F464102

General Info

Members Datasets Scaffolds Average Seq Length
563 248 1126 147

Family's Representative Sequence

Representative Sequence 3300049529|Ga0501313_006245|Ga0501313_006245_516_1037
Length 173
Sequence MSRNESVQKRLQKVRAPRVQMSYDVEIGDAVESKELPFVMGVVGDFAGASQIEQKKLKDRKFVGVDRDTFDDVMKGIAPRAAYRVPNELTPEGGEFSVDLTFESMNDFRPESVVEQVEPLRKLLEARTRLADLRNKLAGNDKLEDILSXXLSNTEKLAELSRASATPPRNDKE

Samples

Sample ID Description Type Environment
1 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
87 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
95 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
96 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
97 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
100 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
101 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
102 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
105 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
106 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
217 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
218 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
224 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
225 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
229 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
230 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
231 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
232 2643221664 Massilia sp. Root418 Isolate Unclassified
233 2738541280 Massilia sp. GV090 Isolate Unclassified
234 2738541300 Massilia sp. GV016 Isolate Unclassified
235 2738541357 Duganella sp. GV053 Isolate Unclassified
236 2738543003 Duganella sp. GV066 Isolate Unclassified
237 2738543018 Massilia sp. GV045 Isolate Unclassified
238 2738543026 Duganella sp. GV089 Isolate Unclassified
239 2738543029 Duganella sp. GV039 Isolate Unclassified
240 2738543030 Massilia sp. GV097 Isolate Unclassified
241 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
242 2842711865 Duganella sp. R-73148 Isolate Unclassified
243 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
244 2857558681 Duganella sp. R-74565 Isolate Unclassified
245 2904424332 Duganella sp. 1411 Isolate Rhizosphere
246 2919476304 Duganella sp. 3397 Isolate Unclassified
247 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
248 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.49
Metatranscriptomes 1.07
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.04
Nodule 0.18
Rhizoplane 5.68
Rhizosphere 78.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501313_006245 3300049529 Bacteria 1285
2 JGI25150J39212_1002686 3300002774 Bacteria 4336
3 JGI25159J45721_1004405 3300002987 Bacteria 4683
4 Ga0006759J45824_1049560 3300003163 Bacteria 1988
5 rootL2_10178613 3300003322 Bacteria 2314
6 Ga0055525_1000047 3300003759 Bacteria 261507
7 Ga0055526_1003332 3300003771 Bacteria 10268
8 Ga0055537_1000248 3300003773 Bacteria 39459
9 Ga0055524_1000021 3300003775 Bacteria 227578
10 Ga0055524_1005175 3300003775 Bacteria 5876
11 Ga0055534_1000318 3300003784 Bacteria 31952
12 Ga0055528_1000116 3300003790 Bacteria 63713
13 Ga0055543_1006681 3300004625 Bacteria 2753
14 Ga0065165_1000630 3300005262 Bacteria 51211
15 Ga0065165_1032915 3300005262 Bacteria 1620
16 Ga0065714_10119742 3300005288 Bacteria 1363
17 Ga0070658_10187716 3300005327 Bacteria 1741
18 Ga0070682_100577336 3300005337 Bacteria 884
19 Ga0070660_100049675 3300005339 Bacteria 3225
20 Ga0070660_100184814 3300005339 Bacteria 1687
21 Ga0070660_100436355 3300005339 Bacteria 1085
22 Ga0070661_100108999 3300005344 Bacteria 2066
23 Ga0070659_100411039 3300005366 Bacteria 1143
24 Ga0070663_100109839 3300005455 Bacteria 2071
25 Ga0070662_100215759 3300005457 Bacteria 1529
26 Ga0070662_100746708 3300005457 Bacteria 830
27 Ga0070672_100593160 3300005543 Bacteria 964
28 Ga0068855_100081836 3300005563 Bacteria 3742
29 Ga0070664_100098391 3300005564 Bacteria 2541
30 Ga0068856_100226794 3300005614 Bacteria 1884
31 Ga0068852_100172577 3300005616 Bacteria 2028
32 Ga0070716_100178177 3300006173 Bacteria 1393
33 Ga0075367_10151836 3300006178 Bacteria 1438
34 Ga0068865_100236463 3300006881 Bacteria 1436
35 Ga0105245_10110816 3300009098 Bacteria 2552
36 Ga0105243_10125915 3300009148 Bacteria 2167
37 Ga0105241_10583003 3300009174 Bacteria 1008
38 Ga0105242_10022993 3300009176 Bacteria 4911
39 Ga0105248_11456117 3300009177 Bacteria 775
40 Ga0105237_10280296 3300009545 Bacteria 1669
41 Ga0105238_10187663 3300009551 Bacteria 2044
42 Ga0157373_10231832 3300013100 Bacteria 1304
43 Ga0157371_10502872 3300013102 Bacteria 895
44 Ga0157369_10794764 3300013105 Bacteria 972
45 Ga0157374_10918875 3300013296 Bacteria 893
46 Ga0182008_10000228 3300014497 Bacteria 43946
47 Ga0182008_10006642 3300014497 Bacteria 6441
48 Ga0182006_1000142 3300015261 Bacteria 76916
49 Ga0182007_10000231 3300015262 Bacteria 37454
50 Ga0182005_1000090 3300015265 Bacteria 68199
51 Ga0163161_10058471 3300017792 Bacteria 2802
52 Ga0163161_10065577 3300017792 Bacteria 2650
53 Ga0209436_108583 3300025208 Bacteria 2021
54 Ga0209563_100003 3300025230 Bacteria 1932942
55 Ga0207425_1000318 3300025245 Bacteria 34531
56 Ga0209677_102029 3300025253 Bacteria 8033
57 Ga0209148_1001353 3300025254 Bacteria 12872
58 Ga0209565_1000009 3300025263 Bacteria 751701
59 Ga0209673_1000019 3300025273 Bacteria 449094
60 Ga0209130_1003480 3300025284 Bacteria 6644
61 Ga0209675_1000028 3300025291 Bacteria 281253
62 Ga0209025_1003609 3300025294 Bacteria 14413
63 Ga0209564_1000058 3300025295 Bacteria 332955
64 Ga0209564_1021418 3300025295 Bacteria 2325
65 Ga0209758_1000675 3300025297 Bacteria 50917
66 Ga0209256_1000044 3300025299 Bacteria 337264
67 Ga0209256_1000093 3300025299 Bacteria 209318
68 Ga0207426_1036634 3300025302 Bacteria 1558
69 Ga0207705_10074561 3300025909 Bacteria 2463
70 Ga0207705_10421702 3300025909 Bacteria 1033
71 Ga0207654_10061273 3300025911 Bacteria 2201
72 Ga0207671_10143141 3300025914 Bacteria 1843
73 Ga0207657_10003522 3300025919 Bacteria 16718
74 Ga0207657_10032076 3300025919 Bacteria 4750
75 Ga0207657_10215831 3300025919 Bacteria 1538
76 Ga0207657_10272440 3300025919 Bacteria 1345
77 Ga0207694_10106979 3300025924 Bacteria 2222
78 Ga0207687_10467552 3300025927 Bacteria 1048
79 Ga0207690_10104052 3300025932 Bacteria 2033
80 Ga0207706_10005937 3300025933 Bacteria 11359
81 Ga0207706_10106679 3300025933 Bacteria 2465
82 Ga0207686_10002979 3300025934 Bacteria 9125
83 Ga0207704_10159109 3300025938 Bacteria 1605
84 Ga0207665_10216039 3300025939 Bacteria 1403
85 Ga0207667_10018225 3300025949 Bacteria 7878
86 Ga0207678_10669588 3300026067 Bacteria 912
87 Ga0207702_11169880 3300026078 Bacteria 763
88 Ga0207698_10353097 3300026142 Bacteria 1390
89 Ga0209974_10002896 3300027876 Bacteria 6225
90 Ga0307515_10000381 3300028794 Bacteria 108373
91 Ga0307515_10002386 3300028794 Bacteria 40952
92 Ga0307515_10009310 3300028794 Bacteria 19001
93 Ga0307512_10064991 3300030522 Bacteria 2772
94 Ga0307512_10247649 3300030522 Bacteria 892
95 Ga0265328_10106892 3300031239 Bacteria 1038
96 Ga0265327_10000205 3300031251 Bacteria 123596
97 Ga0307513_10009505 3300031456 Bacteria 12297
98 Ga0307509_10241816 3300031507 Bacteria 1597
99 Ga0307408_100000735 3300031548 Bacteria 26492
100 Ga0307508_10000194 3300031616 Bacteria 73425
101 Ga0307514_10014297 3300031649 Bacteria 6574
102 Ga0307516_10009770 3300031730 Bacteria 10643
103 Ga0307507_10011647 3300033179 Bacteria 11041
104 Ga0373939_0032490 3300035114 Bacteria 1517
105 Ga0395899_0002576 3300037312 Bacteria 14635
106 Ga0395899_0078926 3300037312 Bacteria 2398
107 Ga0395900_0000763 3300037418 Bacteria 42856
108 Ga0395900_0179082 3300037418 Bacteria 2155
109 Ga0395900_0190798 3300037418 Bacteria 2078
110 Ga0395900_0255632 3300037418 Bacteria 1751
111 Ga0395900_0284786 3300037418 Bacteria 1643
112 Ga0395900_0382423 3300037418 Bacteria 1375
113 Ga0395900_0446947 3300037418 Bacteria 1249
114 Ga0395898_0056317 3300037466 Bacteria 3832
115 Ga0395898_0892230 3300037466 Bacteria 827
116 Ga0395905_0072684 3300037471 Bacteria 3224
117 Ga0395905_0124627 3300037471 Bacteria 2422
118 Ga0395905_0132405 3300037471 Bacteria 2345
119 Ga0395905_0242639 3300037471 Bacteria 1683
120 Ga0395905_0409058 3300037471 Bacteria 1252
121 Ga0395905_0491859 3300037471 Bacteria 1126
122 Ga0395901_0000097 3300038443 Bacteria 118528
123 Ga0395901_0053904 3300038443 Bacteria 4179
124 Ga0395901_0082617 3300038443 Bacteria 3356
125 Ga0395901_0145881 3300038443 Bacteria 2487
126 Ga0395901_0270960 3300038443 Bacteria 1766
127 Ga0395901_0318499 3300038443 Bacteria 1609
128 Ga0395901_0449224 3300038443 Bacteria 1318
129 Ga0395901_1425133 3300038443 Bacteria 650
130 Ga0395901_1645216 3300038443 Bacteria 594
131 Ga0436361_0674642 3300039447 Bacteria 25335
132 Ga0451789_0916289 3300041443 Bacteria 2109
133 Ga0451791_0523573 3300041451 Bacteria 1326
134 Ga0451795_0697288 3300041456 Bacteria 985
135 Ga0451798_0428385 3300041458 Bacteria 1221
136 Ga0451800_0130513 3300041459 Bacteria 2091
137 Ga0451833_0498765 3300041491 Bacteria 1108
138 Ga0451841_1119001 3300041498 Bacteria 2269
139 Ga0451849_0995850 3300041505 Bacteria 1075
140 Ga0451843_0325161 3300041509 Bacteria 730
141 Ga0451853_0705861 3300041512 Bacteria 4119
142 Ga0439448_0088639 3300042005 Bacteria 1044
143 Ga0439450_093292 3300042008 Bacteria 758
144 Ga0439450_160617 3300042008 Bacteria 592
145 Ga0439458_0134152 3300042157 Bacteria 657
146 Ga0466969_0075719 3300044656 Bacteria 1612
147 Ga0466969_0102468 3300044656 Bacteria 1346
148 Ga0466969_0161251 3300044656 Bacteria 1030
149 Ga0466969_0186935 3300044656 Bacteria 947
150 Ga0466972_0148977 3300044658 Bacteria 1100
151 Ga0466965_0001236 3300044683 Bacteria 10110
152 Ga0466965_0008112 3300044683 Bacteria 4851
153 Ga0466965_0083980 3300044683 Bacteria 1612
154 Ga0466965_0091692 3300044683 Bacteria 1546
155 Ga0466966_0025511 3300044684 Bacteria 3859
156 Ga0466966_0041914 3300044684 Bacteria 2940
157 Ga0466966_0053136 3300044684 Bacteria 2570
158 Ga0466966_0058430 3300044684 Bacteria 2437
159 Ga0466966_0757039 3300044684 Bacteria 585
160 Ga0466961_0116076 3300044693 Bacteria 1682
161 Ga0466963_0032740 3300044694 Bacteria 3368
162 Ga0466964_0000163 3300044706 Bacteria 18439
163 Ga0466964_0043842 3300044706 Bacteria 1815
164 Ga0466970_0048703 3300044765 Bacteria 2260
165 Ga0466970_0192753 3300044765 Bacteria 1133
166 Ga0466957_0000007 3300044842 Bacteria 84513
167 Ga0466957_0027093 3300044842 Bacteria 3404
168 Ga0466957_0098671 3300044842 Bacteria 1838
169 Ga0466957_0106670 3300044842 Bacteria 1772
170 Ga0466960_0114381 3300044901 Bacteria 1406
171 Ga0466960_0643677 3300044901 Bacteria 632
172 Ga0466959_0029414 3300045049 Bacteria 4070
173 Ga0466959_0287050 3300045049 Bacteria 1128
174 Ga0466958_0064190 3300045836 Bacteria 2239
175 Ga0466958_0098425 3300045836 Bacteria 1816
176 Ga0466958_0223926 3300045836 Bacteria 1200
177 Ga0466958_0448723 3300045836 Bacteria 835
178 Ga0466967_0001164 3300045976 Bacteria 14741
179 Ga0466967_0176830 3300045976 Bacteria 2011
180 Ga0466967_0250612 3300045976 Bacteria 1691
181 Ga0495627_000255 3300046453 Bacteria 54602
182 Ga0495627_006218 3300046453 Bacteria 4700
183 Ga0495627_006421 3300046453 Bacteria 4610
184 Ga0495603_0309309 3300046455 Bacteria 907
185 Ga0495629_0046219 3300046459 Bacteria 3054
186 Ga0495638_0084028 3300046460 Bacteria 1927
187 Ga0495638_0084275 3300046460 Bacteria 1924
188 Ga0495638_0115682 3300046460 Bacteria 1589
189 Ga0495653_0158082 3300046463 Bacteria 1576
190 Ga0495650_0000477 3300046471 Bacteria 61376
191 Ga0495650_0013865 3300046471 Bacteria 4235
192 Ga0495650_0048992 3300046471 Bacteria 1757
193 Ga0495605_0000024 3300046474 Bacteria 236016
194 Ga0495605_0000044 3300046474 Bacteria 182513
195 Ga0495605_0000236 3300046474 Bacteria 67212
196 Ga0495605_0014617 3300046474 Bacteria 4292
197 Ga0495605_0016225 3300046474 Bacteria 4034
198 Ga0495605_0344993 3300046474 Bacteria 625
199 Ga0495584_0000003 3300046491 Bacteria 323768
200 Ga0495584_0000097 3300046491 Bacteria 59505
201 Ga0495584_0000657 3300046491 Bacteria 23045
202 Ga0495584_0009984 3300046491 Bacteria 4873
203 Ga0495584_0019199 3300046491 Bacteria 3472
204 Ga0495584_0021517 3300046491 Bacteria 3275
205 Ga0495584_0027783 3300046491 Bacteria 2866
206 Ga0495584_0043264 3300046491 Bacteria 2273
207 Ga0495584_0062019 3300046491 Bacteria 1879
208 Ga0495584_0082372 3300046491 Bacteria 1619
209 Ga0495584_0299689 3300046491 Bacteria 816
210 Ga0495585_0000130 3300046492 Bacteria 81689
211 Ga0495585_0000655 3300046492 Bacteria 31822
212 Ga0495585_0000807 3300046492 Bacteria 27258
213 Ga0495585_0001776 3300046492 Bacteria 16376
214 Ga0495585_0006830 3300046492 Bacteria 7038
215 Ga0495585_0008154 3300046492 Bacteria 6364
216 Ga0495585_0037898 3300046492 Bacteria 2714
217 Ga0495585_0068838 3300046492 Bacteria 1932
218 Ga0495585_0103274 3300046492 Bacteria 1522
219 Ga0495594_0144113 3300046499 Bacteria 1351
220 Ga0495596_0001049 3300046500 Bacteria 16417
221 Ga0495596_0005896 3300046500 Bacteria 5721
222 Ga0495596_0007439 3300046500 Bacteria 4941
223 Ga0495596_0010212 3300046500 Bacteria 4097
224 Ga0495596_0029115 3300046500 Bacteria 2215
225 Ga0495607_0001317 3300046501 Bacteria 22137
226 Ga0495607_0001333 3300046501 Bacteria 22039
227 Ga0495607_0002811 3300046501 Bacteria 13834
228 Ga0495607_0013597 3300046501 Bacteria 5328
229 Ga0495607_0014224 3300046501 Bacteria 5189
230 Ga0495607_0037431 3300046501 Bacteria 2915
231 Ga0495607_0056778 3300046501 Bacteria 2246
232 Ga0495607_0093853 3300046501 Bacteria 1620
233 Ga0495607_0228469 3300046501 Bacteria 906
234 Ga0495583_0000235 3300046506 Bacteria 91939
235 Ga0495583_0000560 3300046506 Bacteria 51454
236 Ga0495583_0001243 3300046506 Bacteria 27052
237 Ga0495583_0007311 3300046506 Bacteria 6972
238 Ga0495583_0014241 3300046506 Bacteria 4396
239 Ga0495583_0015784 3300046506 Bacteria 4090
240 Ga0495606_0000229 3300046507 Bacteria 98732
241 Ga0495606_0000537 3300046507 Bacteria 61013
242 Ga0495606_0002327 3300046507 Bacteria 22401
243 Ga0495606_0005020 3300046507 Bacteria 12897
244 Ga0495606_0015478 3300046507 Bacteria 5873
245 Ga0495606_0063852 3300046507 Bacteria 2345
246 Ga0495606_0118496 3300046507 Bacteria 1587
247 Ga0495606_0149490 3300046507 Bacteria 1372
248 Ga0495606_0213926 3300046507 Bacteria 1090
249 Ga0495606_0223020 3300046507 Bacteria 1061
250 Ga0495610_0003072 3300046512 Bacteria 13335
251 Ga0495616_0000634 3300046513 Bacteria 26282
252 Ga0495616_0000913 3300046513 Bacteria 21264
253 Ga0495616_0003494 3300046513 Bacteria 10051
254 Ga0495616_0005288 3300046513 Bacteria 7958
255 Ga0495616_0023002 3300046513 Bacteria 3358
256 Ga0495616_0038749 3300046513 Bacteria 2445
257 Ga0495616_0046097 3300046513 Bacteria 2202
258 Ga0495616_0084115 3300046513 Bacteria 1517
259 Ga0495616_0134870 3300046513 Bacteria 1128
260 Ga0495616_0212917 3300046513 Bacteria 845
261 Ga0495628_1040392 3300046516 Bacteria 562
262 Ga0495631_0005485 3300046518 Bacteria 6631
263 Ga0495631_0014378 3300046518 Bacteria 3821
264 Ga0495631_0050090 3300046518 Bacteria 1827
265 Ga0495631_0055205 3300046518 Bacteria 1730
266 Ga0495631_0193837 3300046518 Bacteria 869
267 Ga0495632_0000203 3300046519 Bacteria 60607
268 Ga0495632_0000225 3300046519 Bacteria 57394
269 Ga0495632_0005704 3300046519 Bacteria 8171
270 Ga0495632_0009707 3300046519 Bacteria 5776
271 Ga0495632_0016996 3300046519 Bacteria 4029
272 Ga0495643_0000171 3300046522 Bacteria 103167
273 Ga0495643_0002430 3300046522 Bacteria 14806
274 Ga0495643_0004286 3300046522 Bacteria 10060
275 Ga0495643_0014827 3300046522 Bacteria 4627
276 Ga0495643_0039456 3300046522 Bacteria 2582
277 Ga0495643_0059539 3300046522 Bacteria 2030
278 Ga0495643_0063034 3300046522 Bacteria 1961
279 Ga0495643_0170049 3300046522 Bacteria 1066
280 Ga0495644_0006396 3300046523 Bacteria 4567
281 Ga0495644_0056827 3300046523 Bacteria 1470
282 Ga0495648_0000003 3300046524 Bacteria 386817
283 Ga0495648_0000290 3300046524 Bacteria 57025
284 Ga0495648_0000863 3300046524 Bacteria 31958
285 Ga0495663_0205456 3300046525 Bacteria 688
286 Ga0495642_0000065 3300046528 Bacteria 63401
287 Ga0495642_0000125 3300046528 Bacteria 43793
288 Ga0495642_0002169 3300046528 Bacteria 8059
289 Ga0495642_0009551 3300046528 Bacteria 3712
290 Ga0495642_0066558 3300046528 Bacteria 1501
291 Ga0495642_0074366 3300046528 Bacteria 1424
292 Ga0495642_0074589 3300046528 Bacteria 1422
293 Ga0495642_0100954 3300046528 Bacteria 1228
294 Ga0495642_0111907 3300046528 Bacteria 1168
295 Ga0495654_0026371 3300046530 Bacteria 2987
296 Ga0495654_0039194 3300046530 Bacteria 2366
297 Ga0495654_0070954 3300046530 Bacteria 1651
298 Ga0495654_0230825 3300046530 Bacteria 778
299 Ga0495665_0142865 3300046531 Bacteria 1250
300 Ga0495665_0519442 3300046531 Bacteria 599
301 Ga0495640_0046100 3300046533 Bacteria 3023
302 Ga0495586_0010261 3300046535 Bacteria 4981
303 Ga0495609_0000030 3300046538 Bacteria 215885
304 Ga0495609_0000140 3300046538 Bacteria 76163
305 Ga0495609_0001927 3300046538 Bacteria 13189
306 Ga0495609_0014277 3300046538 Bacteria 3738
307 Ga0495609_0053355 3300046538 Bacteria 1797
308 Ga0495609_0089068 3300046538 Bacteria 1343
309 Ga0495609_0094040 3300046538 Bacteria 1302
310 Ga0495609_0119236 3300046538 Bacteria 1135
311 Ga0495597_0007929 3300046542 Bacteria 5351
312 Ga0495597_0008345 3300046542 Bacteria 5190
313 Ga0495597_0020828 3300046542 Bacteria 3050
314 Ga0495597_0068152 3300046542 Bacteria 1538
315 Ga0495597_0125224 3300046542 Bacteria 1068
316 Ga0495597_0369615 3300046542 Bacteria 548
317 Ga0495622_0140563 3300046557 Bacteria 1096
318 Ga0495633_0002846 3300046558 Bacteria 11908
319 Ga0495633_0010022 3300046558 Bacteria 5199
320 Ga0495633_0027799 3300046558 Bacteria 2761
321 Ga0495633_0053494 3300046558 Bacteria 1900
322 Ga0495633_0105444 3300046558 Bacteria 1307
323 Ga0495633_0362432 3300046558 Bacteria 656
324 Ga0495667_0178336 3300046559 Bacteria 1364
325 Ga0495656_0048541 3300046615 Bacteria 1804
326 Ga0495656_0059155 3300046615 Bacteria 1666
327 Ga0495656_0073127 3300046615 Bacteria 1528
328 Ga0495656_0086260 3300046615 Bacteria 1427
329 Ga0495656_0159100 3300046615 Bacteria 1096
330 Ga0495656_0366808 3300046615 Bacteria 749
331 Ga0495668_0000118 3300046616 Bacteria 119439
332 Ga0495668_0000155 3300046616 Bacteria 103810
333 Ga0495668_0001326 3300046616 Bacteria 24343
334 Ga0495668_0002548 3300046616 Bacteria 14824
335 Ga0495668_0010819 3300046616 Bacteria 5500
336 Ga0495668_0014413 3300046616 Bacteria 4635
337 Ga0495668_0014502 3300046616 Bacteria 4619
338 Ga0495668_0113973 3300046616 Bacteria 1478
339 Ga0495668_0258870 3300046616 Bacteria 952
340 Ga0495668_0281079 3300046616 Bacteria 912
341 Ga0495611_0005947 3300046648 Bacteria 5206
342 Ga0495611_0008176 3300046648 Bacteria 4437
343 Ga0495611_0067521 3300046648 Bacteria 1631
344 Ga0495611_0071471 3300046648 Bacteria 1586
345 Ga0495611_0461690 3300046648 Bacteria 578
346 Ga0495625_0080449 3300046660 Bacteria 2269
347 Ga0495625_0094653 3300046660 Bacteria 2060
348 Ga0495659_0056455 3300046664 Bacteria 1441
349 Ga0495659_0115174 3300046664 Bacteria 1053
350 Ga0495661_0000209 3300046665 Bacteria 67580
351 Ga0495661_0000754 3300046665 Bacteria 31377
352 Ga0495661_0000949 3300046665 Bacteria 26312
353 Ga0495661_0019946 3300046665 Bacteria 4384
354 Ga0495661_0025005 3300046665 Bacteria 3863
355 Ga0495661_0034032 3300046665 Bacteria 3209
356 Ga0495661_0045380 3300046665 Bacteria 2688
357 Ga0495661_0073542 3300046665 Bacteria 1991
358 Ga0495661_0076015 3300046665 Bacteria 1950
359 Ga0495661_0353460 3300046665 Bacteria 723
360 Ga0495588_0000062 3300046674 Bacteria 253674
361 Ga0495588_0012983 3300046674 Bacteria 3956
362 Ga0495588_0024193 3300046674 Bacteria 3015
363 Ga0495588_0051250 3300046674 Bacteria 2125
364 Ga0495646_0329848 3300046680 Bacteria 802
365 Ga0495658_0030410 3300046683 Bacteria 2932
366 Ga0495669_0001810 3300046684 Bacteria 8736
367 Ga0495669_0005892 3300046684 Bacteria 5108
368 Ga0495670_0001919 3300046691 Bacteria 10235
369 Ga0495670_0002673 3300046691 Bacteria 8797
370 Ga0495670_0005624 3300046691 Bacteria 6147
371 Ga0495670_0011073 3300046691 Bacteria 4435
372 Ga0495670_0027250 3300046691 Bacteria 2830
373 Ga0495670_0175268 3300046691 Bacteria 1130
374 Ga0495670_0261024 3300046691 Bacteria 924
375 Ga0495671_0000001 3300046692 Bacteria 1169494
376 Ga0495671_0016092 3300046692 Bacteria 3999
377 Ga0495671_0038943 3300046692 Bacteria 2401
378 Ga0495671_0071270 3300046692 Bacteria 1707
379 Ga0495649_0013209 3300046694 Bacteria 4770
380 Ga0495649_0016261 3300046694 Bacteria 4218
381 Ga0495649_0043540 3300046694 Bacteria 2450
382 Ga0495649_0307516 3300046694 Bacteria 806
383 Ga0495589_0000021 3300046794 Bacteria 197941
384 Ga0495589_0007566 3300046794 Bacteria 5691
385 Ga0495589_0011516 3300046794 Bacteria 4592
386 Ga0495589_0016859 3300046794 Bacteria 3750
387 Ga0495589_0017109 3300046794 Bacteria 3724
388 Ga0495589_0044688 3300046794 Bacteria 2202
389 Ga0495589_0065818 3300046794 Bacteria 1776
390 Ga0495589_0105649 3300046794 Bacteria 1360
391 Ga0495660_0000173 3300046810 Bacteria 69912
392 Ga0495660_0031763 3300046810 Bacteria 2967
393 Ga0495660_0040819 3300046810 Bacteria 2571
394 Ga0495660_0061692 3300046810 Bacteria 2011
395 Ga0495660_0070711 3300046810 Bacteria 1851
396 Ga0495604_0028553 3300047317 Bacteria 4438
397 Ga0495604_0218463 3300047317 Bacteria 1313
398 Ga0495636_0001814 3300047318 Bacteria 8168
399 Ga0495636_0007941 3300047318 Bacteria 4178
400 Ga0495636_0217557 3300047318 Bacteria 876
401 Ga0495672_0000480 3300047320 Bacteria 47220
402 Ga0495672_0005516 3300047320 Bacteria 10018
403 Ga0495672_0024758 3300047320 Bacteria 3860
404 Ga0495672_0056799 3300047320 Bacteria 2275
405 Ga0495672_0101997 3300047320 Bacteria 1554
406 Ga0495672_0180540 3300047320 Bacteria 1069
407 Ga0495676_0012785 3300047321 Bacteria 7549
408 Ga0495680_0011356 3300047322 Bacteria 7887
409 Ga0495683_0000243 3300047323 Bacteria 48918
410 Ga0495683_0008513 3300047323 Bacteria 5485
411 Ga0495683_0015027 3300047323 Bacteria 4031
412 Ga0495683_0036135 3300047323 Bacteria 2509
413 Ga0495683_0048631 3300047323 Bacteria 2126
414 Ga0495683_0068513 3300047323 Bacteria 1745
415 Ga0495683_0083777 3300047323 Bacteria 1552
416 Ga0495687_000276 3300047443 Bacteria 67876
417 Ga0495687_000279 3300047443 Bacteria 67230
418 Ga0495687_000319 3300047443 Bacteria 62530
419 Ga0495687_057275 3300047443 Bacteria 1621
420 Ga0495687_082261 3300047443 Bacteria 1257
421 Ga0495687_121217 3300047443 Bacteria 943
422 Ga0495687_158639 3300047443 Bacteria 764
423 Ga0495675_0045991 3300047444 Bacteria 2779
424 Ga0495675_0129851 3300047444 Bacteria 1566
425 Ga0495675_0268788 3300047444 Bacteria 1019
426 Ga0495677_0000050 3300047445 Bacteria 67980
427 Ga0495677_0001535 3300047445 Bacteria 9294
428 Ga0495677_0001924 3300047445 Bacteria 8305
429 Ga0495677_0002264 3300047445 Bacteria 7606
430 Ga0495677_0004877 3300047445 Bacteria 5116
431 Ga0495677_0006637 3300047445 Bacteria 4360
432 Ga0495677_0017098 3300047445 Bacteria 2629
433 Ga0495677_0092789 3300047445 Bacteria 1138
434 Ga0495679_007740 3300047446 Bacteria 4444
435 Ga0495679_013266 3300047446 Bacteria 3102
436 Ga0495685_001691 3300047447 Bacteria 6795
437 Ga0495685_105384 3300047447 Bacteria 930
438 Ga0495673_0000006 3300047469 Bacteria 908691
439 Ga0495673_0018702 3300047469 Bacteria 3487
440 Ga0495681_0001449 3300047470 Bacteria 17784
441 Ga0495681_0005424 3300047470 Bacteria 8540
442 Ga0495681_0013429 3300047470 Bacteria 4750
443 Ga0495681_0061130 3300047470 Bacteria 1736
444 Ga0495686_0000474 3300047472 Bacteria 59917
445 Ga0495686_0010651 3300047472 Bacteria 6529
446 Ga0495686_0021085 3300047472 Bacteria 4335
447 Ga0495593_0000781 3300047673 Bacteria 18483
448 Ga0495602_1016587 3300048088 Bacteria 546
449 Ga0495614_0000519 3300048089 Bacteria 15857
450 Ga0495615_0018392 3300048090 Bacteria 1537
451 Ga0495626_0000624 3300048091 Bacteria 34501
452 Ga0495626_0004146 3300048091 Bacteria 8998
453 Ga0495626_0010493 3300048091 Bacteria 4937
454 Ga0495626_0028494 3300048091 Bacteria 2707
455 Ga0495626_0029371 3300048091 Bacteria 2661
456 Ga0495626_0031911 3300048091 Bacteria 2532
457 Ga0495626_0065292 3300048091 Bacteria 1647
458 Ga0495626_0074559 3300048091 Bacteria 1518
459 Ga0495626_0103979 3300048091 Bacteria 1235
460 Ga0495626_0128833 3300048091 Bacteria 1082
461 Ga0495626_0141914 3300048091 Bacteria 1018
462 Ga0496100_0122580 3300048903 Bacteria 1821
463 Ga0496100_0349669 3300048903 Bacteria 1116
464 Ga0496101_0602362 3300048904 Bacteria 869
465 Ga0496101_0666171 3300048904 Bacteria 822
466 Ga0496102_0000343 3300048905 Bacteria 56826
467 Ga0496102_0015304 3300048905 Bacteria 6680
468 Ga0496102_0021536 3300048905 Bacteria 5701
469 Ga0496102_0137485 3300048905 Bacteria 2290
470 Ga0496103_0050725 3300048906 Bacteria 2567
471 Ga0496103_0586246 3300048906 Bacteria 711
472 Ga0496103_0964971 3300048906 Bacteria 532
473 Ga0496104_0186509 3300048907 Bacteria 1985
474 Ga0496106_0007451 3300048909 Bacteria 8087
475 Ga0496108_0589081 3300048911 Bacteria 969
476 Ga0496109_0067239 3300048912 Bacteria 3283
477 Ga0496109_0098527 3300048912 Bacteria 2710
478 Ga0496109_1022764 3300048912 Bacteria 764
479 Ga0496109_1528157 3300048912 Bacteria 602
480 Ga0496110_0314764 3300048913 Bacteria 1425
481 Ga0496111_0022480 3300048914 Bacteria 4416
482 Ga0496111_0715479 3300048914 Bacteria 728
483 Ga0496112_0126727 3300048915 Bacteria 2524
484 Ga0496115_0043328 3300048918 Bacteria 3589
485 Ga0496115_0218084 3300048918 Bacteria 1574
486 Ga0496115_0423373 3300048918 Bacteria 1078
487 Ga0496116_0032098 3300048919 Bacteria 3748
488 Ga0496116_0037708 3300048919 Bacteria 3367
489 Ga0496117_0000045 3300048920 Bacteria 301047
490 Ga0496118_0000041 3300048921 Bacteria 301047
491 Ga0496119_0223290 3300048922 Bacteria 963
492 Ga0496121_0001068 3300048924 Bacteria 48493
493 Ga0496121_0002658 3300048924 Bacteria 26800
494 Ga0496121_0005605 3300048924 Bacteria 16009
495 Ga0496121_0189393 3300048924 Bacteria 1477
496 Ga0496122_0007303 3300048925 Bacteria 12340
497 Ga0496123_0001857 3300048926 Bacteria 27725
498 Ga0496123_0054801 3300048926 Bacteria 2621
499 Ga0496124_0009567 3300048927 Bacteria 9958
500 Ga0496124_0010958 3300048927 Bacteria 9116
501 Ga0496124_0032442 3300048927 Bacteria 4611
502 Ga0496124_0054261 3300048927 Bacteria 3393
503 Ga0496124_0109588 3300048927 Bacteria 2225
504 Ga0496124_0348345 3300048927 Bacteria 1049
505 Ga0496124_0795686 3300048927 Bacteria 586
506 Ga0496125_0159321 3300048928 Bacteria 1536
507 Ga0496125_0201002 3300048928 Bacteria 1304
508 Ga0496125_0219557 3300048928 Bacteria 1226
509 Ga0495678_000162 3300049459 Bacteria 79674
510 Ga0495678_000293 3300049459 Bacteria 54963
511 Ga0495678_001013 3300049459 Bacteria 24008
512 Ga0495678_006351 3300049459 Bacteria 6303
513 Ga0495678_016414 3300049459 Bacteria 3386
514 Ga0495678_106489 3300049459 Bacteria 963
515 Ga0495678_165978 3300049459 Bacteria 702
516 Ga0495682_0000509 3300049460 Bacteria 26895
517 Ga0495682_0110451 3300049460 Bacteria 985
518 Ga0501315_002804 3300049531 Bacteria 1684
519 Ga0501315_068580 3300049531 Bacteria 585
520 Ga0501316_001139 3300049532 Bacteria 2168
521 Ga0501034_0765014 3300049571 Bacteria 860
522 Ga0501046_0000226 3300049580 Bacteria 58757
523 Ga0501047_0000302 3300049581 Bacteria 56851
524 Ga0501047_0151277 3300049581 Bacteria 2197
525 Ga0501048_0003939 3300049582 Bacteria 11284
526 Ga0501238_056850 3300049671 Bacteria 592
527 Ga0501250_068550 3300049680 Bacteria 581
528 Ga0501279_006268 3300049775 Bacteria 1570
529 Ga0501035_0003370 3300049822 Bacteria 15295
530 nmdc:mga06z11_205728_c1 3300050494 Bacteria 1145
531 nmdc:mga07m45_103067_c1 3300050496 Bacteria 1376
532 Ga0500618_029093 3300053125 Bacteria 1305
533 Ga0500619_000084 3300053154 Bacteria 26259
534 Ga0500587_003214 3300053739 Bacteria 2298
535 Ga0590075_100288 3300059424 Bacteria 754
536 Ga0587068_015875 3300059641 Bacteria 1189
537 Ga0466962_0283775 3300061719 Bacteria 817
538 Ga0466962_0374721 3300061719 Bacteria 710
539 2513952380 2513237150 Bacteria 6553639
540 2587754525 2585428062 Bacteria 6842168
541 2599510253 2599185189 Bacteria 5862825
542 2601667459 2600255292 Bacteria 6300551
543 2644355782 2643221664 Bacteria 7272945
544 2738742156 2738541280 Bacteria 6630198
545 2738841321 2738541300 Bacteria 6675882
546 2739153887 2738541357 Bacteria 6549408
547 2739195807 2738543003 Bacteria 6549560
548 2739272191 2738543018 Bacteria 6718814
549 2739322283 2738543026 Bacteria 6549408
550 2739340524 2738543029 Bacteria 6549249
551 2739341235 2738543030 Bacteria 6719714
552 2809142778 2808606418 Bacteria 6724496
553 2842712731 2842711865 Bacteria 7155354
554 2857551316 2857547612 Bacteria 6179999
555 2857551819 2857547612 Bacteria 6179999
556 2857564495 2857558681 Bacteria 6617694
557 2904425200 2904424332 Bacteria 7633521
558 2904426316 2904424332 Bacteria 7633521
559 2919477898 2919476304 Bacteria 5888696
560 2932411071 2932410948 Bacteria 6312192
561 2932416460 2932410948 Bacteria 6312192
562 2932417139 2932416698 Bacteria 6315112
563 2932419362 2932416698 Bacteria 6315112
564 Ga0501313_006245
565 JGI25150J39212_1002686
566 JGI25159J45721_1004405
567 Ga0006759J45824_1049560
568 rootL2_10178613
569 Ga0055525_1000047
570 Ga0055526_1003332
571 Ga0055537_1000248
572 Ga0055524_1000021
573 Ga0055524_1005175
574 Ga0055534_1000318
575 Ga0055528_1000116
576 Ga0055543_1006681
577 Ga0065165_1000630
578 Ga0065165_1032915
579 Ga0065714_10119742
580 Ga0070658_10187716
581 Ga0070682_100577336
582 Ga0070660_100049675
583 Ga0070660_100184814
584 Ga0070660_100436355
585 Ga0070661_100108999
586 Ga0070659_100411039
587 Ga0070663_100109839
588 Ga0070662_100215759
589 Ga0070662_100746708
590 Ga0070672_100593160
591 Ga0068855_100081836
592 Ga0070664_100098391
593 Ga0068856_100226794
594 Ga0068852_100172577
595 Ga0070716_100178177
596 Ga0075367_10151836
597 Ga0068865_100236463
598 Ga0105245_10110816
599 Ga0105243_10125915
600 Ga0105241_10583003
601 Ga0105242_10022993
602 Ga0105248_11456117
603 Ga0105237_10280296
604 Ga0105238_10187663
605 Ga0157373_10231832
606 Ga0157371_10502872
607 Ga0157369_10794764
608 Ga0157374_10918875
609 Ga0182008_10000228
610 Ga0182008_10006642
611 Ga0182006_1000142
612 Ga0182007_10000231
613 Ga0182005_1000090
614 Ga0163161_10058471
615 Ga0163161_10065577
616 Ga0209436_108583
617 Ga0209563_100003
618 Ga0207425_1000318
619 Ga0209677_102029
620 Ga0209148_1001353
621 Ga0209565_1000009
622 Ga0209673_1000019
623 Ga0209130_1003480
624 Ga0209675_1000028
625 Ga0209025_1003609
626 Ga0209564_1000058
627 Ga0209564_1021418
628 Ga0209758_1000675
629 Ga0209256_1000044
630 Ga0209256_1000093
631 Ga0207426_1036634
632 Ga0207705_10074561
633 Ga0207705_10421702
634 Ga0207654_10061273
635 Ga0207671_10143141
636 Ga0207657_10003522
637 Ga0207657_10032076
638 Ga0207657_10215831
639 Ga0207657_10272440
640 Ga0207694_10106979
641 Ga0207687_10467552
642 Ga0207690_10104052
643 Ga0207706_10005937
644 Ga0207706_10106679
645 Ga0207686_10002979
646 Ga0207704_10159109
647 Ga0207665_10216039
648 Ga0207667_10018225
649 Ga0207678_10669588
650 Ga0207702_11169880
651 Ga0207698_10353097
652 Ga0209974_10002896
653 Ga0307515_10000381
654 Ga0307515_10002386
655 Ga0307515_10009310
656 Ga0307512_10064991
657 Ga0307512_10247649
658 Ga0265328_10106892
659 Ga0265327_10000205
660 Ga0307513_10009505
661 Ga0307509_10241816
662 Ga0307408_100000735
663 Ga0307508_10000194
664 Ga0307514_10014297
665 Ga0307516_10009770
666 Ga0307507_10011647
667 Ga0373939_0032490
668 Ga0395899_0002576
669 Ga0395899_0078926
670 Ga0395900_0000763
671 Ga0395900_0179082
672 Ga0395900_0190798
673 Ga0395900_0255632
674 Ga0395900_0284786
675 Ga0395900_0382423
676 Ga0395900_0446947
677 Ga0395898_0056317
678 Ga0395898_0892230
679 Ga0395905_0072684
680 Ga0395905_0124627
681 Ga0395905_0132405
682 Ga0395905_0242639
683 Ga0395905_0409058
684 Ga0395905_0491859
685 Ga0395901_0000097
686 Ga0395901_0053904
687 Ga0395901_0082617
688 Ga0395901_0145881
689 Ga0395901_0270960
690 Ga0395901_0318499
691 Ga0395901_0449224
692 Ga0395901_1425133
693 Ga0395901_1645216
694 Ga0436361_0674642
695 Ga0451789_0916289
696 Ga0451791_0523573
697 Ga0451795_0697288
698 Ga0451798_0428385
699 Ga0451800_0130513
700 Ga0451833_0498765
701 Ga0451841_1119001
702 Ga0451849_0995850
703 Ga0451843_0325161
704 Ga0451853_0705861
705 Ga0439448_0088639
706 Ga0439450_093292
707 Ga0439450_160617
708 Ga0439458_0134152
709 Ga0466969_0075719
710 Ga0466969_0102468
711 Ga0466969_0161251
712 Ga0466969_0186935
713 Ga0466972_0148977
714 Ga0466965_0001236
715 Ga0466965_0008112
716 Ga0466965_0083980
717 Ga0466965_0091692
718 Ga0466966_0025511
719 Ga0466966_0041914
720 Ga0466966_0053136
721 Ga0466966_0058430
722 Ga0466966_0757039
723 Ga0466961_0116076
724 Ga0466963_0032740
725 Ga0466964_0000163
726 Ga0466964_0043842
727 Ga0466970_0048703
728 Ga0466970_0192753
729 Ga0466957_0000007
730 Ga0466957_0027093
731 Ga0466957_0098671
732 Ga0466957_0106670
733 Ga0466960_0114381
734 Ga0466960_0643677
735 Ga0466959_0029414
736 Ga0466959_0287050
737 Ga0466958_0064190
738 Ga0466958_0098425
739 Ga0466958_0223926
740 Ga0466958_0448723
741 Ga0466967_0001164
742 Ga0466967_0176830
743 Ga0466967_0250612
744 Ga0495627_000255
745 Ga0495627_006218
746 Ga0495627_006421
747 Ga0495603_0309309
748 Ga0495629_0046219
749 Ga0495638_0084028
750 Ga0495638_0084275
751 Ga0495638_0115682
752 Ga0495653_0158082
753 Ga0495650_0000477
754 Ga0495650_0013865
755 Ga0495650_0048992
756 Ga0495605_0000024
757 Ga0495605_0000044
758 Ga0495605_0000236
759 Ga0495605_0014617
760 Ga0495605_0016225
761 Ga0495605_0344993
762 Ga0495584_0000003
763 Ga0495584_0000097
764 Ga0495584_0000657
765 Ga0495584_0009984
766 Ga0495584_0019199
767 Ga0495584_0021517
768 Ga0495584_0027783
769 Ga0495584_0043264
770 Ga0495584_0062019
771 Ga0495584_0082372
772 Ga0495584_0299689
773 Ga0495585_0000130
774 Ga0495585_0000655
775 Ga0495585_0000807
776 Ga0495585_0001776
777 Ga0495585_0006830
778 Ga0495585_0008154
779 Ga0495585_0037898
780 Ga0495585_0068838
781 Ga0495585_0103274
782 Ga0495594_0144113
783 Ga0495596_0001049
784 Ga0495596_0005896
785 Ga0495596_0007439
786 Ga0495596_0010212
787 Ga0495596_0029115
788 Ga0495607_0001317
789 Ga0495607_0001333
790 Ga0495607_0002811
791 Ga0495607_0013597
792 Ga0495607_0014224
793 Ga0495607_0037431
794 Ga0495607_0056778
795 Ga0495607_0093853
796 Ga0495607_0228469
797 Ga0495583_0000235
798 Ga0495583_0000560
799 Ga0495583_0001243
800 Ga0495583_0007311
801 Ga0495583_0014241
802 Ga0495583_0015784
803 Ga0495606_0000229
804 Ga0495606_0000537
805 Ga0495606_0002327
806 Ga0495606_0005020
807 Ga0495606_0015478
808 Ga0495606_0063852
809 Ga0495606_0118496
810 Ga0495606_0149490
811 Ga0495606_0213926
812 Ga0495606_0223020
813 Ga0495610_0003072
814 Ga0495616_0000634
815 Ga0495616_0000913
816 Ga0495616_0003494
817 Ga0495616_0005288
818 Ga0495616_0023002
819 Ga0495616_0038749
820 Ga0495616_0046097
821 Ga0495616_0084115
822 Ga0495616_0134870
823 Ga0495616_0212917
824 Ga0495628_1040392
825 Ga0495631_0005485
826 Ga0495631_0014378
827 Ga0495631_0050090
828 Ga0495631_0055205
829 Ga0495631_0193837
830 Ga0495632_0000203
831 Ga0495632_0000225
832 Ga0495632_0005704
833 Ga0495632_0009707
834 Ga0495632_0016996
835 Ga0495643_0000171
836 Ga0495643_0002430
837 Ga0495643_0004286
838 Ga0495643_0014827
839 Ga0495643_0039456
840 Ga0495643_0059539
841 Ga0495643_0063034
842 Ga0495643_0170049
843 Ga0495644_0006396
844 Ga0495644_0056827
845 Ga0495648_0000003
846 Ga0495648_0000290
847 Ga0495648_0000863
848 Ga0495663_0205456
849 Ga0495642_0000065
850 Ga0495642_0000125
851 Ga0495642_0002169
852 Ga0495642_0009551
853 Ga0495642_0066558
854 Ga0495642_0074366
855 Ga0495642_0074589
856 Ga0495642_0100954
857 Ga0495642_0111907
858 Ga0495654_0026371
859 Ga0495654_0039194
860 Ga0495654_0070954
861 Ga0495654_0230825
862 Ga0495665_0142865
863 Ga0495665_0519442
864 Ga0495640_0046100
865 Ga0495586_0010261
866 Ga0495609_0000030
867 Ga0495609_0000140
868 Ga0495609_0001927
869 Ga0495609_0014277
870 Ga0495609_0053355
871 Ga0495609_0089068
872 Ga0495609_0094040
873 Ga0495609_0119236
874 Ga0495597_0007929
875 Ga0495597_0008345
876 Ga0495597_0020828
877 Ga0495597_0068152
878 Ga0495597_0125224
879 Ga0495597_0369615
880 Ga0495622_0140563
881 Ga0495633_0002846
882 Ga0495633_0010022
883 Ga0495633_0027799
884 Ga0495633_0053494
885 Ga0495633_0105444
886 Ga0495633_0362432
887 Ga0495667_0178336
888 Ga0495656_0048541
889 Ga0495656_0059155
890 Ga0495656_0073127
891 Ga0495656_0086260
892 Ga0495656_0159100
893 Ga0495656_0366808
894 Ga0495668_0000118
895 Ga0495668_0000155
896 Ga0495668_0001326
897 Ga0495668_0002548
898 Ga0495668_0010819
899 Ga0495668_0014413
900 Ga0495668_0014502
901 Ga0495668_0113973
902 Ga0495668_0258870
903 Ga0495668_0281079
904 Ga0495611_0005947
905 Ga0495611_0008176
906 Ga0495611_0067521
907 Ga0495611_0071471
908 Ga0495611_0461690
909 Ga0495625_0080449
910 Ga0495625_0094653
911 Ga0495659_0056455
912 Ga0495659_0115174
913 Ga0495661_0000209
914 Ga0495661_0000754
915 Ga0495661_0000949
916 Ga0495661_0019946
917 Ga0495661_0025005
918 Ga0495661_0034032
919 Ga0495661_0045380
920 Ga0495661_0073542
921 Ga0495661_0076015
922 Ga0495661_0353460
923 Ga0495588_0000062
924 Ga0495588_0012983
925 Ga0495588_0024193
926 Ga0495588_0051250
927 Ga0495646_0329848
928 Ga0495658_0030410
929 Ga0495669_0001810
930 Ga0495669_0005892
931 Ga0495670_0001919
932 Ga0495670_0002673
933 Ga0495670_0005624
934 Ga0495670_0011073
935 Ga0495670_0027250
936 Ga0495670_0175268
937 Ga0495670_0261024
938 Ga0495671_0000001
939 Ga0495671_0016092
940 Ga0495671_0038943
941 Ga0495671_0071270
942 Ga0495649_0013209
943 Ga0495649_0016261
944 Ga0495649_0043540
945 Ga0495649_0307516
946 Ga0495589_0000021
947 Ga0495589_0007566
948 Ga0495589_0011516
949 Ga0495589_0016859
950 Ga0495589_0017109
951 Ga0495589_0044688
952 Ga0495589_0065818
953 Ga0495589_0105649
954 Ga0495660_0000173
955 Ga0495660_0031763
956 Ga0495660_0040819
957 Ga0495660_0061692
958 Ga0495660_0070711
959 Ga0495604_0028553
960 Ga0495604_0218463
961 Ga0495636_0001814
962 Ga0495636_0007941
963 Ga0495636_0217557
964 Ga0495672_0000480
965 Ga0495672_0005516
966 Ga0495672_0024758
967 Ga0495672_0056799
968 Ga0495672_0101997
969 Ga0495672_0180540
970 Ga0495676_0012785
971 Ga0495680_0011356
972 Ga0495683_0000243
973 Ga0495683_0008513
974 Ga0495683_0015027
975 Ga0495683_0036135
976 Ga0495683_0048631
977 Ga0495683_0068513
978 Ga0495683_0083777
979 Ga0495687_000276
980 Ga0495687_000279
981 Ga0495687_000319
982 Ga0495687_057275
983 Ga0495687_082261
984 Ga0495687_121217
985 Ga0495687_158639
986 Ga0495675_0045991
987 Ga0495675_0129851
988 Ga0495675_0268788
989 Ga0495677_0000050
990 Ga0495677_0001535
991 Ga0495677_0001924
992 Ga0495677_0002264
993 Ga0495677_0004877
994 Ga0495677_0006637
995 Ga0495677_0017098
996 Ga0495677_0092789
997 Ga0495679_007740
998 Ga0495679_013266
999 Ga0495685_001691
1000 Ga0495685_105384
1001 Ga0495673_0000006
1002 Ga0495673_0018702
1003 Ga0495681_0001449
1004 Ga0495681_0005424
1005 Ga0495681_0013429
1006 Ga0495681_0061130
1007 Ga0495686_0000474
1008 Ga0495686_0010651
1009 Ga0495686_0021085
1010 Ga0495593_0000781
1011 Ga0495602_1016587
1012 Ga0495614_0000519
1013 Ga0495615_0018392
1014 Ga0495626_0000624
1015 Ga0495626_0004146
1016 Ga0495626_0010493
1017 Ga0495626_0028494
1018 Ga0495626_0029371
1019 Ga0495626_0031911
1020 Ga0495626_0065292
1021 Ga0495626_0074559
1022 Ga0495626_0103979
1023 Ga0495626_0128833
1024 Ga0495626_0141914
1025 Ga0496100_0122580
1026 Ga0496100_0349669
1027 Ga0496101_0602362
1028 Ga0496101_0666171
1029 Ga0496102_0000343
1030 Ga0496102_0015304
1031 Ga0496102_0021536
1032 Ga0496102_0137485
1033 Ga0496103_0050725
1034 Ga0496103_0586246
1035 Ga0496103_0964971
1036 Ga0496104_0186509
1037 Ga0496106_0007451
1038 Ga0496108_0589081
1039 Ga0496109_0067239
1040 Ga0496109_0098527
1041 Ga0496109_1022764
1042 Ga0496109_1528157
1043 Ga0496110_0314764
1044 Ga0496111_0022480
1045 Ga0496111_0715479
1046 Ga0496112_0126727
1047 Ga0496115_0043328
1048 Ga0496115_0218084
1049 Ga0496115_0423373
1050 Ga0496116_0032098
1051 Ga0496116_0037708
1052 Ga0496117_0000045
1053 Ga0496118_0000041
1054 Ga0496119_0223290
1055 Ga0496121_0001068
1056 Ga0496121_0002658
1057 Ga0496121_0005605
1058 Ga0496121_0189393
1059 Ga0496122_0007303
1060 Ga0496123_0001857
1061 Ga0496123_0054801
1062 Ga0496124_0009567
1063 Ga0496124_0010958
1064 Ga0496124_0032442
1065 Ga0496124_0054261
1066 Ga0496124_0109588
1067 Ga0496124_0348345
1068 Ga0496124_0795686
1069 Ga0496125_0159321
1070 Ga0496125_0201002
1071 Ga0496125_0219557
1072 Ga0495678_000162
1073 Ga0495678_000293
1074 Ga0495678_001013
1075 Ga0495678_006351
1076 Ga0495678_016414
1077 Ga0495678_106489
1078 Ga0495678_165978
1079 Ga0495682_0000509
1080 Ga0495682_0110451
1081 Ga0501315_002804
1082 Ga0501315_068580
1083 Ga0501316_001139
1084 Ga0501034_0765014
1085 Ga0501046_0000226
1086 Ga0501047_0000302
1087 Ga0501047_0151277
1088 Ga0501048_0003939
1089 Ga0501238_056850
1090 Ga0501250_068550
1091 Ga0501279_006268
1092 Ga0501035_0003370
1093 nmdc:mga06z11_205728_c1
1094 nmdc:mga07m45_103067_c1
1095 Ga0500618_029093
1096 Ga0500619_000084
1097 Ga0500587_003214
1098 Ga0590075_100288
1099 Ga0587068_015875
1100 Ga0466962_0283775
1101 Ga0466962_0374721
1102 2513952380
1103 2587754525
1104 2599510253
1105 2601667459
1106 2644355782
1107 2738742156
1108 2738841321
1109 2739153887
1110 2739195807
1111 2739272191
1112 2739322283
1113 2739340524
1114 2739341235
1115 2809142778
1116 2842712731
1117 2857551316
1118 2857551819
1119 2857564495
1120 2904425200
1121 2904426316
1122 2919477898
1123 2932411071
1124 2932416460
1125 2932417139
1126 2932419362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05591

T6SS_VipA

Type VI secretion system, VipA, VC_A0107 or Hcp2

11

165

0.98

Map