 | 3300025926 | Bacteria | 3008 |
| 141 | Ga0207687_10085999 | 3300025927 | Bacteria | 2282 |
| 142 | Ga0207687_10194538 | 3300025927 | Bacteria | 1581 |
| 143 | Ga0207664_10011283 | 3300025929 | Bacteria | 6339 |
| 144 | Ga0207664_10273897 | 3300025929 | Unclassified | 1479 |
| 145 | Ga0207644_10117838 | 3300025931 | Bacteria | 2017 |
| 146 | Ga0207690_10073400 | 3300025932 | Bacteria | 2366 |
| 147 | Ga0207706_10038724 | 3300025933 | Bacteria | 4229 |
| 148 | Ga0207706_10061709 | 3300025933 | Bacteria | 3301 |
| 149 | Ga0207686_10241583 | 3300025934 | Bacteria | 1314 |
| 150 | Ga0207704_10050240 | 3300025938 | Bacteria | 2514 |
| 151 | Ga0207665_10001958 | 3300025939 | Bacteria | 13849 |
| 152 | Ga0207665_10229542 | 3300025939 | Unclassified | 1364 |
| 153 | Ga0207691_10027573 | 3300025940 | Bacteria | 5324 |
| 154 | Ga0207689_10235375 | 3300025942 | Bacteria | 1514 |
| 155 | Ga0207679_10159838 | 3300025945 | Bacteria | 1844 |
| 156 | Ga0207651_10069472 | 3300025960 | Bacteria | 2487 |
| 157 | Ga0207668_10168626 | 3300025972 | Bacteria | 1715 |
| 158 | Ga0207640_10210709 | 3300025981 | Bacteria | 1480 |
| 159 | Ga0207640_10758419 | 3300025981 | Bacteria | 837 |
| 160 | Ga0207677_10288921 | 3300026023 | Bacteria | 1349 |
| 161 | Ga0207703_10341391 | 3300026035 | Unclassified | 1376 |
| 162 | Ga0207678_10147770 | 3300026067 | Bacteria | 2006 |
| 163 | Ga0207678_10223209 | 3300026067 | Bacteria | 1613 |
| 164 | Ga0207678_10465517 | 3300026067 | Archaea | 1100 |
| 165 | Ga0207678_10560765 | 3300026067 | Unclassified | 999 |
| 166 | Ga0207708_10020388 | 3300026075 | Bacteria | 5000 |
| 167 | Ga0207708_10676558 | 3300026075 | Bacteria | 880 |
| 168 | Ga0207641_10282139 | 3300026088 | Bacteria | 1563 |
| 169 | Ga0207674_10020017 | 3300026116 | Bacteria | 7239 |
| 170 | Ga0207683_10156570 | 3300026121 | Bacteria | 2058 |
| 171 | Ga0207428_10219443 | 3300027907 | Unclassified | 1426 |
| 172 | Ga0207428_10228593 | 3300027907 | Bacteria | 1393 |
| 173 | Ga0265318_10005350 | 3300028577 | Bacteria | 6032 |
| 174 | Ga0265338_10016515 | 3300028800 | Bacteria | 8024 |
| 175 | Ga0265338_10194858 | 3300028800 | Bacteria | 1532 |
| 176 | Ga0265324_10052628 | 3300029957 | Bacteria | 1398 |
| 177 | Ga0265320_10021603 | 3300031240 | Bacteria | 3458 |
| 178 | Ga0373959_0027481 | 3300034820 | Unclassified | 1131 |
| 179 | Ga0373939_0112090 | 3300035114 | Unclassified | 951 |
| 180 | Ga0373955_0072758 | 3300035172 | Bacteria | 1926 |
| 181 | Ga0373931_0057328 | 3300035691 | Bacteria | 2089 |
| 182 | Ga0373933_0034837 | 3300035724 | Bacteria | 2937 |
| 183 | Ga0373947_0162612 | 3300035725 | Bacteria | 1445 |
| 184 | Ga0373937_0003744 | 3300036401 | Bacteria | 12853 |
| 185 | Ga0373937_0097838 | 3300036401 | Bacteria | 2722 |
| 186 | Ga0395900_0503700 | 3300037418 | Bacteria | 1161 |
| 187 | Ga0395900_0765882 | 3300037418 | Bacteria | 895 |
| 188 | Ga0395898_0196217 | 3300037466 | Bacteria | 1928 |
| 189 | Ga0242420_066492 | 3300038996 | Unclassified | 727 |
| 190 | Ga0436360_0135256 | 3300039438 | Bacteria | 6477 |
| 191 | Ga0451853_0860905 | 3300041512 | Bacteria | 971 |
| 192 | Ga0439458_0148239 | 3300042157 | Bacteria | 628 |
| 193 | Ga0466969_0000637 | 3300044656 | Bacteria | 18936 |
| 194 | Ga0466969_0039771 | 3300044656 | Bacteria | 2360 |
| 195 | Ga0466965_0080819 | 3300044683 | Bacteria | 1643 |
| 196 | Ga0466965_0087826 | 3300044683 | Bacteria | 1578 |
| 197 | Ga0466966_0013112 | 3300044684 | Bacteria | 5487 |
| 198 | Ga0466961_0010766 | 3300044693 | Bacteria | 5843 |
| 199 | Ga0466961_0045910 | 3300044693 | Bacteria | 2795 |
| 200 | Ga0466961_0248080 | 3300044693 | Bacteria | 1093 |
| 201 | Ga0466963_0012929 | 3300044694 | Bacteria | 5116 |
| 202 | Ga0466963_0015084 | 3300044694 | Bacteria | 4777 |
| 203 | Ga0466963_0020542 | 3300044694 | Bacteria | 4152 |
| 204 | Ga0466963_0073392 | 3300044694 | Bacteria | 2306 |
| 205 | Ga0466963_0083865 | 3300044694 | Bacteria | 2161 |
| 206 | Ga0466963_0176794 | 3300044694 | Bacteria | 1489 |
| 207 | Ga0466964_0003548 | 3300044706 | Bacteria | 5699 |
| 208 | Ga0466964_0009930 | 3300044706 | Unclassified | 3586 |
| 209 | Ga0466964_0010506 | 3300044706 | Bacteria | 3492 |
| 210 | Ga0466964_0010904 | 3300044706 | Bacteria | 3434 |
| 211 | Ga0466964_0014950 | 3300044706 | Bacteria | 2956 |
| 212 | Ga0466964_0015067 | 3300044706 | Bacteria | 2944 |
| 213 | Ga0466964_0015472 | 3300044706 | Bacteria | 2904 |
| 214 | Ga0466971_0013046 | 3300044719 | Bacteria | 3645 |
| 215 | Ga0466971_0023427 | 3300044719 | Bacteria | 2752 |
| 216 | Ga0466971_0035497 | 3300044719 | Bacteria | 2235 |
| 217 | Ga0466971_0176297 | 3300044719 | Bacteria | 1004 |
| 218 | Ga0466968_0001416 | 3300044735 | Bacteria | 8599 |
| 219 | Ga0466968_0007287 | 3300044735 | Bacteria | 4203 |
| 220 | Ga0466968_0011733 | 3300044735 | Bacteria | 3418 |
| 221 | Ga0466968_0028113 | 3300044735 | Bacteria | 2318 |
| 222 | Ga0466968_0052029 | 3300044735 | Bacteria | 1751 |
| 223 | Ga0466968_0189179 | 3300044735 | Bacteria | 960 |
| 224 | Ga0466970_0005839 | 3300044765 | Bacteria | 6128 |
| 225 | Ga0466970_0084493 | 3300044765 | Bacteria | 1718 |
| 226 | Ga0466970_0170980 | 3300044765 | Bacteria | 1204 |
| 227 | Ga0466970_0242525 | 3300044765 | Bacteria | 1009 |
| 228 | Ga0466957_0007567 | 3300044842 | Bacteria | 6140 |
| 229 | Ga0466957_0010736 | 3300044842 | Bacteria | 5266 |
| 230 | Ga0466957_0036525 | 3300044842 | Bacteria | 2954 |
| 231 | Ga0466957_0070261 | 3300044842 | Bacteria | 2163 |
| 232 | Ga0466957_0096056 | 3300044842 | Bacteria | 1862 |
| 233 | Ga0466957_0140205 | 3300044842 | Bacteria | 1557 |
| 234 | Ga0466959_0002503 | 3300045049 | Bacteria | 11770 |
| 235 | Ga0466959_0009993 | 3300045049 | Bacteria | 6762 |
| 236 | Ga0466959_0033624 | 3300045049 | Bacteria | 3792 |
| 237 | Ga0466959_0040433 | 3300045049 | Bacteria | 3444 |
| 238 | Ga0466958_0001766 | 3300045836 | Bacteria | 10466 |
| 239 | Ga0466958_0004817 | 3300045836 | Bacteria | 7181 |
| 240 | Ga0466958_0006747 | 3300045836 | Bacteria | 6268 |
| 241 | Ga0466958_0010503 | 3300045836 | Bacteria | 5187 |
| 242 | Ga0466958_0040015 | 3300045836 | Bacteria | 2817 |
| 243 | Ga0466958_0121933 | 3300045836 | Bacteria | 1633 |
| 244 | Ga0466958_0145518 | 3300045836 | Bacteria | 1493 |
| 245 | Ga0466958_0310712 | 3300045836 | Bacteria | 1012 |
| 246 | Ga0466967_0002062 | 3300045976 | Bacteria | 12283 |
| 247 | Ga0466967_0008127 | 3300045976 | Bacteria | 7657 |
| 248 | Ga0466967_0020238 | 3300045976 | Bacteria | 5373 |
| 249 | Ga0466967_0041042 | 3300045976 | Bacteria | 3986 |
| 250 | Ga0466967_0044450 | 3300045976 | Bacteria | 3853 |
| 251 | Ga0466967_0046505 | 3300045976 | Bacteria | 3779 |
| 252 | Ga0466967_0061147 | 3300045976 | Bacteria | 3340 |
| 253 | Ga0466967_0076473 | 3300045976 | Unclassified | 3011 |
| 254 | Ga0466967_0192833 | 3300045976 | Bacteria | 1926 |
| 255 | Ga0466967_0201217 | 3300045976 | Bacteria | 1886 |
| 256 | Ga0466967_0210857 | 3300045976 | Bacteria | 1842 |
| 257 | Ga0466967_0335292 | 3300045976 | Bacteria | 1461 |
| 258 | Ga0466967_0423871 | 3300045976 | Bacteria | 1297 |
| 259 | Ga0466967_0457436 | 3300045976 | Bacteria | 1248 |
| 260 | Ga0466967_0658856 | 3300045976 | Bacteria | 1035 |
| 261 | Ga0495592_0000716 | 3300046454 | Bacteria | 23196 |
| 262 | Ga0495592_0001615 | 3300046454 | Bacteria | 15792 |
| 263 | Ga0495603_0003662 | 3300046455 | Bacteria | 9143 |
| 264 | Ga0495603_0009298 | 3300046455 | Bacteria | 5943 |
| 265 | Ga0495629_0446076 | 3300046459 | Bacteria | 876 |
| 266 | Ga0495651_0000001 | 3300046462 | Bacteria | 210544 |
| 267 | Ga0495653_0000668 | 3300046463 | Bacteria | 26201 |
| 268 | Ga0495605_0209106 | 3300046474 | Bacteria | 848 |
| 269 | Ga0495664_0192399 | 3300046477 | Bacteria | 1236 |
| 270 | Ga0495584_0190142 | 3300046491 | Bacteria | 1043 |
| 271 | Ga0495608_0000448 | 3300046511 | Bacteria | 28730 |
| 272 | Ga0495608_0014736 | 3300046511 | Bacteria | 5426 |
| 273 | Ga0495608_0151664 | 3300046511 | Bacteria | 1477 |
| 274 | Ga0495608_0222502 | 3300046511 | Bacteria | 1184 |
| 275 | Ga0495618_0000834 | 3300046514 | Bacteria | 21394 |
| 276 | Ga0495620_0061324 | 3300046515 | Bacteria | 1565 |
| 277 | Ga0495628_0000500 | 3300046516 | Bacteria | 35932 |
| 278 | Ga0495628_0206293 | 3300046516 | Unclassified | 1479 |
| 279 | Ga0495630_0036819 | 3300046517 | Bacteria | 3657 |
| 280 | Ga0495630_0150174 | 3300046517 | Bacteria | 1772 |
| 281 | Ga0495631_0178454 | 3300046518 | Bacteria | 910 |
| 282 | Ga0495637_0060923 | 3300046520 | Bacteria | 1548 |
| 283 | Ga0495663_0044930 | 3300046525 | Bacteria | 1353 |
| 284 | Ga0495652_0000015 | 3300046529 | Bacteria | 222624 |
| 285 | Ga0495652_0193831 | 3300046529 | Bacteria | 1548 |
| 286 | Ga0495586_0241981 | 3300046535 | Bacteria | 1028 |
| 287 | Ga0495587_0000036 | 3300046536 | Bacteria | 117570 |
| 288 | Ga0495587_0018976 | 3300046536 | Bacteria | 4262 |
| 289 | Ga0495587_0028126 | 3300046536 | Unclassified | 3421 |
| 290 | Ga0495645_0000039 | 3300046543 | Bacteria | 94569 |
| 291 | Ga0495645_0028883 | 3300046543 | Unclassified | 4030 |
| 292 | Ga0495645_0227708 | 3300046543 | Bacteria | 1250 |
| 293 | Ga0495667_0029214 | 3300046559 | Bacteria | 3710 |
| 294 | Ga0495667_0039488 | 3300046559 | Bacteria | 3138 |
| 295 | Ga0495656_0069810 | 3300046615 | Bacteria | 1557 |
| 296 | Ga0495668_0044973 | 3300046616 | Bacteria | 2454 |
| 297 | Ga0495611_0032628 | 3300046648 | Bacteria | 2296 |
| 298 | Ga0495635_0154982 | 3300046663 | Bacteria | 1559 |
| 299 | Ga0495635_0222272 | 3300046663 | Bacteria | 1277 |
| 300 | Ga0495588_0125034 | 3300046674 | Unclassified | 1356 |
| 301 | Ga0495657_0004500 | 3300046675 | Bacteria | 11143 |
| 302 | Ga0495657_0121803 | 3300046675 | Bacteria | 1642 |
| 303 | Ga0495599_0000055 | 3300046678 | Bacteria | 79065 |
| 304 | Ga0495599_0000409 | 3300046678 | Bacteria | 24585 |
| 305 | Ga0495599_0341172 | 3300046678 | Unclassified | 899 |
| 306 | Ga0495623_0000445 | 3300046679 | Bacteria | 27187 |
| 307 | Ga0495623_0019915 | 3300046679 | Bacteria | 4337 |
| 308 | Ga0495646_0001458 | 3300046680 | Bacteria | 14066 |
| 309 | Ga0495647_0040949 | 3300046681 | Unclassified | 1762 |
| 310 | Ga0495624_0064031 | 3300046690 | Bacteria | 2298 |
| 311 | Ga0495624_0145321 | 3300046690 | Bacteria | 1452 |
| 312 | Ga0495624_0155129 | 3300046690 | Bacteria | 1400 |
| 313 | Ga0495670_0253804 | 3300046691 | Bacteria | 938 |
| 314 | Ga0495671_0045157 | 3300046692 | Bacteria | 2207 |
| 315 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 316 | Ga0495604_0149452 | 3300047317 | Bacteria | 1661 |
| 317 | Ga0495674_0104353 | 3300047319 | Bacteria | 2409 |
| 318 | Ga0495676_0031300 | 3300047321 | Bacteria | 4502 |
| 319 | Ga0495676_0076429 | 3300047321 | Bacteria | 2557 |
| 320 | Ga0495676_0415274 | 3300047321 | Bacteria | 891 |
| 321 | Ga0495680_0003419 | 3300047322 | Bacteria | 15661 |
| 322 | Ga0495680_0009194 | 3300047322 | Bacteria | 8912 |
| 323 | Ga0495675_0000250 | 3300047444 | Bacteria | 38818 |
| 324 | Ga0495675_0164707 | 3300047444 | Bacteria | 1364 |
| 325 | Ga0495684_0039575 | 3300047471 | Bacteria | 3614 |
| 326 | Ga0495684_0525865 | 3300047471 | Bacteria | 809 |
| 327 | Ga0495602_0000159 | 3300048088 | Bacteria | 62801 |
| 328 | Ga0495602_0007762 | 3300048088 | Bacteria | 11216 |
| 329 | Ga0495615_0020032 | 3300048090 | Bacteria | 1494 |
| 330 | Ga0496100_0093553 | 3300048903 | Bacteria | 2057 |
| 331 | Ga0496101_0026881 | 3300048904 | Bacteria | 4002 |
| 332 | Ga0496101_0142525 | 3300048904 | Unclassified | 1827 |
| 333 | Ga0496101_0156312 | 3300048904 | Bacteria | 1747 |
| 334 | Ga0496102_0015662 | 3300048905 | Bacteria | 6605 |
| 335 | Ga0496102_0494403 | 3300048905 | Unclassified | 1145 |
| 336 | Ga0496103_0026651 | 3300048906 | Bacteria | 3499 |
| 337 | Ga0496103_0103679 | 3300048906 | Bacteria | 1802 |
| 338 | Ga0496103_0189562 | 3300048906 | Bacteria | 1322 |
| 339 | Ga0496103_0306492 | 3300048906 | Bacteria | 1022 |
| 340 | Ga0496104_0002848 | 3300048907 | Bacteria | 14912 |
| 341 | Ga0496104_0183707 | 3300048907 | Unclassified | 2001 |
| 342 | Ga0496105_0005081 | 3300048908 | Bacteria | 9971 |
| 343 | Ga0496105_0047041 | 3300048908 | Bacteria | 3560 |
| 344 | Ga0496105_0051132 | 3300048908 | Bacteria | 3414 |
| 345 | Ga0496105_0102248 | 3300048908 | Bacteria | 2366 |
| 346 | Ga0496105_0442569 | 3300048908 | Bacteria | 1027 |
| 347 | Ga0496106_0105410 | 3300048909 | Bacteria | 2190 |
| 348 | Ga0496106_0128064 | 3300048909 | Bacteria | 1989 |
| 349 | Ga0496106_0245722 | 3300048909 | Bacteria | 1430 |
| 350 | Ga0496107_0018279 | 3300048910 | Bacteria | 4934 |
| 351 | Ga0496107_0089569 | 3300048910 | Bacteria | 2247 |
| 352 | Ga0496107_0091469 | 3300048910 | Bacteria | 2224 |
| 353 | Ga0496107_0173973 | 3300048910 | Unclassified | 1598 |
| 354 | Ga0496108_0006665 | 3300048911 | Bacteria | 9352 |
| 355 | Ga0496108_0012105 | 3300048911 | Bacteria | 7014 |
| 356 | Ga0496108_0053682 | 3300048911 | Bacteria | 3380 |
| 357 | Ga0496109_0001361 | 3300048912 | Bacteria | 20257 |
| 358 | Ga0496109_0016734 | 3300048912 | Bacteria | 6415 |
| 359 | Ga0496109_0041910 | 3300048912 | Bacteria | 4146 |
| 360 | Ga0496109_0074499 | 3300048912 | Bacteria | 3120 |
| 361 | Ga0496109_0098106 | 3300048912 | Bacteria | 2716 |
| 362 | Ga0496109_0193438 | 3300048912 | Bacteria | 1911 |
| 363 | Ga0496110_0000487 | 3300048913 | Bacteria | 26963 |
| 364 | Ga0496110_0062401 | 3300048913 | Bacteria | 3291 |
| 365 | Ga0496110_0199579 | 3300048913 | Bacteria | 1817 |
| 366 | Ga0496111_0001213 | 3300048914 | Bacteria | 14401 |
| 367 | Ga0496111_0187559 | 3300048914 | Bacteria | 1537 |
| 368 | Ga0496112_0049024 | 3300048915 | Bacteria | 4139 |
| 369 | Ga0496112_0094139 | 3300048915 | Bacteria | 2966 |
| 370 | Ga0496112_0100175 | 3300048915 | Bacteria | 2867 |
| 371 | Ga0496112_0211397 | 3300048915 | Bacteria | 1897 |
| 372 | Ga0496113_0117502 | 3300048916 | Bacteria | 2076 |
| 373 | Ga0496113_0480954 | 3300048916 | Bacteria | 997 |
| 374 | Ga0496114_0047139 | 3300048917 | Bacteria | 3584 |
| 375 | Ga0496114_0049632 | 3300048917 | Bacteria | 3492 |
| 376 | Ga0496114_0160166 | 3300048917 | Bacteria | 1956 |
| 377 | Ga0496115_0056592 | 3300048918 | Bacteria | 3152 |
| 378 | Ga0496115_0100246 | 3300048918 | Bacteria | 2374 |
| 379 | Ga0496115_0589701 | 3300048918 | Archaea | 885 |
| 380 | Ga0501031_0007415 | 3300049568 | Bacteria | 7146 |
| 381 | Ga0501031_0008294 | 3300049568 | Bacteria | 6758 |
| 382 | Ga0501031_0050008 | 3300049568 | Bacteria | 2724 |
| 383 | Ga0501031_0051499 | 3300049568 | Bacteria | 2681 |
| 384 | Ga0501031_0216908 | 3300049568 | Bacteria | 1246 |
| 385 | Ga0501032_0010947 | 3300049569 | Bacteria | 6522 |
| 386 | Ga0501032_0017625 | 3300049569 | Bacteria | 5013 |
| 387 | Ga0501032_0430662 | 3300049569 | Bacteria | 846 |
| 388 | Ga0501033_0000751 | 3300049570 | Bacteria | 29835 |
| 389 | Ga0501033_0044434 | 3300049570 | Bacteria | 3307 |
| 390 | Ga0501033_0134242 | 3300049570 | Bacteria | 1791 |
| 391 | Ga0501033_0162341 | 3300049570 | Bacteria | 1608 |
| 392 | Ga0501033_0163632 | 3300049570 | Bacteria | 1600 |
| 393 | Ga0501034_0002274 | 3300049571 | Bacteria | 23567 |
| 394 | Ga0501036_0007550 | 3300049572 | Bacteria | 8871 |
| 395 | Ga0501036_0022004 | 3300049572 | Bacteria | 5361 |
| 396 | Ga0501036_0117499 | 3300049572 | Bacteria | 2246 |
| 397 | Ga0501036_0134004 | 3300049572 | Bacteria | 2091 |
| 398 | Ga0501036_0144351 | 3300049572 | Bacteria | 2008 |
| 399 | Ga0501036_0181541 | 3300049572 | Bacteria | 1771 |
| 400 | Ga0501037_0011098 | 3300049573 | Bacteria | 6630 |
| 401 | Ga0501037_0042151 | 3300049573 | Bacteria | 3354 |
| 402 | Ga0501037_0099608 | 3300049573 | Bacteria | 2099 |
| 403 | Ga0501037_0323827 | 3300049573 | Bacteria | 1067 |
| 404 | Ga0501038_0014252 | 3300049574 | Bacteria | 7242 |
| 405 | Ga0501038_0078267 | 3300049574 | Bacteria | 2790 |
| 406 | Ga0501038_0128577 | 3300049574 | Bacteria | 2082 |
| 407 | Ga0501038_0280576 | 3300049574 | Bacteria | 1311 |
| 408 | Ga0501039_0003170 | 3300049575 | Bacteria | 12299 |
| 409 | Ga0501039_0007034 | 3300049575 | Bacteria | 8565 |
| 410 | Ga0501039_0009041 | 3300049575 | Bacteria | 7590 |
| 411 | Ga0501039_0036725 | 3300049575 | Bacteria | 3781 |
| 412 | Ga0501040_0000081 | 3300049576 | Bacteria | 46641 |
| 413 | Ga0501040_0005626 | 3300049576 | Bacteria | 8099 |
| 414 | Ga0501040_0016666 | 3300049576 | Bacteria | 4868 |
| 415 | Ga0501040_0020799 | 3300049576 | Bacteria | 4375 |
| 416 | Ga0501040_0142529 | 3300049576 | Bacteria | 1688 |
| 417 | Ga0501040_0172820 | 3300049576 | Bacteria | 1530 |
| 418 | Ga0501040_0209778 | 3300049576 | Bacteria | 1385 |
| 419 | Ga0501040_0289018 | 3300049576 | Bacteria | 1171 |
| 420 | Ga0501041_0000083 | 3300049577 | Bacteria | 37197 |
| 421 | Ga0501041_0019999 | 3300049577 | Bacteria | 3999 |
| 422 | Ga0501041_0046972 | 3300049577 | Bacteria | 2627 |
| 423 | Ga0501041_0089562 | 3300049577 | Bacteria | 1899 |
| 424 | Ga0501042_0000488 | 3300049578 | Bacteria | 20567 |
| 425 | Ga0501042_0006467 | 3300049578 | Bacteria | 7609 |
| 426 | Ga0501042_0030812 | 3300049578 | Bacteria | 3792 |
| 427 | Ga0501042_0096918 | 3300049578 | Bacteria | 2119 |
| 428 | Ga0501043_0052770 | 3300049579 | Bacteria | 3193 |
| 429 | Ga0501043_0066087 | 3300049579 | Bacteria | 2840 |
| 430 | Ga0501043_0532191 | 3300049579 | Bacteria | 875 |
| 431 | Ga0501046_0000510 | 3300049580 | Bacteria | 38530 |
| 432 | Ga0501046_0013681 | 3300049580 | Bacteria | 6861 |
| 433 | Ga0501046_0070511 | 3300049580 | Bacteria | 2717 |
| 434 | Ga0501046_0070725 | 3300049580 | Bacteria | 2712 |
| 435 | Ga0501046_0075180 | 3300049580 | Bacteria | 2620 |
| 436 | Ga0501046_0288625 | 3300049580 | Unclassified | 1200 |
| 437 | Ga0501047_0017519 | 3300049581 | Bacteria | 6861 |
| 438 | Ga0501048_0001274 | 3300049582 | Bacteria | 19096 |
| 439 | Ga0501048_0007663 | 3300049582 | Bacteria | 8184 |
| 440 | Ga0501048_0010808 | 3300049582 | Bacteria | 6805 |
| 441 | Ga0501048_0022993 | 3300049582 | Bacteria | 4556 |
| 442 | Ga0501048_0093571 | 3300049582 | Bacteria | 2120 |
| 443 | Ga0501048_0259986 | 3300049582 | Bacteria | 1233 |
| 444 | Ga0501048_0264313 | 3300049582 | Bacteria | 1222 |
| 445 | Ga0501067_0015926 | 3300049583 | Bacteria | 4159 |
| 446 | Ga0501067_0021321 | 3300049583 | Bacteria | 3585 |
| 447 | Ga0501067_0054241 | 3300049583 | Bacteria | 2221 |
| 448 | Ga0501068_0000266 | 3300049584 | Bacteria | 25796 |
| 449 | Ga0501068_0095264 | 3300049584 | Bacteria | 1840 |
| 450 | Ga0501068_0098491 | 3300049584 | Bacteria | 1810 |
| 451 | Ga0501069_0026234 | 3300049585 | Bacteria | 3190 |
| 452 | Ga0501069_0128911 | 3300049585 | Bacteria | 1448 |
| 453 | Ga0501069_0298481 | 3300049585 | Unclassified | 944 |
| 454 | Ga0501070_0002030 | 3300049586 | Bacteria | 17801 |
| 455 | Ga0501070_0026233 | 3300049586 | Bacteria | 4891 |
| 456 | Ga0501070_0127988 | 3300049586 | Bacteria | 2098 |
| 457 | Ga0501071_0000179 | 3300049587 | Bacteria | 28005 |
| 458 | Ga0501071_0015212 | 3300049587 | Bacteria | 5278 |
| 459 | Ga0501071_0046574 | 3300049587 | Bacteria | 3114 |
| 460 | Ga0501071_0181291 | 3300049587 | Bacteria | 1578 |
| 461 | Ga0501071_0196163 | 3300049587 | Bacteria | 1515 |
| 462 | Ga0501072_0000870 | 3300049588 | Bacteria | 22145 |
| 463 | Ga0501072_0001737 | 3300049588 | Bacteria | 16233 |
| 464 | Ga0501072_0042320 | 3300049588 | Bacteria | 3578 |
| 465 | Ga0501072_0043731 | 3300049588 | Bacteria | 3521 |
| 466 | Ga0501072_0234555 | 3300049588 | Bacteria | 1461 |
| 467 | Ga0501072_0305619 | 3300049588 | Bacteria | 1264 |
| 468 | Ga0501072_0784819 | 3300049588 | Bacteria | 746 |
| 469 | Ga0501073_0004319 | 3300049589 | Bacteria | 10669 |
| 470 | Ga0501073_0043371 | 3300049589 | Bacteria | 3172 |
| 471 | Ga0501074_0007927 | 3300049590 | Bacteria | 7691 |
| 472 | Ga0501074_0010525 | 3300049590 | Bacteria | 6712 |
| 473 | Ga0501074_0010566 | 3300049590 | Bacteria | 6701 |
| 474 | Ga0501074_0066039 | 3300049590 | Bacteria | 2603 |
| 475 | Ga0501074_0118819 | 3300049590 | Bacteria | 1890 |
| 476 | Ga0501074_0209255 | 3300049590 | Bacteria | 1390 |
| 477 | Ga0501074_0232742 | 3300049590 | Bacteria | 1311 |
| 478 | Ga0501074_0502696 | 3300049590 | Bacteria | 859 |
| 479 | Ga0501075_0000298 | 3300049591 | Bacteria | 27595 |
| 480 | Ga0501075_0001882 | 3300049591 | Bacteria | 13848 |
| 481 | Ga0501075_0076521 | 3300049591 | Bacteria | 2531 |
| 482 | Ga0501075_0121402 | 3300049591 | Bacteria | 1988 |
| 483 | Ga0501076_0005387 | 3300049592 | Bacteria | 9194 |
| 484 | Ga0501076_0005397 | 3300049592 | Bacteria | 9187 |
| 485 | Ga0501076_0009148 | 3300049592 | Bacteria | 7296 |
| 486 | Ga0501076_0030134 | 3300049592 | Bacteria | 4225 |
| 487 | Ga0501076_0114771 | 3300049592 | Bacteria | 2179 |
| 488 | Ga0501076_0195982 | 3300049592 | Bacteria | 1649 |
| 489 | Ga0501077_0000718 | 3300049593 | Bacteria | 20025 |
| 490 | Ga0501077_0029055 | 3300049593 | Bacteria | 3514 |
| 491 | Ga0501077_0053641 | 3300049593 | Bacteria | 2559 |
| 492 | Ga0501077_0093304 | 3300049593 | Bacteria | 1908 |
| 493 | Ga0501079_0001566 | 3300049741 | Bacteria | 16231 |
| 494 | Ga0501079_0066175 | 3300049741 | Bacteria | 2788 |
| 495 | Ga0501079_0094574 | 3300049741 | Bacteria | 2315 |
| 496 | Ga0501079_0145329 | 3300049741 | Bacteria | 1848 |
| 497 | Ga0501079_0151966 | 3300049741 | Bacteria | 1804 |
| 498 | Ga0501079_0243477 | 3300049741 | Bacteria | 1405 |
| 499 | Ga0501079_0293315 | 3300049741 | Bacteria | 1272 |
| 500 | Ga0501079_0377727 | 3300049741 | Bacteria | 1111 |
| 501 | Ga0501080_0000450 | 3300049742 | Bacteria | 31992 |
| 502 | Ga0501080_0086353 | 3300049742 | Bacteria | 2915 |
| 503 | Ga0501080_0222737 | 3300049742 | Bacteria | 1726 |
| 504 | Ga0501080_0291151 | 3300049742 | Bacteria | 1482 |
| 505 | Ga0501081_0000447 | 3300049743 | Bacteria | 22828 |
| 506 | Ga0501081_0001529 | 3300049743 | Bacteria | 14201 |
| 507 | Ga0501081_0014636 | 3300049743 | Bacteria | 5176 |
| 508 | Ga0501081_0025411 | 3300049743 | Bacteria | 3983 |
| 509 | Ga0501081_0113712 | 3300049743 | Bacteria | 1922 |
| 510 | Ga0501081_0152810 | 3300049743 | Bacteria | 1659 |
| 511 | Ga0501081_0271038 | 3300049743 | Bacteria | 1241 |
| 512 | Ga0501083_0008619 | 3300049744 | Bacteria | 7195 |
| 513 | Ga0501083_0021582 | 3300049744 | Bacteria | 4472 |
| 514 | Ga0501083_0197713 | 3300049744 | Bacteria | 1311 |
| 515 | Ga0501083_0377192 | 3300049744 | Unclassified | 922 |
| 516 | Ga0501035_0015755 | 3300049822 | Bacteria | 6977 |
| 517 | Ga0501035_0052097 | 3300049822 | Bacteria | 3662 |
| 518 | Ga0501035_0080313 | 3300049822 | Bacteria | 2880 |
| 519 | Ga0501035_0293341 | 3300049822 | Bacteria | 1372 |
| 520 | Ga0501044_0014722 | 3300049823 | Bacteria | 8433 |
| 521 | Ga0501044_0106019 | 3300049823 | Bacteria | 2823 |
| 522 | Ga0501044_0211897 | 3300049823 | Bacteria | 1891 |
| 523 | Ga0501045_0002012 | 3300049824 | Bacteria | 13738 |
| 524 | Ga0501045_0003128 | 3300049824 | Bacteria | 11316 |
| 525 | Ga0501045_0013233 | 3300049824 | Bacteria | 5821 |
| 526 | Ga0501045_0049421 | 3300049824 | Bacteria | 3066 |
| 527 | Ga0501045_0090156 | 3300049824 | Bacteria | 2265 |
| 528 | Ga0501045_0337607 | 3300049824 | Bacteria | 1121 |
| 529 | nmdc:mga08y16_158838_c1 | 3300050511 | Bacteria | 2349 |
| 530 | nmdc:mga08y16_303386_c1 | 3300050511 | Unclassified | 1646 |
| 531 | nmdc:mga0n895_3482_c1 | 3300050512 | Bacteria | 12703 |
| 532 | Ga0495601_0000183 | 3300053077 | Bacteria | 33204 |
| 533 | Ga0495601_0086561 | 3300053077 | Bacteria | 2013 |
| 534 | Ga0495601_0092174 | 3300053077 | Bacteria | 1951 |
| 535 | Ga0495601_0120211 | 3300053077 | Unclassified | 1705 |
| 536 | Ga0495601_0134664 | 3300053077 | Bacteria | 1610 |
| 537 | Ga0495655_0044131 | 3300053083 | Bacteria | 1152 |
| 538 | Ga0495595_0055077 | 3300053084 | Bacteria | 1851 |
| 539 | Ga0495595_0305455 | 3300053084 | Unclassified | 800 |
| 540 | Ga0495619_0001430 | 3300053085 | Bacteria | 15694 |
| 541 | Ga0495619_0082017 | 3300053085 | Bacteria | 2173 |
| 542 | Ga0495619_0153962 | 3300053085 | Unclassified | 1586 |
| 543 | Ga0501084_0008560 | 3300054114 | Bacteria | 8459 |
| 544 | Ga0501084_0067535 | 3300054114 | Bacteria | 2992 |
| 545 | Ga0501084_0116557 | 3300054114 | Bacteria | 2245 |
| 546 | Ga0501084_0128113 | 3300054114 | Bacteria | 2136 |
| 547 | Ga0501084_0254413 | 3300054114 | Bacteria | 1482 |
| 548 | Ga0501084_0268144 | 3300054114 | Bacteria | 1441 |
| 549 | Ga0590075_044865 | 3300059424 | Bacteria | 1132 |
| 550 | Ga0501082_0002126 | 3300060353 | Bacteria | 17424 |
| 551 | Ga0501082_0002732 | 3300060353 | Bacteria | 15414 |
| 552 | Ga0501082_0005344 | 3300060353 | Bacteria | 11152 |
| 553 | Ga0501082_0087914 | 3300060353 | Bacteria | 2681 |
| 554 | Ga0501082_0159404 | 3300060353 | Bacteria | 1960 |
| 555 | Ga0466962_0057707 | 3300061719 | Bacteria | 1853 |
| 556 | Ga0466962_0060228 | 3300061719 | Bacteria | 1812 |
| 557 | Ga0466962_0069754 | 3300061719 | Bacteria | 1678 |
| 558 | Ga0530510_0002824 | 3300061734 | Bacteria | 11945 |
| 559 | Ga0530510_0002903 | 3300061734 | Bacteria | 11747 |
| 560 | Ga0530510_0006456 | 3300061734 | Bacteria | 8166 |
| 561 | Ga0530510_0014787 | 3300061734 | Bacteria | 5510 |
| 562 | Ga0530510_0062373 | 3300061734 | Bacteria | 2698 |
| 563 | Ga0530510_0604464 | 3300061734 | Bacteria | 834 |
| 564 | Ga0466959_0016330 | |||
| 565 | Ga0070658_10010313 | |||
| 566 | Ga0070658_10016021 | |||
| 567 | Ga0070683_100041457 | |||
| 568 | Ga0070683_100192959 | |||
| 569 | Ga0070683_100193260 | |||
| 570 | Ga0070670_100377520 | |||
| 571 | Ga0070677_10351284 | |||
| 572 | Ga0070680_100332000 | |||
| 573 | Ga0070682_100121089 | |||
| 574 | Ga0070682_100209279 | |||
| 575 | Ga0068868_100004283 | |||
| 576 | Ga0068868_100257198 | |||
| 577 | Ga0070660_100061865 | |||
| 578 | Ga0070660_100141658 | |||
| 579 | Ga0070660_100195937 | |||
| 580 | Ga0070660_100438926 | |||
| 581 | Ga0070689_100065489 | |||
| 582 | Ga0070687_100367966 | |||
| 583 | Ga0070661_100581575 | |||
| 584 | Ga0070668_100139945 | |||
| 585 | Ga0070668_100771013 | |||
| 586 | Ga0070671_100174569 | |||
| 587 | Ga0070671_100287221 | |||
| 588 | Ga0070714_100014293 | |||
| 589 | Ga0070714_100060585 | |||
| 590 | Ga0070714_100063992 | |||
| 591 | Ga0070714_100528531 | |||
| 592 | Ga0070710_10006454 | |||
| 593 | Ga0070710_10174144 | |||
| 594 | Ga0070710_10417852 | |||
| 595 | Ga0070701_10167403 | |||
| 596 | Ga0070711_100002087 | |||
| 597 | Ga0070705_100432741 | |||
| 598 | Ga0070700_100091121 | |||
| 599 | Ga0070694_100070587 | |||
| 600 | Ga0070663_100184932 | |||
| 601 | Ga0070678_100045254 | |||
| 602 | Ga0070662_100136356 | |||
| 603 | Ga0070662_100261048 | |||
| 604 | Ga0070681_10302969 | |||
| 605 | Ga0068867_100034920 | |||
| 606 | Ga0070707_100001529 | |||
| 607 | Ga0070679_100036800 | |||
| 608 | Ga0070679_100079858 | |||
| 609 | Ga0070679_100157019 | |||
| 610 | Ga0070679_100270707 | |||
| 611 | Ga0070684_100382847 | |||
| 612 | Ga0070697_100337964 | |||
| 613 | Ga0068853_100099945 | |||
| 614 | Ga0068853_100472522 | |||
| 615 | Ga0070686_100102752 | |||
| 616 | Ga0070695_100000393 | |||
| 617 | Ga0070696_100207395 | |||
| 618 | Ga0070693_100116362 | |||
| 619 | Ga0070704_100365573 | |||
| 620 | Ga0068855_100040162 | |||
| 621 | Ga0070664_100618136 | |||
| 622 | Ga0068857_100583235 | |||
| 623 | Ga0068854_100253198 | |||
| 624 | Ga0068856_100067085 | |||
| 625 | Ga0068859_100480103 | |||
| 626 | Ga0068864_100241633 | |||
| 627 | Ga0068861_100197183 | |||
| 628 | Ga0068870_10116039 | |||
| 629 | Ga0068870_10563988 | |||
| 630 | Ga0068863_100206049 | |||
| 631 | Ga0068858_100118152 | |||
| 632 | Ga0068860_100635763 | |||
| 633 | Ga0081539_10000452 | |||
| 634 | Ga0070717_10020080 | |||
| 635 | Ga0070717_10035780 | |||
| 636 | Ga0070717_10050261 | |||
| 637 | Ga0075432_10117033 | |||
| 638 | Ga0070715_10008398 | |||
| 639 | Ga0070716_100033263 | |||
| 640 | Ga0068871_100064871 | |||
| 641 | Ga0075434_100004162 | |||
| 642 | Ga0068865_100159879 | |||
| 643 | Ga0068865_100161828 | |||
| 644 | Ga0097620_100480106 | |||
| 645 | Ga0097620_101017534 | |||
| 646 | Ga0105240_10080227 | |||
| 647 | Ga0111539_10129457 | |||
| 648 | Ga0111539_10417988 | |||
| 649 | Ga0111539_10435949 | |||
| 650 | Ga0105245_10116191 | |||
| 651 | Ga0105245_10126474 | |||
| 652 | Ga0105245_10159326 | |||
| 653 | Ga0105245_10460277 | |||
| 654 | Ga0105243_10064215 | |||
| 655 | Ga0105243_10298539 | |||
| 656 | Ga0105242_10036840 | |||
| 657 | Ga0105248_10052290 | |||
| 658 | Ga0105248_10172047 | |||
| 659 | Ga0105248_11150368 | |||
| 660 | Ga0105237_10026012 | |||
| 661 | Ga0105238_10456885 | |||
| 662 | Ga0105249_10318177 | |||
| 663 | Ga0105239_10205963 | |||
| 664 | Ga0157371_10040626 | |||
| 665 | Ga0157369_10421336 | |||
| 666 | Ga0157374_10057521 | |||
| 667 | Ga0157374_10161448 | |||
| 668 | Ga0157378_10333925 | |||
| 669 | Ga0163162_10200975 | |||
| 670 | Ga0157372_10010768 | |||
| 671 | Ga0157372_10021043 | |||
| 672 | Ga0157372_10024334 | |||
| 673 | Ga0157372_10040888 | |||
| 674 | Ga0157372_10316420 | |||
| 675 | Ga0157372_10538827 | |||
| 676 | Ga0157372_10857721 | |||
| 677 | Ga0157375_10361331 | |||
| 678 | Ga0163163_10472068 | |||
| 679 | Ga0182008_10130111 | |||
| 680 | Ga0157379_10122474 | |||
| 681 | Ga0206354_11692940 | |||
| 682 | Ga0224712_10009473 | |||
| 683 | Ga0207692_10016984 | |||
| 684 | Ga0207692_10129437 | |||
| 685 | Ga0207692_10467422 | |||
| 686 | Ga0207685_10038831 | |||
| 687 | Ga0207645_10058818 | |||
| 688 | Ga0207643_10010675 | |||
| 689 | Ga0207643_10153494 | |||
| 690 | Ga0207695_10171399 | |||
| 691 | Ga0207693_10000222 | |||
| 692 | Ga0207693_10000964 | |||
| 693 | Ga0207693_10496888 | |||
| 694 | Ga0207663_10316814 | |||
| 695 | Ga0207662_10030248 | |||
| 696 | Ga0207657_10007527 | |||
| 697 | Ga0207657_10029136 | |||
| 698 | Ga0207657_10118569 | |||
| 699 | Ga0207652_10053007 | |||
| 700 | Ga0207646_10044724 | |||
| 701 | Ga0207646_10368398 | |||
| 702 | Ga0207694_10590108 | |||
| 703 | Ga0207659_10048518 | |||
| 704 | Ga0207687_10085999 | |||
| 705 | Ga0207687_10194538 | |||
| 706 | Ga0207664_10011283 | |||
| 707 | Ga0207664_10273897 | |||
| 708 | Ga0207644_10117838 | |||
| 709 | Ga0207690_10073400 | |||
| 710 | Ga0207706_10038724 | |||
| 711 | Ga0207706_10061709 | |||
| 712 | Ga0207686_10241583 | |||
| 713 | Ga0207704_10050240 | |||
| 714 | Ga0207665_10001958 | |||
| 715 | Ga0207665_10229542 | |||
| 716 | Ga0207691_10027573 | |||
| 717 | Ga0207689_10235375 | |||
| 718 | Ga0207679_10159838 | |||
| 719 | Ga0207651_10069472 | |||
| 720 | Ga0207668_10168626 | |||
| 721 | Ga0207640_10210709 | |||
| 722 | Ga0207640_10758419 | |||
| 723 | Ga0207677_10288921 | |||
| 724 | Ga0207703_10341391 | |||
| 725 | Ga0207678_10147770 | |||
| 726 | Ga0207678_10223209 | |||
| 727 | Ga0207678_10465517 | |||
| 728 | Ga0207678_10560765 | |||
| 729 | Ga0207708_10020388 | |||
| 730 | Ga0207708_10676558 | |||
| 731 | Ga0207641_10282139 | |||
| 732 | Ga0207674_10020017 | |||
| 733 | Ga0207683_10156570 | |||
| 734 | Ga0207428_10219443 | |||
| 735 | Ga0207428_10228593 | |||
| 736 | Ga0265318_10005350 | |||
| 737 | Ga0265338_10016515 | |||
| 738 | Ga0265338_10194858 | |||
| 739 | Ga0265324_10052628 | |||
| 740 | Ga0265320_10021603 | |||
| 741 | Ga0373959_0027481 | |||
| 742 | Ga0373939_0112090 | |||
| 743 | Ga0373955_0072758 | |||
| 744 | Ga0373931_0057328 | |||
| 745 | Ga0373933_0034837 | |||
| 746 | Ga0373947_0162612 | |||
| 747 | Ga0373937_0003744 | |||
| 748 | Ga0373937_0097838 | |||
| 749 | Ga0395900_0503700 | |||
| 750 | Ga0395900_0765882 | |||
| 751 | Ga0395898_0196217 | |||
| 752 | Ga0242420_066492 | |||
| 753 | Ga0436360_0135256 | |||
| 754 | Ga0451853_0860905 | |||
| 755 | Ga0439458_0148239 | |||
| 756 | Ga0466969_0000637 | |||
| 757 | Ga0466969_0039771 | |||
| 758 | Ga0466965_0080819 | |||
| 759 | Ga0466965_0087826 | |||
| 760 | Ga0466966_0013112 | |||
| 761 | Ga0466961_0010766 | |||
| 762 | Ga0466961_0045910 | |||
| 763 | Ga0466961_0248080 | |||
| 764 | Ga0466963_0012929 | |||
| 765 | Ga0466963_0015084 | |||
| 766 | Ga0466963_0020542 | |||
| 767 | Ga0466963_0073392 | |||
| 768 | Ga0466963_0083865 | |||
| 769 | Ga0466963_0176794 | |||
| 770 | Ga0466964_0003548 | |||
| 771 | Ga0466964_0009930 | |||
| 772 | Ga0466964_0010506 | |||
| 773 | Ga0466964_0010904 | |||
| 774 | Ga0466964_0014950 | |||
| 775 | Ga0466964_0015067 | |||
| 776 | Ga0466964_0015472 | |||
| 777 | Ga0466971_0013046 | |||
| 778 | Ga0466971_0023427 | |||
| 779 | Ga0466971_0035497 | |||
| 780 | Ga0466971_0176297 | |||
| 781 | Ga0466968_0001416 | |||
| 782 | Ga0466968_0007287 | |||
| 783 | Ga0466968_0011733 | |||
| 784 | Ga0466968_0028113 | |||
| 785 | Ga0466968_0052029 | |||
| 786 | Ga0466968_0189179 | |||
| 787 | Ga0466970_0005839 | |||
| 788 | Ga0466970_0084493 | |||
| 789 | Ga0466970_0170980 | |||
| 790 | Ga0466970_0242525 | |||
| 791 | Ga0466957_0007567 | |||
| 792 | Ga0466957_0010736 | |||
| 793 | Ga0466957_0036525 | |||
| 794 | Ga0466957_0070261 | |||
| 795 | Ga0466957_0096056 | |||
| 796 | Ga0466957_0140205 | |||
| 797 | Ga0466959_0002503 | |||
| 798 | Ga0466959_0009993 | |||
| 799 | Ga0466959_0033624 | |||
| 800 | Ga0466959_0040433 | |||
| 801 | Ga0466958_0001766 | |||
| 802 | Ga0466958_0004817 | |||
| 803 | Ga0466958_0006747 | |||
| 804 | Ga0466958_0010503 | |||
| 805 | Ga0466958_0040015 | |||
| 806 | Ga0466958_0121933 | |||
| 807 | Ga0466958_0145518 | |||
| 808 | Ga0466958_0310712 | |||
| 809 | Ga0466967_0002062 | |||
| 810 | Ga0466967_0008127 | |||
| 811 | Ga0466967_0020238 | |||
| 812 | Ga0466967_0041042 | |||
| 813 | Ga0466967_0044450 | |||
| 814 | Ga0466967_0046505 | |||
| 815 | Ga0466967_0061147 | |||
| 816 | Ga0466967_0076473 | |||
| 817 | Ga0466967_0192833 | |||
| 818 | Ga0466967_0201217 | |||
| 819 | Ga0466967_0210857 | |||
| 820 | Ga0466967_0335292 | |||
| 821 | Ga0466967_0423871 | |||
| 822 | Ga0466967_0457436 | |||
| 823 | Ga0466967_0658856 | |||
| 824 | Ga0495592_0000716 | |||
| 825 | Ga0495592_0001615 | |||
| 826 | Ga0495603_0003662 | |||
| 827 | Ga0495603_0009298 | |||
| 828 | Ga0495629_0446076 | |||
| 829 | Ga0495651_0000001 | |||
| 830 | Ga0495653_0000668 | |||
| 831 | Ga0495605_0209106 | |||
| 832 | Ga0495664_0192399 | |||
| 833 | Ga0495584_0190142 | |||
| 834 | Ga0495608_0000448 | |||
| 835 | Ga0495608_0014736 | |||
| 836 | Ga0495608_0151664 | |||
| 837 | Ga0495608_0222502 | |||
| 838 | Ga0495618_0000834 | |||
| 839 | Ga0495620_0061324 | |||
| 840 | Ga0495628_0000500 | |||
| 841 | Ga0495628_0206293 | |||
| 842 | Ga0495630_0036819 | |||
| 843 | Ga0495630_0150174 | |||
| 844 | Ga0495631_0178454 | |||
| 845 | Ga0495637_0060923 | |||
| 846 | Ga0495663_0044930 | |||
| 847 | Ga0495652_0000015 | |||
| 848 | Ga0495652_0193831 | |||
| 849 | Ga0495586_0241981 | |||
| 850 | Ga0495587_0000036 | |||
| 851 | Ga0495587_0018976 | |||
| 852 | Ga0495587_0028126 | |||
| 853 | Ga0495645_0000039 | |||
| 854 | Ga0495645_0028883 | |||
| 855 | Ga0495645_0227708 | |||
| 856 | Ga0495667_0029214 | |||
| 857 | Ga0495667_0039488 | |||
| 858 | Ga0495656_0069810 | |||
| 859 | Ga0495668_0044973 | |||
| 860 | Ga0495611_0032628 | |||
| 861 | Ga0495635_0154982 | |||
| 862 | Ga0495635_0222272 | |||
| 863 | Ga0495588_0125034 | |||
| 864 | Ga0495657_0004500 | |||
| 865 | Ga0495657_0121803 | |||
| 866 | Ga0495599_0000055 | |||
| 867 | Ga0495599_0000409 | |||
| 868 | Ga0495599_0341172 | |||
| 869 | Ga0495623_0000445 | |||
| 870 | Ga0495623_0019915 | |||
| 871 | Ga0495646_0001458 | |||
| 872 | Ga0495647_0040949 | |||
| 873 | Ga0495624_0064031 | |||
| 874 | Ga0495624_0145321 | |||
| 875 | Ga0495624_0155129 | |||
| 876 | Ga0495670_0253804 | |||
| 877 | Ga0495671_0045157 | |||
| 878 | Ga0495604_0000004 | |||
| 879 | Ga0495604_0149452 | |||
| 880 | Ga0495674_0104353 | |||
| 881 | Ga0495676_0031300 | |||
| 882 | Ga0495676_0076429 | |||
| 883 | Ga0495676_0415274 | |||
| 884 | Ga0495680_0003419 | |||
| 885 | Ga0495680_0009194 | |||
| 886 | Ga0495675_0000250 | |||
| 887 | Ga0495675_0164707 | |||
| 888 | Ga0495684_0039575 | |||
| 889 | Ga0495684_0525865 | |||
| 890 | Ga0495602_0000159 | |||
| 891 | Ga0495602_0007762 | |||
| 892 | Ga0495615_0020032 | |||
| 893 | Ga0496100_0093553 | |||
| 894 | Ga0496101_0026881 | |||
| 895 | Ga0496101_0142525 | |||
| 896 | Ga0496101_0156312 | |||
| 897 | Ga0496102_0015662 | |||
| 898 | Ga0496102_0494403 | |||
| 899 | Ga0496103_0026651 | |||
| 900 | Ga0496103_0103679 | |||
| 901 | Ga0496103_0189562 | |||
| 902 | Ga0496103_0306492 | |||
| 903 | Ga0496104_0002848 | |||
| 904 | Ga0496104_0183707 | |||
| 905 | Ga0496105_0005081 | |||
| 906 | Ga0496105_0047041 | |||
| 907 | Ga0496105_0051132 | |||
| 908 | Ga0496105_0102248 | |||
| 909 | Ga0496105_0442569 | |||
| 910 | Ga0496106_0105410 | |||
| 911 | Ga0496106_0128064 | |||
| 912 | Ga0496106_0245722 | |||
| 913 | Ga0496107_0018279 | |||
| 914 | Ga0496107_0089569 | |||
| 915 | Ga0496107_0091469 | |||
| 916 | Ga0496107_0173973 | |||
| 917 | Ga0496108_0006665 | |||
| 918 | Ga0496108_0012105 | |||
| 919 | Ga0496108_0053682 | |||
| 920 | Ga0496109_0001361 | |||
| 921 | Ga0496109_0016734 | |||
| 922 | Ga0496109_0041910 | |||
| 923 | Ga0496109_0074499 | |||
| 924 | Ga0496109_0098106 | |||
| 925 | Ga0496109_0193438 | |||
| 926 | Ga0496110_0000487 | |||
| 927 | Ga0496110_0062401 | |||
| 928 | Ga0496110_0199579 | |||
| 929 | Ga0496111_0001213 | |||
| 930 | Ga0496111_0187559 | |||
| 931 | Ga0496112_0049024 | |||
| 932 | Ga0496112_0094139 | |||
| 933 | Ga0496112_0100175 | |||
| 934 | Ga0496112_0211397 | |||
| 935 | Ga0496113_0117502 | |||
| 936 | Ga0496113_0480954 | |||
| 937 | Ga0496114_0047139 | |||
| 938 | Ga0496114_0049632 | |||
| 939 | Ga0496114_0160166 | |||
| 940 | Ga0496115_0056592 | |||
| 941 | Ga0496115_0100246 | |||
| 942 | Ga0496115_0589701 | |||
| 943 | Ga0501031_0007415 | |||
| 944 | Ga0501031_0008294 | |||
| 945 | Ga0501031_0050008 | |||
| 946 | Ga0501031_0051499 | |||
| 947 | Ga0501031_0216908 | |||
| 948 | Ga0501032_0010947 | |||
| 949 | Ga0501032_0017625 | |||
| 950 | Ga0501032_0430662 | |||
| 951 | Ga0501033_0000751 | |||
| 952 | Ga0501033_0044434 | |||
| 953 | Ga0501033_0134242 | |||
| 954 | Ga0501033_0162341 | |||
| 955 | Ga0501033_0163632 | |||
| 956 | Ga0501034_0002274 | |||
| 957 | Ga0501036_0007550 | |||
| 958 | Ga0501036_0022004 | |||
| 959 | Ga0501036_0117499 | |||
| 960 | Ga0501036_0134004 | |||
| 961 | Ga0501036_0144351 | |||
| 962 | Ga0501036_0181541 | |||
| 963 | Ga0501037_0011098 | |||
| 964 | Ga0501037_0042151 | |||
| 965 | Ga0501037_0099608 | |||
| 966 | Ga0501037_0323827 | |||
| 967 | Ga0501038_0014252 | |||
| 968 | Ga0501038_0078267 | |||
| 969 | Ga0501038_0128577 | |||
| 970 | Ga0501038_0280576 | |||
| 971 | Ga0501039_0003170 | |||
| 972 | Ga0501039_0007034 | |||
| 973 | Ga0501039_0009041 | |||
| 974 | Ga0501039_0036725 | |||
| 975 | Ga0501040_0000081 | |||
| 976 | Ga0501040_0005626 | |||
| 977 | Ga0501040_0016666 | |||
| 978 | Ga0501040_0020799 | |||
| 979 | Ga0501040_0142529 | |||
| 980 | Ga0501040_0172820 | |||
| 981 | Ga0501040_0209778 | |||
| 982 | Ga0501040_0289018 | |||
| 983 | Ga0501041_0000083 | |||
| 984 | Ga0501041_0019999 | |||
| 985 | Ga0501041_0046972 | |||
| 986 | Ga0501041_0089562 | |||
| 987 | Ga0501042_0000488 | |||
| 988 | Ga0501042_0006467 | |||
| 989 | Ga0501042_0030812 | |||
| 990 | Ga0501042_0096918 | |||
| 991 | Ga0501043_0052770 | |||
| 992 | Ga0501043_0066087 | |||
| 993 | Ga0501043_0532191 | |||
| 994 | Ga0501046_0000510 | |||
| 995 | Ga0501046_0013681 | |||
| 996 | Ga0501046_0070511 | |||
| 997 | Ga0501046_0070725 | |||
| 998 | Ga0501046_0075180 | |||
| 999 | Ga0501046_0288625 | |||
| 1000 | Ga0501047_0017519 | |||
| 1001 | Ga0501048_0001274 | |||
| 1002 | Ga0501048_0007663 | |||
| 1003 | Ga0501048_0010808 | |||
| 1004 | Ga0501048_0022993 | |||
| 1005 | Ga0501048_0093571 | |||
| 1006 | Ga0501048_0259986 | |||
| 1007 | Ga0501048_0264313 | |||
| 1008 | Ga0501067_0015926 | |||
| 1009 | Ga0501067_0021321 | |||
| 1010 | Ga0501067_0054241 | |||
| 1011 | Ga0501068_0000266 | |||
| 1012 | Ga0501068_0095264 | |||
| 1013 | Ga0501068_0098491 | |||
| 1014 | Ga0501069_0026234 | |||
| 1015 | Ga0501069_0128911 | |||
| 1016 | Ga0501069_0298481 | |||
| 1017 | Ga0501070_0002030 | |||
| 1018 | Ga0501070_0026233 | |||
| 1019 | Ga0501070_0127988 | |||
| 1020 | Ga0501071_0000179 | |||
| 1021 | Ga0501071_0015212 | |||
| 1022 | Ga0501071_0046574 | |||
| 1023 | Ga0501071_0181291 | |||
| 1024 | Ga0501071_0196163 | |||
| 1025 | Ga0501072_0000870 | |||
| 1026 | Ga0501072_0001737 | |||
| 1027 | Ga0501072_0042320 | |||
| 1028 | Ga0501072_0043731 | |||
| 1029 | Ga0501072_0234555 | |||
| 1030 | Ga0501072_0305619 | |||
| 1031 | Ga0501072_0784819 | |||
| 1032 | Ga0501073_0004319 | |||
| 1033 | Ga0501073_0043371 | |||
| 1034 | Ga0501074_0007927 | |||
| 1035 | Ga0501074_0010525 | |||
| 1036 | Ga0501074_0010566 | |||
| 1037 | Ga0501074_0066039 | |||
| 1038 | Ga0501074_0118819 | |||
| 1039 | Ga0501074_0209255 | |||
| 1040 | Ga0501074_0232742 | |||
| 1041 | Ga0501074_0502696 | |||
| 1042 | Ga0501075_0000298 | |||
| 1043 | Ga0501075_0001882 | |||
| 1044 | Ga0501075_0076521 | |||
| 1045 | Ga0501075_0121402 | |||
| 1046 | Ga0501076_0005387 | |||
| 1047 | Ga0501076_0005397 | |||
| 1048 | Ga0501076_0009148 | |||
| 1049 | Ga0501076_0030134 | |||
| 1050 | Ga0501076_0114771 | |||
| 1051 | Ga0501076_0195982 | |||
| 1052 | Ga0501077_0000718 | |||
| 1053 | Ga0501077_0029055 | |||
| 1054 | Ga0501077_0053641 | |||
| 1055 | Ga0501077_0093304 | |||
| 1056 | Ga0501079_0001566 | |||
| 1057 | Ga0501079_0066175 | |||
| 1058 | Ga0501079_0094574 | |||
| 1059 | Ga0501079_0145329 | |||
| 1060 | Ga0501079_0151966 | |||
| 1061 | Ga0501079_0243477 | |||
| 1062 | Ga0501079_0293315 | |||
| 1063 | Ga0501079_0377727 | |||
| 1064 | Ga0501080_0000450 | |||
| 1065 | Ga0501080_0086353 | |||
| 1066 | Ga0501080_0222737 | |||
| 1067 | Ga0501080_0291151 | |||
| 1068 | Ga0501081_0000447 | |||
| 1069 | Ga0501081_0001529 | |||
| 1070 | Ga0501081_0014636 | |||
| 1071 | Ga0501081_0025411 | |||
| 1072 | Ga0501081_0113712 | |||
| 1073 | Ga0501081_0152810 | |||
| 1074 | Ga0501081_0271038 | |||
| 1075 | Ga0501083_0008619 | |||
| 1076 | Ga0501083_0021582 | |||
| 1077 | Ga0501083_0197713 | |||
| 1078 | Ga0501083_0377192 | |||
| 1079 | Ga0501035_0015755 | |||
| 1080 | Ga0501035_0052097 | |||
| 1081 | Ga0501035_0080313 | |||
| 1082 | Ga0501035_0293341 | |||
| 1083 | Ga0501044_0014722 | |||
| 1084 | Ga0501044_0106019 | |||
| 1085 | Ga0501044_0211897 | |||
| 1086 | Ga0501045_0002012 | |||
| 1087 | Ga0501045_0003128 | |||
| 1088 | Ga0501045_0013233 | |||
| 1089 | Ga0501045_0049421 | |||
| 1090 | Ga0501045_0090156 | |||
| 1091 | Ga0501045_0337607 | |||
| 1092 | nmdc:mga08y16_158838_c1 | |||
| 1093 | nmdc:mga08y16_303386_c1 | |||
| 1094 | nmdc:mga0n895_3482_c1 | |||
| 1095 | Ga0495601_0000183 | |||
| 1096 | Ga0495601_0086561 | |||
| 1097 | Ga0495601_0092174 | |||
| 1098 | Ga0495601_0120211 | |||
| 1099 | Ga0495601_0134664 | |||
| 1100 | Ga0495655_0044131 | |||
| 1101 | Ga0495595_0055077 | |||
| 1102 | Ga0495595_0305455 | |||
| 1103 | Ga0495619_0001430 | |||
| 1104 | Ga0495619_0082017 | |||
| 1105 | Ga0495619_0153962 | |||
| 1106 | Ga0501084_0008560 | |||
| 1107 | Ga0501084_0067535 | |||
| 1108 | Ga0501084_0116557 | |||
| 1109 | Ga0501084_0128113 | |||
| 1110 | Ga0501084_0254413 | |||
| 1111 | Ga0501084_0268144 | |||
| 1112 | Ga0590075_044865 | |||
| 1113 | Ga0501082_0002126 | |||
| 1114 | Ga0501082_0002732 | |||
| 1115 | Ga0501082_0005344 | |||
| 1116 | Ga0501082_0087914 | |||
| 1117 | Ga0501082_0159404 | |||
| 1118 | Ga0466962_0057707 | |||
| 1119 | Ga0466962_0060228 | |||
| 1120 | Ga0466962_0069754 | |||
| 1121 | Ga0530510_0002824 | |||
| 1122 | Ga0530510_0002903 | |||
| 1123 | Ga0530510_0006456 | |||
| 1124 | Ga0530510_0014787 | |||
| 1125 | Ga0530510_0062373 | |||
| 1126 | Ga0530510_0604464 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d1l-assembly1.cif.gz_B | crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis | 0.8208 | 1 | 220 |
| 2i76-assembly1.cif.gz_B | crystal structure of protein tm1727 from thermotoga maritima | 0.801 | 5 | 222 |
| 3d1l-assembly1.cif.gz_B | crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis | 0.7889 | 1 | 220 |
| 2i76-assembly1.cif.gz_A | crystal structure of protein tm1727 from thermotoga maritima | 0.7692 | 5 | 226 |
| 2i76-assembly1.cif.gz_B | crystal structure of protein tm1727 from thermotoga maritima | 0.7631 | 5 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06279_7_172_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8726 | 4 | 125 | 3.40.50.720 |
| 2f1kD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.839 | 4 | 127 | 3.40.50.720 |
| af_P9WPZ9_10_289_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8206 | 4 | 62 | 3.50.50.60 |
| af_O69721_5_180_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8068 | 2 | 130 | 3.40.50.720 |
| 3d1lA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7766 | 3 | 128 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0SK36-F1-model_v4 | DUF2520 domain-containing protein | 0.9752 | 32 | 223 |
|
| AF-A0A7W0S275-F1-model_v4 | Uncharacterized protein | 0.9736 | 20 | 117 |
|
| AF-A0A538JYS5-F1-model_v4 | DUF2520 domain-containing protein | 0.9724 | 3 | 228 |
|
| AF-A0A538EIS6-F1-model_v4 | DUF2520 domain-containing protein | 0.9718 | 3 | 219 |
|
| AF-A0A3N5GNB7-F1-model_v4 | DUF2520 domain-containing protein | 0.9717 | 1 | 217 |
|