F464102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 563 | 248 | 1126 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300049529|Ga0501313_006245|Ga0501313_006245_516_1037 |
| Length | 173 |
| Sequence | MSRNESVQKRLQKVRAPRVQMSYDVEIGDAVESKELPFVMGVVGDFAGASQIEQKKLKDRKFVGVDRDTFDDVMKGIAPRAAYRVPNELTPEGGEFSVDLTFESMNDFRPESVVEQVEPLRKLLEARTRLADLRNKLAGNDKLEDILSXXLSNTEKLAELSRASATPPRNDKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 29 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 42 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 53 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 77 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 78 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 79 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 81 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 82 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 83 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 84 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 85 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 86 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 87 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 88 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 91 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 92 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 93 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 94 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 95 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 96 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 97 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 98 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 99 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 100 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 101 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 102 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 103 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 104 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 105 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 106 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 107 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 108 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 109 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 110 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 111 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 112 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 113 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 114 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 199 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 200 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 203 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 204 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 205 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 206 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 207 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 208 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 217 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 218 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 221 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 222 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 224 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 225 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 226 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 228 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 229 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 230 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 231 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 232 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 233 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 234 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 235 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 236 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 237 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 238 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 239 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 240 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 241 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 242 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 243 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 244 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 245 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 246 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 247 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 248 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.49 |
| Metatranscriptomes | 1.07 |
| Isolates | 4.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.04 |
| Nodule | 0.18 |
| Rhizoplane | 5.68 |
| Rhizosphere | 78.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501313_006245 | 3300049529 | Bacteria | 1285 |
| 2 | JGI25150J39212_1002686 | 3300002774 | Bacteria | 4336 |
| 3 | JGI25159J45721_1004405 | 3300002987 | Bacteria | 4683 |
| 4 | Ga0006759J45824_1049560 | 3300003163 | Bacteria | 1988 |
| 5 | rootL2_10178613 | 3300003322 | Bacteria | 2314 |
| 6 | Ga0055525_1000047 | 3300003759 | Bacteria | 261507 |
| 7 | Ga0055526_1003332 | 3300003771 | Bacteria | 10268 |
| 8 | Ga0055537_1000248 | 3300003773 | Bacteria | 39459 |
| 9 | Ga0055524_1000021 | 3300003775 | Bacteria | 227578 |
| 10 | Ga0055524_1005175 | 3300003775 | Bacteria | 5876 |
| 11 | Ga0055534_1000318 | 3300003784 | Bacteria | 31952 |
| 12 | Ga0055528_1000116 | 3300003790 | Bacteria | 63713 |
| 13 | Ga0055543_1006681 | 3300004625 | Bacteria | 2753 |
| 14 | Ga0065165_1000630 | 3300005262 | Bacteria | 51211 |
| 15 | Ga0065165_1032915 | 3300005262 | Bacteria | 1620 |
| 16 | Ga0065714_10119742 | 3300005288 | Bacteria | 1363 |
| 17 | Ga0070658_10187716 | 3300005327 | Bacteria | 1741 |
| 18 | Ga0070682_100577336 | 3300005337 | Bacteria | 884 |
| 19 | Ga0070660_100049675 | 3300005339 | Bacteria | 3225 |
| 20 | Ga0070660_100184814 | 3300005339 | Bacteria | 1687 |
| 21 | Ga0070660_100436355 | 3300005339 | Bacteria | 1085 |
| 22 | Ga0070661_100108999 | 3300005344 | Bacteria | 2066 |
| 23 | Ga0070659_100411039 | 3300005366 | Bacteria | 1143 |
| 24 | Ga0070663_100109839 | 3300005455 | Bacteria | 2071 |
| 25 | Ga0070662_100215759 | 3300005457 | Bacteria | 1529 |
| 26 | Ga0070662_100746708 | 3300005457 | Bacteria | 830 |
| 27 | Ga0070672_100593160 | 3300005543 | Bacteria | 964 |
| 28 | Ga0068855_100081836 | 3300005563 | Bacteria | 3742 |
| 29 | Ga0070664_100098391 | 3300005564 | Bacteria | 2541 |
| 30 | Ga0068856_100226794 | 3300005614 | Bacteria | 1884 |
| 31 | Ga0068852_100172577 | 3300005616 | Bacteria | 2028 |
| 32 | Ga0070716_100178177 | 3300006173 | Bacteria | 1393 |
| 33 | Ga0075367_10151836 | 3300006178 | Bacteria | 1438 |
| 34 | Ga0068865_100236463 | 3300006881 | Bacteria | 1436 |
| 35 | Ga0105245_10110816 | 3300009098 | Bacteria | 2552 |
| 36 | Ga0105243_10125915 | 3300009148 | Bacteria | 2167 |
| 37 | Ga0105241_10583003 | 3300009174 | Bacteria | 1008 |
| 38 | Ga0105242_10022993 | 3300009176 | Bacteria | 4911 |
| 39 | Ga0105248_11456117 | 3300009177 | Bacteria | 775 |
| 40 | Ga0105237_10280296 | 3300009545 | Bacteria | 1669 |
| 41 | Ga0105238_10187663 | 3300009551 | Bacteria | 2044 |
| 42 | Ga0157373_10231832 | 3300013100 | Bacteria | 1304 |
| 43 | Ga0157371_10502872 | 3300013102 | Bacteria | 895 |
| 44 | Ga0157369_10794764 | 3300013105 | Bacteria | 972 |
| 45 | Ga0157374_10918875 | 3300013296 | Bacteria | 893 |
| 46 | Ga0182008_10000228 | 3300014497 | Bacteria | 43946 |
| 47 | Ga0182008_10006642 | 3300014497 | Bacteria | 6441 |
| 48 | Ga0182006_1000142 | 3300015261 | Bacteria | 76916 |
| 49 | Ga0182007_10000231 | 3300015262 | Bacteria | 37454 |
| 50 | Ga0182005_1000090 | 3300015265 | Bacteria | 68199 |
| 51 | Ga0163161_10058471 | 3300017792 | Bacteria | 2802 |
| 52 | Ga0163161_10065577 | 3300017792 | Bacteria | 2650 |
| 53 | Ga0209436_108583 | 3300025208 | Bacteria | 2021 |
| 54 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 55 | Ga0207425_1000318 | 3300025245 | Bacteria | 34531 |
| 56 | Ga0209677_102029 | 3300025253 | Bacteria | 8033 |
| 57 | Ga0209148_1001353 | 3300025254 | Bacteria | 12872 |
| 58 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 59 | Ga0209673_1000019 | 3300025273 | Bacteria | 449094 |
| 60 | Ga0209130_1003480 | 3300025284 | Bacteria | 6644 |
| 61 | Ga0209675_1000028 | 3300025291 | Bacteria | 281253 |
| 62 | Ga0209025_1003609 | 3300025294 | Bacteria | 14413 |
| 63 | Ga0209564_1000058 | 3300025295 | Bacteria | 332955 |
| 64 | Ga0209564_1021418 | 3300025295 | Bacteria | 2325 |
| 65 | Ga0209758_1000675 | 3300025297 | Bacteria | 50917 |
| 66 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 67 | Ga0209256_1000093 | 3300025299 | Bacteria | 209318 |
| 68 | Ga0207426_1036634 | 3300025302 | Bacteria | 1558 |
| 69 | Ga0207705_10074561 | 3300025909 | Bacteria | 2463 |
| 70 | Ga0207705_10421702 | 3300025909 | Bacteria | 1033 |
| 71 | Ga0207654_10061273 | 3300025911 | Bacteria | 2201 |
| 72 | Ga0207671_10143141 | 3300025914 | Bacteria | 1843 |
| 73 | Ga0207657_10003522 | 3300025919 | Bacteria | 16718 |
| 74 | Ga0207657_10032076 | 3300025919 | Bacteria | 4750 |
| 75 | Ga0207657_10215831 | 3300025919 | Bacteria | 1538 |
| 76 | Ga0207657_10272440 | 3300025919 | Bacteria | 1345 |
| 77 | Ga0207694_10106979 | 3300025924 | Bacteria | 2222 |
| 78 | Ga0207687_10467552 | 3300025927 | Bacteria | 1048 |
| 79 | Ga0207690_10104052 | 3300025932 | Bacteria | 2033 |
| 80 | Ga0207706_10005937 | 3300025933 | Bacteria | 11359 |
| 81 | Ga0207706_10106679 | 3300025933 | Bacteria | 2465 |
| 82 | Ga0207686_10002979 | 3300025934 | Bacteria | 9125 |
| 83 | Ga0207704_10159109 | 3300025938 | Bacteria | 1605 |
| 84 | Ga0207665_10216039 | 3300025939 | Bacteria | 1403 |
| 85 | Ga0207667_10018225 | 3300025949 | Bacteria | 7878 |
| 86 | Ga0207678_10669588 | 3300026067 | Bacteria | 912 |
| 87 | Ga0207702_11169880 | 3300026078 | Bacteria | 763 |
| 88 | Ga0207698_10353097 | 3300026142 | Bacteria | 1390 |
| 89 | Ga0209974_10002896 | 3300027876 | Bacteria | 6225 |
| 90 | Ga0307515_10000381 | 3300028794 | Bacteria | 108373 |
| 91 | Ga0307515_10002386 | 3300028794 | Bacteria | 40952 |
| 92 | Ga0307515_10009310 | 3300028794 | Bacteria | 19001 |
| 93 | Ga0307512_10064991 | 3300030522 | Bacteria | 2772 |
| 94 | Ga0307512_10247649 | 3300030522 | Bacteria | 892 |
| 95 | Ga0265328_10106892 | 3300031239 | Bacteria | 1038 |
| 96 | Ga0265327_10000205 | 3300031251 | Bacteria | 123596 |
| 97 | Ga0307513_10009505 | 3300031456 | Bacteria | 12297 |
| 98 | Ga0307509_10241816 | 3300031507 | Bacteria | 1597 |
| 99 | Ga0307408_100000735 | 3300031548 | Bacteria | 26492 |
| 100 | Ga0307508_10000194 | 3300031616 | Bacteria | 73425 |
| 101 | Ga0307514_10014297 | 3300031649 | Bacteria | 6574 |
| 102 | Ga0307516_10009770 | 3300031730 | Bacteria | 10643 |
| 103 | Ga0307507_10011647 | 3300033179 | Bacteria | 11041 |
| 104 | Ga0373939_0032490 | 3300035114 | Bacteria | 1517 |
| 105 | Ga0395899_0002576 | 3300037312 | Bacteria | 14635 |
| 106 | Ga0395899_0078926 | 3300037312 | Bacteria | 2398 |
| 107 | Ga0395900_0000763 | 3300037418 | Bacteria | 42856 |
| 108 | Ga0395900_0179082 | 3300037418 | Bacteria | 2155 |
| 109 | Ga0395900_0190798 | 3300037418 | Bacteria | 2078 |
| 110 | Ga0395900_0255632 | 3300037418 | Bacteria | 1751 |
| 111 | Ga0395900_0284786 | 3300037418 | Bacteria | 1643 |
| 112 | Ga0395900_0382423 | 3300037418 | Bacteria | 1375 |
| 113 | Ga0395900_0446947 | 3300037418 | Bacteria | 1249 |
| 114 | Ga0395898_0056317 | 3300037466 | Bacteria | 3832 |
| 115 | Ga0395898_0892230 | 3300037466 | Bacteria | 827 |
| 116 | Ga0395905_0072684 | 3300037471 | Bacteria | 3224 |
| 117 | Ga0395905_0124627 | 3300037471 | Bacteria | 2422 |
| 118 | Ga0395905_0132405 | 3300037471 | Bacteria | 2345 |
| 119 | Ga0395905_0242639 | 3300037471 | Bacteria | 1683 |
| 120 | Ga0395905_0409058 | 3300037471 | Bacteria | 1252 |
| 121 | Ga0395905_0491859 | 3300037471 | Bacteria | 1126 |
| 122 | Ga0395901_0000097 | 3300038443 | Bacteria | 118528 |
| 123 | Ga0395901_0053904 | 3300038443 | Bacteria | 4179 |
| 124 | Ga0395901_0082617 | 3300038443 | Bacteria | 3356 |
| 125 | Ga0395901_0145881 | 3300038443 | Bacteria | 2487 |
| 126 | Ga0395901_0270960 | 3300038443 | Bacteria | 1766 |
| 127 | Ga0395901_0318499 | 3300038443 | Bacteria | 1609 |
| 128 | Ga0395901_0449224 | 3300038443 | Bacteria | 1318 |
| 129 | Ga0395901_1425133 | 3300038443 | Bacteria | 650 |
| 130 | Ga0395901_1645216 | 3300038443 | Bacteria | 594 |
| 131 | Ga0436361_0674642 | 3300039447 | Bacteria | 25335 |
| 132 | Ga0451789_0916289 | 3300041443 | Bacteria | 2109 |
| 133 | Ga0451791_0523573 | 3300041451 | Bacteria | 1326 |
| 134 | Ga0451795_0697288 | 3300041456 | Bacteria | 985 |
| 135 | Ga0451798_0428385 | 3300041458 | Bacteria | 1221 |
| 136 | Ga0451800_0130513 | 3300041459 | Bacteria | 2091 |
| 137 | Ga0451833_0498765 | 3300041491 | Bacteria | 1108 |
| 138 | Ga0451841_1119001 | 3300041498 | Bacteria | 2269 |
| 139 | Ga0451849_0995850 | 3300041505 | Bacteria | 1075 |
| 140 | Ga0451843_0325161 | 3300041509 | Bacteria | 730 |
| 141 | Ga0451853_0705861 | 3300041512 | Bacteria | 4119 |
| 142 | Ga0439448_0088639 | 3300042005 | Bacteria | 1044 |
| 143 | Ga0439450_093292 | 3300042008 | Bacteria | 758 |
| 144 | Ga0439450_160617 | 3300042008 | Bacteria | 592 |
| 145 | Ga0439458_0134152 | 3300042157 | Bacteria | 657 |
| 146 | Ga0466969_0075719 | 3300044656 | Bacteria | 1612 |
| 147 | Ga0466969_0102468 | 3300044656 | Bacteria | 1346 |
| 148 | Ga0466969_0161251 | 3300044656 | Bacteria | 1030 |
| 149 | Ga0466969_0186935 | 3300044656 | Bacteria | 947 |
| 150 | Ga0466972_0148977 | 3300044658 | Bacteria | 1100 |
| 151 | Ga0466965_0001236 | 3300044683 | Bacteria | 10110 |
| 152 | Ga0466965_0008112 | 3300044683 | Bacteria | 4851 |
| 153 | Ga0466965_0083980 | 3300044683 | Bacteria | 1612 |
| 154 | Ga0466965_0091692 | 3300044683 | Bacteria | 1546 |
| 155 | Ga0466966_0025511 | 3300044684 | Bacteria | 3859 |
| 156 | Ga0466966_0041914 | 3300044684 | Bacteria | 2940 |
| 157 | Ga0466966_0053136 | 3300044684 | Bacteria | 2570 |
| 158 | Ga0466966_0058430 | 3300044684 | Bacteria | 2437 |
| 159 | Ga0466966_0757039 | 3300044684 | Bacteria | 585 |
| 160 | Ga0466961_0116076 | 3300044693 | Bacteria | 1682 |
| 161 | Ga0466963_0032740 | 3300044694 | Bacteria | 3368 |
| 162 | Ga0466964_0000163 | 3300044706 | Bacteria | 18439 |
| 163 | Ga0466964_0043842 | 3300044706 | Bacteria | 1815 |
| 164 | Ga0466970_0048703 | 3300044765 | Bacteria | 2260 |
| 165 | Ga0466970_0192753 | 3300044765 | Bacteria | 1133 |
| 166 | Ga0466957_0000007 | 3300044842 | Bacteria | 84513 |
| 167 | Ga0466957_0027093 | 3300044842 | Bacteria | 3404 |
| 168 | Ga0466957_0098671 | 3300044842 | Bacteria | 1838 |
| 169 | Ga0466957_0106670 | 3300044842 | Bacteria | 1772 |
| 170 | Ga0466960_0114381 | 3300044901 | Bacteria | 1406 |
| 171 | Ga0466960_0643677 | 3300044901 | Bacteria | 632 |
| 172 | Ga0466959_0029414 | 3300045049 | Bacteria | 4070 |
| 173 | Ga0466959_0287050 | 3300045049 | Bacteria | 1128 |
| 174 | Ga0466958_0064190 | 3300045836 | Bacteria | 2239 |
| 175 | Ga0466958_0098425 | 3300045836 | Bacteria | 1816 |
| 176 | Ga0466958_0223926 | 3300045836 | Bacteria | 1200 |
| 177 | Ga0466958_0448723 | 3300045836 | Bacteria | 835 |
| 178 | Ga0466967_0001164 | 3300045976 | Bacteria | 14741 |
| 179 | Ga0466967_0176830 | 3300045976 | Bacteria | 2011 |
| 180 | Ga0466967_0250612 | 3300045976 | Bacteria | 1691 |
| 181 | Ga0495627_000255 | 3300046453 | Bacteria | 54602 |
| 182 | Ga0495627_006218 | 3300046453 | Bacteria | 4700 |
| 183 | Ga0495627_006421 | 3300046453 | Bacteria | 4610 |
| 184 | Ga0495603_0309309 | 3300046455 | Bacteria | 907 |
| 185 | Ga0495629_0046219 | 3300046459 | Bacteria | 3054 |
| 186 | Ga0495638_0084028 | 3300046460 | Bacteria | 1927 |
| 187 | Ga0495638_0084275 | 3300046460 | Bacteria | 1924 |
| 188 | Ga0495638_0115682 | 3300046460 | Bacteria | 1589 |
| 189 | Ga0495653_0158082 | 3300046463 | Bacteria | 1576 |
| 190 | Ga0495650_0000477 | 3300046471 | Bacteria | 61376 |
| 191 | Ga0495650_0013865 | 3300046471 | Bacteria | 4235 |
| 192 | Ga0495650_0048992 | 3300046471 | Bacteria | 1757 |
| 193 | Ga0495605_0000024 | 3300046474 | Bacteria | 236016 |
| 194 | Ga0495605_0000044 | 3300046474 | Bacteria | 182513 |
| 195 | Ga0495605_0000236 | 3300046474 | Bacteria | 67212 |
| 196 | Ga0495605_0014617 | 3300046474 | Bacteria | 4292 |
| 197 | Ga0495605_0016225 | 3300046474 | Bacteria | 4034 |
| 198 | Ga0495605_0344993 | 3300046474 | Bacteria | 625 |
| 199 | Ga0495584_0000003 | 3300046491 | Bacteria | 323768 |
| 200 | Ga0495584_0000097 | 3300046491 | Bacteria | 59505 |
| 201 | Ga0495584_0000657 | 3300046491 | Bacteria | 23045 |
| 202 | Ga0495584_0009984 | 3300046491 | Bacteria | 4873 |
| 203 | Ga0495584_0019199 | 3300046491 | Bacteria | 3472 |
| 204 | Ga0495584_0021517 | 3300046491 | Bacteria | 3275 |
| 205 | Ga0495584_0027783 | 3300046491 | Bacteria | 2866 |
| 206 | Ga0495584_0043264 | 3300046491 | Bacteria | 2273 |
| 207 | Ga0495584_0062019 | 3300046491 | Bacteria | 1879 |
| 208 | Ga0495584_0082372 | 3300046491 | Bacteria | 1619 |
| 209 | Ga0495584_0299689 | 3300046491 | Bacteria | 816 |
| 210 | Ga0495585_0000130 | 3300046492 | Bacteria | 81689 |
| 211 | Ga0495585_0000655 | 3300046492 | Bacteria | 31822 |
| 212 | Ga0495585_0000807 | 3300046492 | Bacteria | 27258 |
| 213 | Ga0495585_0001776 | 3300046492 | Bacteria | 16376 |
| 214 | Ga0495585_0006830 | 3300046492 | Bacteria | 7038 |
| 215 | Ga0495585_0008154 | 3300046492 | Bacteria | 6364 |
| 216 | Ga0495585_0037898 | 3300046492 | Bacteria | 2714 |
| 217 | Ga0495585_0068838 | 3300046492 | Bacteria | 1932 |
| 218 | Ga0495585_0103274 | 3300046492 | Bacteria | 1522 |
| 219 | Ga0495594_0144113 | 3300046499 | Bacteria | 1351 |
| 220 | Ga0495596_0001049 | 3300046500 | Bacteria | 16417 |
| 221 | Ga0495596_0005896 | 3300046500 | Bacteria | 5721 |
| 222 | Ga0495596_0007439 | 3300046500 | Bacteria | 4941 |
| 223 | Ga0495596_0010212 | 3300046500 | Bacteria | 4097 |
| 224 | Ga0495596_0029115 | 3300046500 | Bacteria | 2215 |
| 225 | Ga0495607_0001317 | 3300046501 | Bacteria | 22137 |
| 226 | Ga0495607_0001333 | 3300046501 | Bacteria | 22039 |
| 227 | Ga0495607_0002811 | 3300046501 | Bacteria | 13834 |
| 228 | Ga0495607_0013597 | 3300046501 | Bacteria | 5328 |
| 229 | Ga0495607_0014224 | 3300046501 | Bacteria | 5189 |
| 230 | Ga0495607_0037431 | 3300046501 | Bacteria | 2915 |
| 231 | Ga0495607_0056778 | 3300046501 | Bacteria | 2246 |
| 232 | Ga0495607_0093853 | 3300046501 | Bacteria | 1620 |
| 233 | Ga0495607_0228469 | 3300046501 | Bacteria | 906 |
| 234 | Ga0495583_0000235 | 3300046506 | Bacteria | 91939 |
| 235 | Ga0495583_0000560 | 3300046506 | Bacteria | 51454 |
| 236 | Ga0495583_0001243 | 3300046506 | Bacteria | 27052 |
| 237 | Ga0495583_0007311 | 3300046506 | Bacteria | 6972 |
| 238 | Ga0495583_0014241 | 3300046506 | Bacteria | 4396 |
| 239 | Ga0495583_0015784 | 3300046506 | Bacteria | 4090 |
| 240 | Ga0495606_0000229 | 3300046507 | Bacteria | 98732 |
| 241 | Ga0495606_0000537 | 3300046507 | Bacteria | 61013 |
| 242 | Ga0495606_0002327 | 3300046507 | Bacteria | 22401 |
| 243 | Ga0495606_0005020 | 3300046507 | Bacteria | 12897 |
| 244 | Ga0495606_0015478 | 3300046507 | Bacteria | 5873 |
| 245 | Ga0495606_0063852 | 3300046507 | Bacteria | 2345 |
| 246 | Ga0495606_0118496 | 3300046507 | Bacteria | 1587 |
| 247 | Ga0495606_0149490 | 3300046507 | Bacteria | 1372 |
| 248 | Ga0495606_0213926 | 3300046507 | Bacteria | 1090 |
| 249 | Ga0495606_0223020 | 3300046507 | Bacteria | 1061 |
| 250 | Ga0495610_0003072 | 3300046512 | Bacteria | 13335 |
| 251 | Ga0495616_0000634 | 3300046513 | Bacteria | 26282 |
| 252 | Ga0495616_0000913 | 3300046513 | Bacteria | 21264 |
| 253 | Ga0495616_0003494 | 3300046513 | Bacteria | 10051 |
| 254 | Ga0495616_0005288 | 3300046513 | Bacteria | 7958 |
| 255 | Ga0495616_0023002 | 3300046513 | Bacteria | 3358 |
| 256 | Ga0495616_0038749 | 3300046513 | Bacteria | 2445 |
| 257 | Ga0495616_0046097 | 3300046513 | Bacteria | 2202 |
| 258 | Ga0495616_0084115 | 3300046513 | Bacteria | 1517 |
| 259 | Ga0495616_0134870 | 3300046513 | Bacteria | 1128 |
| 260 | Ga0495616_0212917 | 3300046513 | Bacteria | 845 |
| 261 | Ga0495628_1040392 | 3300046516 | Bacteria | 562 |
| 262 | Ga0495631_0005485 | 3300046518 | Bacteria | 6631 |
| 263 | Ga0495631_0014378 | 3300046518 | Bacteria | 3821 |
| 264 | Ga0495631_0050090 | 3300046518 | Bacteria | 1827 |
| 265 | Ga0495631_0055205 | 3300046518 | Bacteria | 1730 |
| 266 | Ga0495631_0193837 | 3300046518 | Bacteria | 869 |
| 267 | Ga0495632_0000203 | 3300046519 | Bacteria | 60607 |
| 268 | Ga0495632_0000225 | 3300046519 | Bacteria | 57394 |
| 269 | Ga0495632_0005704 | 3300046519 | Bacteria | 8171 |
| 270 | Ga0495632_0009707 | 3300046519 | Bacteria | 5776 |
| 271 | Ga0495632_0016996 | 3300046519 | Bacteria | 4029 |
| 272 | Ga0495643_0000171 | 3300046522 | Bacteria | 103167 |
| 273 | Ga0495643_0002430 | 3300046522 | Bacteria | 14806 |
| 274 | Ga0495643_0004286 | 3300046522 | Bacteria | 10060 |
| 275 | Ga0495643_0014827 | 3300046522 | Bacteria | 4627 |
| 276 | Ga0495643_0039456 | 3300046522 | Bacteria | 2582 |
| 277 | Ga0495643_0059539 | 3300046522 | Bacteria | 2030 |
| 278 | Ga0495643_0063034 | 3300046522 | Bacteria | 1961 |
| 279 | Ga0495643_0170049 | 3300046522 | Bacteria | 1066 |
| 280 | Ga0495644_0006396 | 3300046523 | Bacteria | 4567 |
| 281 | Ga0495644_0056827 | 3300046523 | Bacteria | 1470 |
| 282 | Ga0495648_0000003 | 3300046524 | Bacteria | 386817 |
| 283 | Ga0495648_0000290 | 3300046524 | Bacteria | 57025 |
| 284 | Ga0495648_0000863 | 3300046524 | Bacteria | 31958 |
| 285 | Ga0495663_0205456 | 3300046525 | Bacteria | 688 |
| 286 | Ga0495642_0000065 | 3300046528 | Bacteria | 63401 |
| 287 | Ga0495642_0000125 | 3300046528 | Bacteria | 43793 |
| 288 | Ga0495642_0002169 | 3300046528 | Bacteria | 8059 |
| 289 | Ga0495642_0009551 | 3300046528 | Bacteria | 3712 |
| 290 | Ga0495642_0066558 | 3300046528 | Bacteria | 1501 |
| 291 | Ga0495642_0074366 | 3300046528 | Bacteria | 1424 |
| 292 | Ga0495642_0074589 | 3300046528 | Bacteria | 1422 |
| 293 | Ga0495642_0100954 | 3300046528 | Bacteria | 1228 |
| 294 | Ga0495642_0111907 | 3300046528 | Bacteria | 1168 |
| 295 | Ga0495654_0026371 | 3300046530 | Bacteria | 2987 |
| 296 | Ga0495654_0039194 | 3300046530 | Bacteria | 2366 |
| 297 | Ga0495654_0070954 | 3300046530 | Bacteria | 1651 |
| 298 | Ga0495654_0230825 | 3300046530 | Bacteria | 778 |
| 299 | Ga0495665_0142865 | 3300046531 | Bacteria | 1250 |
| 300 | Ga0495665_0519442 | 3300046531 | Bacteria | 599 |
| 301 | Ga0495640_0046100 | 3300046533 | Bacteria | 3023 |
| 302 | Ga0495586_0010261 | 3300046535 | Bacteria | 4981 |
| 303 | Ga0495609_0000030 | 3300046538 | Bacteria | 215885 |
| 304 | Ga0495609_0000140 | 3300046538 | Bacteria | 76163 |
| 305 | Ga0495609_0001927 | 3300046538 | Bacteria | 13189 |
| 306 | Ga0495609_0014277 | 3300046538 | Bacteria | 3738 |
| 307 | Ga0495609_0053355 | 3300046538 | Bacteria | 1797 |
| 308 | Ga0495609_0089068 | 3300046538 | Bacteria | 1343 |
| 309 | Ga0495609_0094040 | 3300046538 | Bacteria | 1302 |
| 310 | Ga0495609_0119236 | 3300046538 | Bacteria | 1135 |
| 311 | Ga0495597_0007929 | 3300046542 | Bacteria | 5351 |
| 312 | Ga0495597_0008345 | 3300046542 | Bacteria | 5190 |
| 313 | Ga0495597_0020828 | 3300046542 | Bacteria | 3050 |
| 314 | Ga0495597_0068152 | 3300046542 | Bacteria | 1538 |
| 315 | Ga0495597_0125224 | 3300046542 | Bacteria | 1068 |
| 316 | Ga0495597_0369615 | 3300046542 | Bacteria | 548 |
| 317 | Ga0495622_0140563 | 3300046557 | Bacteria | 1096 |
| 318 | Ga0495633_0002846 | 3300046558 | Bacteria | 11908 |
| 319 | Ga0495633_0010022 | 3300046558 | Bacteria | 5199 |
| 320 | Ga0495633_0027799 | 3300046558 | Bacteria | 2761 |
| 321 | Ga0495633_0053494 | 3300046558 | Bacteria | 1900 |
| 322 | Ga0495633_0105444 | 3300046558 | Bacteria | 1307 |
| 323 | Ga0495633_0362432 | 3300046558 | Bacteria | 656 |
| 324 | Ga0495667_0178336 | 3300046559 | Bacteria | 1364 |
| 325 | Ga0495656_0048541 | 3300046615 | Bacteria | 1804 |
| 326 | Ga0495656_0059155 | 3300046615 | Bacteria | 1666 |
| 327 | Ga0495656_0073127 | 3300046615 | Bacteria | 1528 |
| 328 | Ga0495656_0086260 | 3300046615 | Bacteria | 1427 |
| 329 | Ga0495656_0159100 | 3300046615 | Bacteria | 1096 |
| 330 | Ga0495656_0366808 | 3300046615 | Bacteria | 749 |
| 331 | Ga0495668_0000118 | 3300046616 | Bacteria | 119439 |
| 332 | Ga0495668_0000155 | 3300046616 | Bacteria | 103810 |
| 333 | Ga0495668_0001326 | 3300046616 | Bacteria | 24343 |
| 334 | Ga0495668_0002548 | 3300046616 | Bacteria | 14824 |
| 335 | Ga0495668_0010819 | 3300046616 | Bacteria | 5500 |
| 336 | Ga0495668_0014413 | 3300046616 | Bacteria | 4635 |
| 337 | Ga0495668_0014502 | 3300046616 | Bacteria | 4619 |
| 338 | Ga0495668_0113973 | 3300046616 | Bacteria | 1478 |
| 339 | Ga0495668_0258870 | 3300046616 | Bacteria | 952 |
| 340 | Ga0495668_0281079 | 3300046616 | Bacteria | 912 |
| 341 | Ga0495611_0005947 | 3300046648 | Bacteria | 5206 |
| 342 | Ga0495611_0008176 | 3300046648 | Bacteria | 4437 |
| 343 | Ga0495611_0067521 | 3300046648 | Bacteria | 1631 |
| 344 | Ga0495611_0071471 | 3300046648 | Bacteria | 1586 |
| 345 | Ga0495611_0461690 | 3300046648 | Bacteria | 578 |
| 346 | Ga0495625_0080449 | 3300046660 | Bacteria | 2269 |
| 347 | Ga0495625_0094653 | 3300046660 | Bacteria | 2060 |
| 348 | Ga0495659_0056455 | 3300046664 | Bacteria | 1441 |
| 349 | Ga0495659_0115174 | 3300046664 | Bacteria | 1053 |
| 350 | Ga0495661_0000209 | 3300046665 | Bacteria | 67580 |
| 351 | Ga0495661_0000754 | 3300046665 | Bacteria | 31377 |
| 352 | Ga0495661_0000949 | 3300046665 | Bacteria | 26312 |
| 353 | Ga0495661_0019946 | 3300046665 | Bacteria | 4384 |
| 354 | Ga0495661_0025005 | 3300046665 | Bacteria | 3863 |
| 355 | Ga0495661_0034032 | 3300046665 | Bacteria | 3209 |
| 356 | Ga0495661_0045380 | 3300046665 | Bacteria | 2688 |
| 357 | Ga0495661_0073542 | 3300046665 | Bacteria | 1991 |
| 358 | Ga0495661_0076015 | 3300046665 | Bacteria | 1950 |
| 359 | Ga0495661_0353460 | 3300046665 | Bacteria | 723 |
| 360 | Ga0495588_0000062 | 3300046674 | Bacteria | 253674 |
| 361 | Ga0495588_0012983 | 3300046674 | Bacteria | 3956 |
| 362 | Ga0495588_0024193 | 3300046674 | Bacteria | 3015 |
| 363 | Ga0495588_0051250 | 3300046674 | Bacteria | 2125 |
| 364 | Ga0495646_0329848 | 3300046680 | Bacteria | 802 |
| 365 | Ga0495658_0030410 | 3300046683 | Bacteria | 2932 |
| 366 | Ga0495669_0001810 | 3300046684 | Bacteria | 8736 |
| 367 | Ga0495669_0005892 | 3300046684 | Bacteria | 5108 |
| 368 | Ga0495670_0001919 | 3300046691 | Bacteria | 10235 |
| 369 | Ga0495670_0002673 | 3300046691 | Bacteria | 8797 |
| 370 | Ga0495670_0005624 | 3300046691 | Bacteria | 6147 |
| 371 | Ga0495670_0011073 | 3300046691 | Bacteria | 4435 |
| 372 | Ga0495670_0027250 | 3300046691 | Bacteria | 2830 |
| 373 | Ga0495670_0175268 | 3300046691 | Bacteria | 1130 |
| 374 | Ga0495670_0261024 | 3300046691 | Bacteria | 924 |
| 375 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 376 | Ga0495671_0016092 | 3300046692 | Bacteria | 3999 |
| 377 | Ga0495671_0038943 | 3300046692 | Bacteria | 2401 |
| 378 | Ga0495671_0071270 | 3300046692 | Bacteria | 1707 |
| 379 | Ga0495649_0013209 | 3300046694 | Bacteria | 4770 |
| 380 | Ga0495649_0016261 | 3300046694 | Bacteria | 4218 |
| 381 | Ga0495649_0043540 | 3300046694 | Bacteria | 2450 |
| 382 | Ga0495649_0307516 | 3300046694 | Bacteria | 806 |
| 383 | Ga0495589_0000021 | 3300046794 | Bacteria | 197941 |
| 384 | Ga0495589_0007566 | 3300046794 | Bacteria | 5691 |
| 385 | Ga0495589_0011516 | 3300046794 | Bacteria | 4592 |
| 386 | Ga0495589_0016859 | 3300046794 | Bacteria | 3750 |
| 387 | Ga0495589_0017109 | 3300046794 | Bacteria | 3724 |
| 388 | Ga0495589_0044688 | 3300046794 | Bacteria | 2202 |
| 389 | Ga0495589_0065818 | 3300046794 | Bacteria | 1776 |
| 390 | Ga0495589_0105649 | 3300046794 | Bacteria | 1360 |
| 391 | Ga0495660_0000173 | 3300046810 | Bacteria | 69912 |
| 392 | Ga0495660_0031763 | 3300046810 | Bacteria | 2967 |
| 393 | Ga0495660_0040819 | 3300046810 | Bacteria | 2571 |
| 394 | Ga0495660_0061692 | 3300046810 | Bacteria | 2011 |
| 395 | Ga0495660_0070711 | 3300046810 | Bacteria | 1851 |
| 396 | Ga0495604_0028553 | 3300047317 | Bacteria | 4438 |
| 397 | Ga0495604_0218463 | 3300047317 | Bacteria | 1313 |
| 398 | Ga0495636_0001814 | 3300047318 | Bacteria | 8168 |
| 399 | Ga0495636_0007941 | 3300047318 | Bacteria | 4178 |
| 400 | Ga0495636_0217557 | 3300047318 | Bacteria | 876 |
| 401 | Ga0495672_0000480 | 3300047320 | Bacteria | 47220 |
| 402 | Ga0495672_0005516 | 3300047320 | Bacteria | 10018 |
| 403 | Ga0495672_0024758 | 3300047320 | Bacteria | 3860 |
| 404 | Ga0495672_0056799 | 3300047320 | Bacteria | 2275 |
| 405 | Ga0495672_0101997 | 3300047320 | Bacteria | 1554 |
| 406 | Ga0495672_0180540 | 3300047320 | Bacteria | 1069 |
| 407 | Ga0495676_0012785 | 3300047321 | Bacteria | 7549 |
| 408 | Ga0495680_0011356 | 3300047322 | Bacteria | 7887 |
| 409 | Ga0495683_0000243 | 3300047323 | Bacteria | 48918 |
| 410 | Ga0495683_0008513 | 3300047323 | Bacteria | 5485 |
| 411 | Ga0495683_0015027 | 3300047323 | Bacteria | 4031 |
| 412 | Ga0495683_0036135 | 3300047323 | Bacteria | 2509 |
| 413 | Ga0495683_0048631 | 3300047323 | Bacteria | 2126 |
| 414 | Ga0495683_0068513 | 3300047323 | Bacteria | 1745 |
| 415 | Ga0495683_0083777 | 3300047323 | Bacteria | 1552 |
| 416 | Ga0495687_000276 | 3300047443 | Bacteria | 67876 |
| 417 | Ga0495687_000279 | 3300047443 | Bacteria | 67230 |
| 418 | Ga0495687_000319 | 3300047443 | Bacteria | 62530 |
| 419 | Ga0495687_057275 | 3300047443 | Bacteria | 1621 |
| 420 | Ga0495687_082261 | 3300047443 | Bacteria | 1257 |
| 421 | Ga0495687_121217 | 3300047443 | Bacteria | 943 |
| 422 | Ga0495687_158639 | 3300047443 | Bacteria | 764 |
| 423 | Ga0495675_0045991 | 3300047444 | Bacteria | 2779 |
| 424 | Ga0495675_0129851 | 3300047444 | Bacteria | 1566 |
| 425 | Ga0495675_0268788 | 3300047444 | Bacteria | 1019 |
| 426 | Ga0495677_0000050 | 3300047445 | Bacteria | 67980 |
| 427 | Ga0495677_0001535 | 3300047445 | Bacteria | 9294 |
| 428 | Ga0495677_0001924 | 3300047445 | Bacteria | 8305 |
| 429 | Ga0495677_0002264 | 3300047445 | Bacteria | 7606 |
| 430 | Ga0495677_0004877 | 3300047445 | Bacteria | 5116 |
| 431 | Ga0495677_0006637 | 3300047445 | Bacteria | 4360 |
| 432 | Ga0495677_0017098 | 3300047445 | Bacteria | 2629 |
| 433 | Ga0495677_0092789 | 3300047445 | Bacteria | 1138 |
| 434 | Ga0495679_007740 | 3300047446 | Bacteria | 4444 |
| 435 | Ga0495679_013266 | 3300047446 | Bacteria | 3102 |
| 436 | Ga0495685_001691 | 3300047447 | Bacteria | 6795 |
| 437 | Ga0495685_105384 | 3300047447 | Bacteria | 930 |
| 438 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 439 | Ga0495673_0018702 | 3300047469 | Bacteria | 3487 |
| 440 | Ga0495681_0001449 | 3300047470 | Bacteria | 17784 |
| 441 | Ga0495681_0005424 | 3300047470 | Bacteria | 8540 |
| 442 | Ga0495681_0013429 | 3300047470 | Bacteria | 4750 |
| 443 | Ga0495681_0061130 | 3300047470 | Bacteria | 1736 |
| 444 | Ga0495686_0000474 | 3300047472 | Bacteria | 59917 |
| 445 | Ga0495686_0010651 | 3300047472 | Bacteria | 6529 |
| 446 | Ga0495686_0021085 | 3300047472 | Bacteria | 4335 |
| 447 | Ga0495593_0000781 | 3300047673 | Bacteria | 18483 |
| 448 | Ga0495602_1016587 | 3300048088 | Bacteria | 546 |
| 449 | Ga0495614_0000519 | 3300048089 | Bacteria | 15857 |
| 450 | Ga0495615_0018392 | 3300048090 | Bacteria | 1537 |
| 451 | Ga0495626_0000624 | 3300048091 | Bacteria | 34501 |
| 452 | Ga0495626_0004146 | 3300048091 | Bacteria | 8998 |
| 453 | Ga0495626_0010493 | 3300048091 | Bacteria | 4937 |
| 454 | Ga0495626_0028494 | 3300048091 | Bacteria | 2707 |
| 455 | Ga0495626_0029371 | 3300048091 | Bacteria | 2661 |
| 456 | Ga0495626_0031911 | 3300048091 | Bacteria | 2532 |
| 457 | Ga0495626_0065292 | 3300048091 | Bacteria | 1647 |
| 458 | Ga0495626_0074559 | 3300048091 | Bacteria | 1518 |
| 459 | Ga0495626_0103979 | 3300048091 | Bacteria | 1235 |
| 460 | Ga0495626_0128833 | 3300048091 | Bacteria | 1082 |
| 461 | Ga0495626_0141914 | 3300048091 | Bacteria | 1018 |
| 462 | Ga0496100_0122580 | 3300048903 | Bacteria | 1821 |
| 463 | Ga0496100_0349669 | 3300048903 | Bacteria | 1116 |
| 464 | Ga0496101_0602362 | 3300048904 | Bacteria | 869 |
| 465 | Ga0496101_0666171 | 3300048904 | Bacteria | 822 |
| 466 | Ga0496102_0000343 | 3300048905 | Bacteria | 56826 |
| 467 | Ga0496102_0015304 | 3300048905 | Bacteria | 6680 |
| 468 | Ga0496102_0021536 | 3300048905 | Bacteria | 5701 |
| 469 | Ga0496102_0137485 | 3300048905 | Bacteria | 2290 |
| 470 | Ga0496103_0050725 | 3300048906 | Bacteria | 2567 |
| 471 | Ga0496103_0586246 | 3300048906 | Bacteria | 711 |
| 472 | Ga0496103_0964971 | 3300048906 | Bacteria | 532 |
| 473 | Ga0496104_0186509 | 3300048907 | Bacteria | 1985 |
| 474 | Ga0496106_0007451 | 3300048909 | Bacteria | 8087 |
| 475 | Ga0496108_0589081 | 3300048911 | Bacteria | 969 |
| 476 | Ga0496109_0067239 | 3300048912 | Bacteria | 3283 |
| 477 | Ga0496109_0098527 | 3300048912 | Bacteria | 2710 |
| 478 | Ga0496109_1022764 | 3300048912 | Bacteria | 764 |
| 479 | Ga0496109_1528157 | 3300048912 | Bacteria | 602 |
| 480 | Ga0496110_0314764 | 3300048913 | Bacteria | 1425 |
| 481 | Ga0496111_0022480 | 3300048914 | Bacteria | 4416 |
| 482 | Ga0496111_0715479 | 3300048914 | Bacteria | 728 |
| 483 | Ga0496112_0126727 | 3300048915 | Bacteria | 2524 |
| 484 | Ga0496115_0043328 | 3300048918 | Bacteria | 3589 |
| 485 | Ga0496115_0218084 | 3300048918 | Bacteria | 1574 |
| 486 | Ga0496115_0423373 | 3300048918 | Bacteria | 1078 |
| 487 | Ga0496116_0032098 | 3300048919 | Bacteria | 3748 |
| 488 | Ga0496116_0037708 | 3300048919 | Bacteria | 3367 |
| 489 | Ga0496117_0000045 | 3300048920 | Bacteria | 301047 |
| 490 | Ga0496118_0000041 | 3300048921 | Bacteria | 301047 |
| 491 | Ga0496119_0223290 | 3300048922 | Bacteria | 963 |
| 492 | Ga0496121_0001068 | 3300048924 | Bacteria | 48493 |
| 493 | Ga0496121_0002658 | 3300048924 | Bacteria | 26800 |
| 494 | Ga0496121_0005605 | 3300048924 | Bacteria | 16009 |
| 495 | Ga0496121_0189393 | 3300048924 | Bacteria | 1477 |
| 496 | Ga0496122_0007303 | 3300048925 | Bacteria | 12340 |
| 497 | Ga0496123_0001857 | 3300048926 | Bacteria | 27725 |
| 498 | Ga0496123_0054801 | 3300048926 | Bacteria | 2621 |
| 499 | Ga0496124_0009567 | 3300048927 | Bacteria | 9958 |
| 500 | Ga0496124_0010958 | 3300048927 | Bacteria | 9116 |
| 501 | Ga0496124_0032442 | 3300048927 | Bacteria | 4611 |
| 502 | Ga0496124_0054261 | 3300048927 | Bacteria | 3393 |
| 503 | Ga0496124_0109588 | 3300048927 | Bacteria | 2225 |
| 504 | Ga0496124_0348345 | 3300048927 | Bacteria | 1049 |
| 505 | Ga0496124_0795686 | 3300048927 | Bacteria | 586 |
| 506 | Ga0496125_0159321 | 3300048928 | Bacteria | 1536 |
| 507 | Ga0496125_0201002 | 3300048928 | Bacteria | 1304 |
| 508 | Ga0496125_0219557 | 3300048928 | Bacteria | 1226 |
| 509 | Ga0495678_000162 | 3300049459 | Bacteria | 79674 |
| 510 | Ga0495678_000293 | 3300049459 | Bacteria | 54963 |
| 511 | Ga0495678_001013 | 3300049459 | Bacteria | 24008 |
| 512 | Ga0495678_006351 | 3300049459 | Bacteria | 6303 |
| 513 | Ga0495678_016414 | 3300049459 | Bacteria | 3386 |
| 514 | Ga0495678_106489 | 3300049459 | Bacteria | 963 |
| 515 | Ga0495678_165978 | 3300049459 | Bacteria | 702 |
| 516 | Ga0495682_0000509 | 3300049460 | Bacteria | 26895 |
| 517 | Ga0495682_0110451 | 3300049460 | Bacteria | 985 |
| 518 | Ga0501315_002804 | 3300049531 | Bacteria | 1684 |
| 519 | Ga0501315_068580 | 3300049531 | Bacteria | 585 |
| 520 | Ga0501316_001139 | 3300049532 | Bacteria | 2168 |
| 521 | Ga0501034_0765014 | 3300049571 | Bacteria | 860 |
| 522 | Ga0501046_0000226 | 3300049580 | Bacteria | 58757 |
| 523 | Ga0501047_0000302 | 3300049581 | Bacteria | 56851 |
| 524 | Ga0501047_0151277 | 3300049581 | Bacteria | 2197 |
| 525 | Ga0501048_0003939 | 3300049582 | Bacteria | 11284 |
| 526 | Ga0501238_056850 | 3300049671 | Bacteria | 592 |
| 527 | Ga0501250_068550 | 3300049680 | Bacteria | 581 |
| 528 | Ga0501279_006268 | 3300049775 | Bacteria | 1570 |
| 529 | Ga0501035_0003370 | 3300049822 | Bacteria | 15295 |
| 530 | nmdc:mga06z11_205728_c1 | 3300050494 | Bacteria | 1145 |
| 531 | nmdc:mga07m45_103067_c1 | 3300050496 | Bacteria | 1376 |
| 532 | Ga0500618_029093 | 3300053125 | Bacteria | 1305 |
| 533 | Ga0500619_000084 | 3300053154 | Bacteria | 26259 |
| 534 | Ga0500587_003214 | 3300053739 | Bacteria | 2298 |
| 535 | Ga0590075_100288 | 3300059424 | Bacteria | 754 |
| 536 | Ga0587068_015875 | 3300059641 | Bacteria | 1189 |
| 537 | Ga0466962_0283775 | 3300061719 | Bacteria | 817 |
| 538 | Ga0466962_0374721 | 3300061719 | Bacteria | 710 |
| 539 | 2513952380 | 2513237150 | Bacteria | 6553639 |
| 540 | 2587754525 | 2585428062 | Bacteria | 6842168 |
| 541 | 2599510253 | 2599185189 | Bacteria | 5862825 |
| 542 | 2601667459 | 2600255292 | Bacteria | 6300551 |
| 543 | 2644355782 | 2643221664 | Bacteria | 7272945 |
| 544 | 2738742156 | 2738541280 | Bacteria | 6630198 |
| 545 | 2738841321 | 2738541300 | Bacteria | 6675882 |
| 546 | 2739153887 | 2738541357 | Bacteria | 6549408 |
| 547 | 2739195807 | 2738543003 | Bacteria | 6549560 |
| 548 | 2739272191 | 2738543018 | Bacteria | 6718814 |
| 549 | 2739322283 | 2738543026 | Bacteria | 6549408 |
| 550 | 2739340524 | 2738543029 | Bacteria | 6549249 |
| 551 | 2739341235 | 2738543030 | Bacteria | 6719714 |
| 552 | 2809142778 | 2808606418 | Bacteria | 6724496 |
| 553 | 2842712731 | 2842711865 | Bacteria | 7155354 |
| 554 | 2857551316 | 2857547612 | Bacteria | 6179999 |
| 555 | 2857551819 | 2857547612 | Bacteria | 6179999 |
| 556 | 2857564495 | 2857558681 | Bacteria | 6617694 |
| 557 | 2904425200 | 2904424332 | Bacteria | 7633521 |
| 558 | 2904426316 | 2904424332 | Bacteria | 7633521 |
| 559 | 2919477898 | 2919476304 | Bacteria | 5888696 |
| 560 | 2932411071 | 2932410948 | Bacteria | 6312192 |
| 561 | 2932416460 | 2932410948 | Bacteria | 6312192 |
| 562 | 2932417139 | 2932416698 | Bacteria | 6315112 |
| 563 | 2932419362 | 2932416698 | Bacteria | 6315112 |
| 564 | Ga0501313_006245 | |||
| 565 | JGI25150J39212_1002686 | |||
| 566 | JGI25159J45721_1004405 | |||
| 567 | Ga0006759J45824_1049560 | |||
| 568 | rootL2_10178613 | |||
| 569 | Ga0055525_1000047 | |||
| 570 | Ga0055526_1003332 | |||
| 571 | Ga0055537_1000248 | |||
| 572 | Ga0055524_1000021 | |||
| 573 | Ga0055524_1005175 | |||
| 574 | Ga0055534_1000318 | |||
| 575 | Ga0055528_1000116 | |||
| 576 | Ga0055543_1006681 | |||
| 577 | Ga0065165_1000630 | |||
| 578 | Ga0065165_1032915 | |||
| 579 | Ga0065714_10119742 | |||
| 580 | Ga0070658_10187716 | |||
| 581 | Ga0070682_100577336 | |||
| 582 | Ga0070660_100049675 | |||
| 583 | Ga0070660_100184814 | |||
| 584 | Ga0070660_100436355 | |||
| 585 | Ga0070661_100108999 | |||
| 586 | Ga0070659_100411039 | |||
| 587 | Ga0070663_100109839 | |||
| 588 | Ga0070662_100215759 | |||
| 589 | Ga0070662_100746708 | |||
| 590 | Ga0070672_100593160 | |||
| 591 | Ga0068855_100081836 | |||
| 592 | Ga0070664_100098391 | |||
| 593 | Ga0068856_100226794 | |||
| 594 | Ga0068852_100172577 | |||
| 595 | Ga0070716_100178177 | |||
| 596 | Ga0075367_10151836 | |||
| 597 | Ga0068865_100236463 | |||
| 598 | Ga0105245_10110816 | |||
| 599 | Ga0105243_10125915 | |||
| 600 | Ga0105241_10583003 | |||
| 601 | Ga0105242_10022993 | |||
| 602 | Ga0105248_11456117 | |||
| 603 | Ga0105237_10280296 | |||
| 604 | Ga0105238_10187663 | |||
| 605 | Ga0157373_10231832 | |||
| 606 | Ga0157371_10502872 | |||
| 607 | Ga0157369_10794764 | |||
| 608 | Ga0157374_10918875 | |||
| 609 | Ga0182008_10000228 | |||
| 610 | Ga0182008_10006642 | |||
| 611 | Ga0182006_1000142 | |||
| 612 | Ga0182007_10000231 | |||
| 613 | Ga0182005_1000090 | |||
| 614 | Ga0163161_10058471 | |||
| 615 | Ga0163161_10065577 | |||
| 616 | Ga0209436_108583 | |||
| 617 | Ga0209563_100003 | |||
| 618 | Ga0207425_1000318 | |||
| 619 | Ga0209677_102029 | |||
| 620 | Ga0209148_1001353 | |||
| 621 | Ga0209565_1000009 | |||
| 622 | Ga0209673_1000019 | |||
| 623 | Ga0209130_1003480 | |||
| 624 | Ga0209675_1000028 | |||
| 625 | Ga0209025_1003609 | |||
| 626 | Ga0209564_1000058 | |||
| 627 | Ga0209564_1021418 | |||
| 628 | Ga0209758_1000675 | |||
| 629 | Ga0209256_1000044 | |||
| 630 | Ga0209256_1000093 | |||
| 631 | Ga0207426_1036634 | |||
| 632 | Ga0207705_10074561 | |||
| 633 | Ga0207705_10421702 | |||
| 634 | Ga0207654_10061273 | |||
| 635 | Ga0207671_10143141 | |||
| 636 | Ga0207657_10003522 | |||
| 637 | Ga0207657_10032076 | |||
| 638 | Ga0207657_10215831 | |||
| 639 | Ga0207657_10272440 | |||
| 640 | Ga0207694_10106979 | |||
| 641 | Ga0207687_10467552 | |||
| 642 | Ga0207690_10104052 | |||
| 643 | Ga0207706_10005937 | |||
| 644 | Ga0207706_10106679 | |||
| 645 | Ga0207686_10002979 | |||
| 646 | Ga0207704_10159109 | |||
| 647 | Ga0207665_10216039 | |||
| 648 | Ga0207667_10018225 | |||
| 649 | Ga0207678_10669588 | |||
| 650 | Ga0207702_11169880 | |||
| 651 | Ga0207698_10353097 | |||
| 652 | Ga0209974_10002896 | |||
| 653 | Ga0307515_10000381 | |||
| 654 | Ga0307515_10002386 | |||
| 655 | Ga0307515_10009310 | |||
| 656 | Ga0307512_10064991 | |||
| 657 | Ga0307512_10247649 | |||
| 658 | Ga0265328_10106892 | |||
| 659 | Ga0265327_10000205 | |||
| 660 | Ga0307513_10009505 | |||
| 661 | Ga0307509_10241816 | |||
| 662 | Ga0307408_100000735 | |||
| 663 | Ga0307508_10000194 | |||
| 664 | Ga0307514_10014297 | |||
| 665 | Ga0307516_10009770 | |||
| 666 | Ga0307507_10011647 | |||
| 667 | Ga0373939_0032490 | |||
| 668 | Ga0395899_0002576 | |||
| 669 | Ga0395899_0078926 | |||
| 670 | Ga0395900_0000763 | |||
| 671 | Ga0395900_0179082 | |||
| 672 | Ga0395900_0190798 | |||
| 673 | Ga0395900_0255632 | |||
| 674 | Ga0395900_0284786 | |||
| 675 | Ga0395900_0382423 | |||
| 676 | Ga0395900_0446947 | |||
| 677 | Ga0395898_0056317 | |||
| 678 | Ga0395898_0892230 | |||
| 679 | Ga0395905_0072684 | |||
| 680 | Ga0395905_0124627 | |||
| 681 | Ga0395905_0132405 | |||
| 682 | Ga0395905_0242639 | |||
| 683 | Ga0395905_0409058 | |||
| 684 | Ga0395905_0491859 | |||
| 685 | Ga0395901_0000097 | |||
| 686 | Ga0395901_0053904 | |||
| 687 | Ga0395901_0082617 | |||
| 688 | Ga0395901_0145881 | |||
| 689 | Ga0395901_0270960 | |||
| 690 | Ga0395901_0318499 | |||
| 691 | Ga0395901_0449224 | |||
| 692 | Ga0395901_1425133 | |||
| 693 | Ga0395901_1645216 | |||
| 694 | Ga0436361_0674642 | |||
| 695 | Ga0451789_0916289 | |||
| 696 | Ga0451791_0523573 | |||
| 697 | Ga0451795_0697288 | |||
| 698 | Ga0451798_0428385 | |||
| 699 | Ga0451800_0130513 | |||
| 700 | Ga0451833_0498765 | |||
| 701 | Ga0451841_1119001 | |||
| 702 | Ga0451849_0995850 | |||
| 703 | Ga0451843_0325161 | |||
| 704 | Ga0451853_0705861 | |||
| 705 | Ga0439448_0088639 | |||
| 706 | Ga0439450_093292 | |||
| 707 | Ga0439450_160617 | |||
| 708 | Ga0439458_0134152 | |||
| 709 | Ga0466969_0075719 | |||
| 710 | Ga0466969_0102468 | |||
| 711 | Ga0466969_0161251 | |||
| 712 | Ga0466969_0186935 | |||
| 713 | Ga0466972_0148977 | |||
| 714 | Ga0466965_0001236 | |||
| 715 | Ga0466965_0008112 | |||
| 716 | Ga0466965_0083980 | |||
| 717 | Ga0466965_0091692 | |||
| 718 | Ga0466966_0025511 | |||
| 719 | Ga0466966_0041914 | |||
| 720 | Ga0466966_0053136 | |||
| 721 | Ga0466966_0058430 | |||
| 722 | Ga0466966_0757039 | |||
| 723 | Ga0466961_0116076 | |||
| 724 | Ga0466963_0032740 | |||
| 725 | Ga0466964_0000163 | |||
| 726 | Ga0466964_0043842 | |||
| 727 | Ga0466970_0048703 | |||
| 728 | Ga0466970_0192753 | |||
| 729 | Ga0466957_0000007 | |||
| 730 | Ga0466957_0027093 | |||
| 731 | Ga0466957_0098671 | |||
| 732 | Ga0466957_0106670 | |||
| 733 | Ga0466960_0114381 | |||
| 734 | Ga0466960_0643677 | |||
| 735 | Ga0466959_0029414 | |||
| 736 | Ga0466959_0287050 | |||
| 737 | Ga0466958_0064190 | |||
| 738 | Ga0466958_0098425 | |||
| 739 | Ga0466958_0223926 | |||
| 740 | Ga0466958_0448723 | |||
| 741 | Ga0466967_0001164 | |||
| 742 | Ga0466967_0176830 | |||
| 743 | Ga0466967_0250612 | |||
| 744 | Ga0495627_000255 | |||
| 745 | Ga0495627_006218 | |||
| 746 | Ga0495627_006421 | |||
| 747 | Ga0495603_0309309 | |||
| 748 | Ga0495629_0046219 | |||
| 749 | Ga0495638_0084028 | |||
| 750 | Ga0495638_0084275 | |||
| 751 | Ga0495638_0115682 | |||
| 752 | Ga0495653_0158082 | |||
| 753 | Ga0495650_0000477 | |||
| 754 | Ga0495650_0013865 | |||
| 755 | Ga0495650_0048992 | |||
| 756 | Ga0495605_0000024 | |||
| 757 | Ga0495605_0000044 | |||
| 758 | Ga0495605_0000236 | |||
| 759 | Ga0495605_0014617 | |||
| 760 | Ga0495605_0016225 | |||
| 761 | Ga0495605_0344993 | |||
| 762 | Ga0495584_0000003 | |||
| 763 | Ga0495584_0000097 | |||
| 764 | Ga0495584_0000657 | |||
| 765 | Ga0495584_0009984 | |||
| 766 | Ga0495584_0019199 | |||
| 767 | Ga0495584_0021517 | |||
| 768 | Ga0495584_0027783 | |||
| 769 | Ga0495584_0043264 | |||
| 770 | Ga0495584_0062019 | |||
| 771 | Ga0495584_0082372 | |||
| 772 | Ga0495584_0299689 | |||
| 773 | Ga0495585_0000130 | |||
| 774 | Ga0495585_0000655 | |||
| 775 | Ga0495585_0000807 | |||
| 776 | Ga0495585_0001776 | |||
| 777 | Ga0495585_0006830 | |||
| 778 | Ga0495585_0008154 | |||
| 779 | Ga0495585_0037898 | |||
| 780 | Ga0495585_0068838 | |||
| 781 | Ga0495585_0103274 | |||
| 782 | Ga0495594_0144113 | |||
| 783 | Ga0495596_0001049 | |||
| 784 | Ga0495596_0005896 | |||
| 785 | Ga0495596_0007439 | |||
| 786 | Ga0495596_0010212 | |||
| 787 | Ga0495596_0029115 | |||
| 788 | Ga0495607_0001317 | |||
| 789 | Ga0495607_0001333 | |||
| 790 | Ga0495607_0002811 | |||
| 791 | Ga0495607_0013597 | |||
| 792 | Ga0495607_0014224 | |||
| 793 | Ga0495607_0037431 | |||
| 794 | Ga0495607_0056778 | |||
| 795 | Ga0495607_0093853 | |||
| 796 | Ga0495607_0228469 | |||
| 797 | Ga0495583_0000235 | |||
| 798 | Ga0495583_0000560 | |||
| 799 | Ga0495583_0001243 | |||
| 800 | Ga0495583_0007311 | |||
| 801 | Ga0495583_0014241 | |||
| 802 | Ga0495583_0015784 | |||
| 803 | Ga0495606_0000229 | |||
| 804 | Ga0495606_0000537 | |||
| 805 | Ga0495606_0002327 | |||
| 806 | Ga0495606_0005020 | |||
| 807 | Ga0495606_0015478 | |||
| 808 | Ga0495606_0063852 | |||
| 809 | Ga0495606_0118496 | |||
| 810 | Ga0495606_0149490 | |||
| 811 | Ga0495606_0213926 | |||
| 812 | Ga0495606_0223020 | |||
| 813 | Ga0495610_0003072 | |||
| 814 | Ga0495616_0000634 | |||
| 815 | Ga0495616_0000913 | |||
| 816 | Ga0495616_0003494 | |||
| 817 | Ga0495616_0005288 | |||
| 818 | Ga0495616_0023002 | |||
| 819 | Ga0495616_0038749 | |||
| 820 | Ga0495616_0046097 | |||
| 821 | Ga0495616_0084115 | |||
| 822 | Ga0495616_0134870 | |||
| 823 | Ga0495616_0212917 | |||
| 824 | Ga0495628_1040392 | |||
| 825 | Ga0495631_0005485 | |||
| 826 | Ga0495631_0014378 | |||
| 827 | Ga0495631_0050090 | |||
| 828 | Ga0495631_0055205 | |||
| 829 | Ga0495631_0193837 | |||
| 830 | Ga0495632_0000203 | |||
| 831 | Ga0495632_0000225 | |||
| 832 | Ga0495632_0005704 | |||
| 833 | Ga0495632_0009707 | |||
| 834 | Ga0495632_0016996 | |||
| 835 | Ga0495643_0000171 | |||
| 836 | Ga0495643_0002430 | |||
| 837 | Ga0495643_0004286 | |||
| 838 | Ga0495643_0014827 | |||
| 839 | Ga0495643_0039456 | |||
| 840 | Ga0495643_0059539 | |||
| 841 | Ga0495643_0063034 | |||
| 842 | Ga0495643_0170049 | |||
| 843 | Ga0495644_0006396 | |||
| 844 | Ga0495644_0056827 | |||
| 845 | Ga0495648_0000003 | |||
| 846 | Ga0495648_0000290 | |||
| 847 | Ga0495648_0000863 | |||
| 848 | Ga0495663_0205456 | |||
| 849 | Ga0495642_0000065 | |||
| 850 | Ga0495642_0000125 | |||
| 851 | Ga0495642_0002169 | |||
| 852 | Ga0495642_0009551 | |||
| 853 | Ga0495642_0066558 | |||
| 854 | Ga0495642_0074366 | |||
| 855 | Ga0495642_0074589 | |||
| 856 | Ga0495642_0100954 | |||
| 857 | Ga0495642_0111907 | |||
| 858 | Ga0495654_0026371 | |||
| 859 | Ga0495654_0039194 | |||
| 860 | Ga0495654_0070954 | |||
| 861 | Ga0495654_0230825 | |||
| 862 | Ga0495665_0142865 | |||
| 863 | Ga0495665_0519442 | |||
| 864 | Ga0495640_0046100 | |||
| 865 | Ga0495586_0010261 | |||
| 866 | Ga0495609_0000030 | |||
| 867 | Ga0495609_0000140 | |||
| 868 | Ga0495609_0001927 | |||
| 869 | Ga0495609_0014277 | |||
| 870 | Ga0495609_0053355 | |||
| 871 | Ga0495609_0089068 | |||
| 872 | Ga0495609_0094040 | |||
| 873 | Ga0495609_0119236 | |||
| 874 | Ga0495597_0007929 | |||
| 875 | Ga0495597_0008345 | |||
| 876 | Ga0495597_0020828 | |||
| 877 | Ga0495597_0068152 | |||
| 878 | Ga0495597_0125224 | |||
| 879 | Ga0495597_0369615 | |||
| 880 | Ga0495622_0140563 | |||
| 881 | Ga0495633_0002846 | |||
| 882 | Ga0495633_0010022 | |||
| 883 | Ga0495633_0027799 | |||
| 884 | Ga0495633_0053494 | |||
| 885 | Ga0495633_0105444 | |||
| 886 | Ga0495633_0362432 | |||
| 887 | Ga0495667_0178336 | |||
| 888 | Ga0495656_0048541 | |||
| 889 | Ga0495656_0059155 | |||
| 890 | Ga0495656_0073127 | |||
| 891 | Ga0495656_0086260 | |||
| 892 | Ga0495656_0159100 | |||
| 893 | Ga0495656_0366808 | |||
| 894 | Ga0495668_0000118 | |||
| 895 | Ga0495668_0000155 | |||
| 896 | Ga0495668_0001326 | |||
| 897 | Ga0495668_0002548 | |||
| 898 | Ga0495668_0010819 | |||
| 899 | Ga0495668_0014413 | |||
| 900 | Ga0495668_0014502 | |||
| 901 | Ga0495668_0113973 | |||
| 902 | Ga0495668_0258870 | |||
| 903 | Ga0495668_0281079 | |||
| 904 | Ga0495611_0005947 | |||
| 905 | Ga0495611_0008176 | |||
| 906 | Ga0495611_0067521 | |||
| 907 | Ga0495611_0071471 | |||
| 908 | Ga0495611_0461690 | |||
| 909 | Ga0495625_0080449 | |||
| 910 | Ga0495625_0094653 | |||
| 911 | Ga0495659_0056455 | |||
| 912 | Ga0495659_0115174 | |||
| 913 | Ga0495661_0000209 | |||
| 914 | Ga0495661_0000754 | |||
| 915 | Ga0495661_0000949 | |||
| 916 | Ga0495661_0019946 | |||
| 917 | Ga0495661_0025005 | |||
| 918 | Ga0495661_0034032 | |||
| 919 | Ga0495661_0045380 | |||
| 920 | Ga0495661_0073542 | |||
| 921 | Ga0495661_0076015 | |||
| 922 | Ga0495661_0353460 | |||
| 923 | Ga0495588_0000062 | |||
| 924 | Ga0495588_0012983 | |||
| 925 | Ga0495588_0024193 | |||
| 926 | Ga0495588_0051250 | |||
| 927 | Ga0495646_0329848 | |||
| 928 | Ga0495658_0030410 | |||
| 929 | Ga0495669_0001810 | |||
| 930 | Ga0495669_0005892 | |||
| 931 | Ga0495670_0001919 | |||
| 932 | Ga0495670_0002673 | |||
| 933 | Ga0495670_0005624 | |||
| 934 | Ga0495670_0011073 | |||
| 935 | Ga0495670_0027250 | |||
| 936 | Ga0495670_0175268 | |||
| 937 | Ga0495670_0261024 | |||
| 938 | Ga0495671_0000001 | |||
| 939 | Ga0495671_0016092 | |||
| 940 | Ga0495671_0038943 | |||
| 941 | Ga0495671_0071270 | |||
| 942 | Ga0495649_0013209 | |||
| 943 | Ga0495649_0016261 | |||
| 944 | Ga0495649_0043540 | |||
| 945 | Ga0495649_0307516 | |||
| 946 | Ga0495589_0000021 | |||
| 947 | Ga0495589_0007566 | |||
| 948 | Ga0495589_0011516 | |||
| 949 | Ga0495589_0016859 | |||
| 950 | Ga0495589_0017109 | |||
| 951 | Ga0495589_0044688 | |||
| 952 | Ga0495589_0065818 | |||
| 953 | Ga0495589_0105649 | |||
| 954 | Ga0495660_0000173 | |||
| 955 | Ga0495660_0031763 | |||
| 956 | Ga0495660_0040819 | |||
| 957 | Ga0495660_0061692 | |||
| 958 | Ga0495660_0070711 | |||
| 959 | Ga0495604_0028553 | |||
| 960 | Ga0495604_0218463 | |||
| 961 | Ga0495636_0001814 | |||
| 962 | Ga0495636_0007941 | |||
| 963 | Ga0495636_0217557 | |||
| 964 | Ga0495672_0000480 | |||
| 965 | Ga0495672_0005516 | |||
| 966 | Ga0495672_0024758 | |||
| 967 | Ga0495672_0056799 | |||
| 968 | Ga0495672_0101997 | |||
| 969 | Ga0495672_0180540 | |||
| 970 | Ga0495676_0012785 | |||
| 971 | Ga0495680_0011356 | |||
| 972 | Ga0495683_0000243 | |||
| 973 | Ga0495683_0008513 | |||
| 974 | Ga0495683_0015027 | |||
| 975 | Ga0495683_0036135 | |||
| 976 | Ga0495683_0048631 | |||
| 977 | Ga0495683_0068513 | |||
| 978 | Ga0495683_0083777 | |||
| 979 | Ga0495687_000276 | |||
| 980 | Ga0495687_000279 | |||
| 981 | Ga0495687_000319 | |||
| 982 | Ga0495687_057275 | |||
| 983 | Ga0495687_082261 | |||
| 984 | Ga0495687_121217 | |||
| 985 | Ga0495687_158639 | |||
| 986 | Ga0495675_0045991 | |||
| 987 | Ga0495675_0129851 | |||
| 988 | Ga0495675_0268788 | |||
| 989 | Ga0495677_0000050 | |||
| 990 | Ga0495677_0001535 | |||
| 991 | Ga0495677_0001924 | |||
| 992 | Ga0495677_0002264 | |||
| 993 | Ga0495677_0004877 | |||
| 994 | Ga0495677_0006637 | |||
| 995 | Ga0495677_0017098 | |||
| 996 | Ga0495677_0092789 | |||
| 997 | Ga0495679_007740 | |||
| 998 | Ga0495679_013266 | |||
| 999 | Ga0495685_001691 | |||
| 1000 | Ga0495685_105384 | |||
| 1001 | Ga0495673_0000006 | |||
| 1002 | Ga0495673_0018702 | |||
| 1003 | Ga0495681_0001449 | |||
| 1004 | Ga0495681_0005424 | |||
| 1005 | Ga0495681_0013429 | |||
| 1006 | Ga0495681_0061130 | |||
| 1007 | Ga0495686_0000474 | |||
| 1008 | Ga0495686_0010651 | |||
| 1009 | Ga0495686_0021085 | |||
| 1010 | Ga0495593_0000781 | |||
| 1011 | Ga0495602_1016587 | |||
| 1012 | Ga0495614_0000519 | |||
| 1013 | Ga0495615_0018392 | |||
| 1014 | Ga0495626_0000624 | |||
| 1015 | Ga0495626_0004146 | |||
| 1016 | Ga0495626_0010493 | |||
| 1017 | Ga0495626_0028494 | |||
| 1018 | Ga0495626_0029371 | |||
| 1019 | Ga0495626_0031911 | |||
| 1020 | Ga0495626_0065292 | |||
| 1021 | Ga0495626_0074559 | |||
| 1022 | Ga0495626_0103979 | |||
| 1023 | Ga0495626_0128833 | |||
| 1024 | Ga0495626_0141914 | |||
| 1025 | Ga0496100_0122580 | |||
| 1026 | Ga0496100_0349669 | |||
| 1027 | Ga0496101_0602362 | |||
| 1028 | Ga0496101_0666171 | |||
| 1029 | Ga0496102_0000343 | |||
| 1030 | Ga0496102_0015304 | |||
| 1031 | Ga0496102_0021536 | |||
| 1032 | Ga0496102_0137485 | |||
| 1033 | Ga0496103_0050725 | |||
| 1034 | Ga0496103_0586246 | |||
| 1035 | Ga0496103_0964971 | |||
| 1036 | Ga0496104_0186509 | |||
| 1037 | Ga0496106_0007451 | |||
| 1038 | Ga0496108_0589081 | |||
| 1039 | Ga0496109_0067239 | |||
| 1040 | Ga0496109_0098527 | |||
| 1041 | Ga0496109_1022764 | |||
| 1042 | Ga0496109_1528157 | |||
| 1043 | Ga0496110_0314764 | |||
| 1044 | Ga0496111_0022480 | |||
| 1045 | Ga0496111_0715479 | |||
| 1046 | Ga0496112_0126727 | |||
| 1047 | Ga0496115_0043328 | |||
| 1048 | Ga0496115_0218084 | |||
| 1049 | Ga0496115_0423373 | |||
| 1050 | Ga0496116_0032098 | |||
| 1051 | Ga0496116_0037708 | |||
| 1052 | Ga0496117_0000045 | |||
| 1053 | Ga0496118_0000041 | |||
| 1054 | Ga0496119_0223290 | |||
| 1055 | Ga0496121_0001068 | |||
| 1056 | Ga0496121_0002658 | |||
| 1057 | Ga0496121_0005605 | |||
| 1058 | Ga0496121_0189393 | |||
| 1059 | Ga0496122_0007303 | |||
| 1060 | Ga0496123_0001857 | |||
| 1061 | Ga0496123_0054801 | |||
| 1062 | Ga0496124_0009567 | |||
| 1063 | Ga0496124_0010958 | |||
| 1064 | Ga0496124_0032442 | |||
| 1065 | Ga0496124_0054261 | |||
| 1066 | Ga0496124_0109588 | |||
| 1067 | Ga0496124_0348345 | |||
| 1068 | Ga0496124_0795686 | |||
| 1069 | Ga0496125_0159321 | |||
| 1070 | Ga0496125_0201002 | |||
| 1071 | Ga0496125_0219557 | |||
| 1072 | Ga0495678_000162 | |||
| 1073 | Ga0495678_000293 | |||
| 1074 | Ga0495678_001013 | |||
| 1075 | Ga0495678_006351 | |||
| 1076 | Ga0495678_016414 | |||
| 1077 | Ga0495678_106489 | |||
| 1078 | Ga0495678_165978 | |||
| 1079 | Ga0495682_0000509 | |||
| 1080 | Ga0495682_0110451 | |||
| 1081 | Ga0501315_002804 | |||
| 1082 | Ga0501315_068580 | |||
| 1083 | Ga0501316_001139 | |||
| 1084 | Ga0501034_0765014 | |||
| 1085 | Ga0501046_0000226 | |||
| 1086 | Ga0501047_0000302 | |||
| 1087 | Ga0501047_0151277 | |||
| 1088 | Ga0501048_0003939 | |||
| 1089 | Ga0501238_056850 | |||
| 1090 | Ga0501250_068550 | |||
| 1091 | Ga0501279_006268 | |||
| 1092 | Ga0501035_0003370 | |||
| 1093 | nmdc:mga06z11_205728_c1 | |||
| 1094 | nmdc:mga07m45_103067_c1 | |||
| 1095 | Ga0500618_029093 | |||
| 1096 | Ga0500619_000084 | |||
| 1097 | Ga0500587_003214 | |||
| 1098 | Ga0590075_100288 | |||
| 1099 | Ga0587068_015875 | |||
| 1100 | Ga0466962_0283775 | |||
| 1101 | Ga0466962_0374721 | |||
| 1102 | 2513952380 | |||
| 1103 | 2587754525 | |||
| 1104 | 2599510253 | |||
| 1105 | 2601667459 | |||
| 1106 | 2644355782 | |||
| 1107 | 2738742156 | |||
| 1108 | 2738841321 | |||
| 1109 | 2739153887 | |||
| 1110 | 2739195807 | |||
| 1111 | 2739272191 | |||
| 1112 | 2739322283 | |||
| 1113 | 2739340524 | |||
| 1114 | 2739341235 | |||
| 1115 | 2809142778 | |||
| 1116 | 2842712731 | |||
| 1117 | 2857551316 | |||
| 1118 | 2857551819 | |||
| 1119 | 2857564495 | |||
| 1120 | 2904425200 | |||
| 1121 | 2904426316 | |||
| 1122 | 2919477898 | |||
| 1123 | 2932411071 | |||
| 1124 | 2932416460 | |||
| 1125 | 2932417139 | |||
| 1126 | 2932419362 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy