F464119

General Info

Members Datasets Scaffolds Average Seq Length
563 307 1126 402

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055172936|8055176810
Length 446
Sequence GPGKHPDRDGPVPLDPFQDGPVSDDPLKDGLFREGPLTNDRVGGGALLDRFEQTWSALSRVGDEGARGYRRFAWTPVDLALRTWFREQAEARGMDCEQDRNGNLWAWWGTPGPGAVVTGSHLDSVPGGGAFDGPLGVVSAFLAVDLLRERGVVPERPIAVVNFADEEGARFGVACVGSRLLAGVLAPDAARALRDADGVTLAEAMRAAGADPGALGRDEEALARIGAFVELHIEQGRGLAGLDAPVGVASAIWPHGRWRCTFHGEGNHAGTTLLADRRDPMLPFASAVLATRQAAERLGAVATFGKVLVDPNGTNAIASRVDAWLDGRAPDSATVRKMVEEITGAAEAAGAGHGVRVEVVEESWTPVVEFGGELRDRVAATLGGVPALPTGAGHDAGILSAYVPSAMLFVRNPTGTSHSPAEHAEPADCVAGILALTAALEDLACG

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
282 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
283 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
290 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
291 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
292 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
293 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
294 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
295 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
296 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
297 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
298 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
299 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
300 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
301 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
302 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
303 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
304 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
305 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
306 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
307 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0.53
Isolates 3.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.8
Nodule 0
Rhizoplane 14.74
Rhizosphere 73.18
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1002969 3300002073 Bacteria 1758
2 JGI24744J21845_10000359 3300002077 Bacteria 7761
3 Ga0055540_1001451 3300003792 Bacteria 14120
4 Ga0055540_1001925 3300003792 Bacteria 11596
5 Ga0055540_1002814 3300003792 Bacteria 8899
6 Ga0055540_1005837 3300003792 Bacteria 5050
7 Ga0070658_10011995 3300005327 Bacteria 6958
8 Ga0070676_10155550 3300005328 Bacteria 1467
9 Ga0070683_100000236 3300005329 Bacteria 37800
10 Ga0070683_100098861 3300005329 Bacteria 2746
11 Ga0070690_100014568 3300005330 Bacteria 4666
12 Ga0070670_100083928 3300005331 Bacteria 2737
13 Ga0070670_100202029 3300005331 Bacteria 1727
14 Ga0070677_10010713 3300005333 Bacteria 3143
15 Ga0068869_100016126 3300005334 Bacteria 5031
16 Ga0068869_100092837 3300005334 Bacteria 2273
17 Ga0068869_100232676 3300005334 Bacteria 1465
18 Ga0070666_10144702 3300005335 Bacteria 1657
19 Ga0070680_100196961 3300005336 Bacteria 1698
20 Ga0070682_100003664 3300005337 Bacteria 8526
21 Ga0068868_100003669 3300005338 Bacteria 10719
22 Ga0068868_100085264 3300005338 Bacteria 2538
23 Ga0070660_100006166 3300005339 Bacteria 8296
24 Ga0070689_100004896 3300005340 Bacteria 9083
25 Ga0070689_100111606 3300005340 Bacteria 2175
26 Ga0070691_10008852 3300005341 Bacteria 4608
27 Ga0070668_100004934 3300005347 Bacteria 9879
28 Ga0070669_100000385 3300005353 Bacteria 33896
29 Ga0070673_100149593 3300005364 Bacteria 1976
30 Ga0070688_100022601 3300005365 Bacteria 3688
31 Ga0070659_100058769 3300005366 Bacteria 3036
32 Ga0070667_100000308 3300005367 Bacteria 54638
33 Ga0070667_100001250 3300005367 Bacteria 23094
34 Ga0070667_100111677 3300005367 Bacteria 2371
35 Ga0070709_10028936 3300005434 Bacteria 3308
36 Ga0070714_100003617 3300005435 Bacteria 11568
37 Ga0070714_100013156 3300005435 Bacteria 6626
38 Ga0070714_100019404 3300005435 Bacteria 5539
39 Ga0070713_100032310 3300005436 Bacteria 4179
40 Ga0070710_10004789 3300005437 Bacteria 6401
41 Ga0070710_10110009 3300005437 Bacteria 1654
42 Ga0070701_10127920 3300005438 Bacteria 1440
43 Ga0070711_100001940 3300005439 Bacteria 11588
44 Ga0070711_100003880 3300005439 Bacteria 8778
45 Ga0070711_100048198 3300005439 Bacteria 2911
46 Ga0070711_100096339 3300005439 Bacteria 2143
47 Ga0070705_100033998 3300005440 Bacteria 2846
48 Ga0070700_100015736 3300005441 Bacteria 4296
49 Ga0070694_100006522 3300005444 Bacteria 7089
50 Ga0070663_100013063 3300005455 Bacteria 5276
51 Ga0070678_100000765 3300005456 Bacteria 16105
52 Ga0070678_100137944 3300005456 Bacteria 1947
53 Ga0070662_100023726 3300005457 Bacteria 4217
54 Ga0070681_10060573 3300005458 Bacteria 3761
55 Ga0068867_100002126 3300005459 Bacteria 13905
56 Ga0068867_100108546 3300005459 Bacteria 2129
57 Ga0070706_100008823 3300005467 Bacteria 9394
58 Ga0070706_100021243 3300005467 Bacteria 5979
59 Ga0070707_100028389 3300005468 Bacteria 5325
60 Ga0070707_100034988 3300005468 Bacteria 4789
61 Ga0070707_100035376 3300005468 Bacteria 4764
62 Ga0070679_100135382 3300005530 Bacteria 2445
63 Ga0070684_100001605 3300005535 Bacteria 16331
64 Ga0070684_100005379 3300005535 Bacteria 9808
65 Ga0070684_100087749 3300005535 Bacteria 2762
66 Ga0070684_100204279 3300005535 Bacteria 1800
67 Ga0068853_100004948 3300005539 Bacteria 10380
68 Ga0070686_100037837 3300005544 Bacteria 2996
69 Ga0070695_100006710 3300005545 Bacteria 6809
70 Ga0070696_100002116 3300005546 Bacteria 13055
71 Ga0070693_100018445 3300005547 Bacteria 3645
72 Ga0070665_100001277 3300005548 Bacteria 30184
73 Ga0070665_100008854 3300005548 Bacteria 10191
74 Ga0070665_100026011 3300005548 Bacteria 5895
75 Ga0070665_100413332 3300005548 Bacteria 1358
76 Ga0068855_100008166 3300005563 Bacteria 12655
77 Ga0068855_100115438 3300005563 Bacteria 3078
78 Ga0070664_100005547 3300005564 Bacteria 10133
79 Ga0070664_100069197 3300005564 Bacteria 3019
80 Ga0068857_100155317 3300005577 Bacteria 2075
81 Ga0068854_100000953 3300005578 Bacteria 17419
82 Ga0068854_100073353 3300005578 Bacteria 2508
83 Ga0068854_100075704 3300005578 Bacteria 2472
84 Ga0068856_100003239 3300005614 Bacteria 16573
85 Ga0068856_100031825 3300005614 Bacteria 5161
86 Ga0068856_100102098 3300005614 Bacteria 2861
87 Ga0068856_100134354 3300005614 Bacteria 2479
88 Ga0068852_100010135 3300005616 Bacteria 7019
89 Ga0068852_100035072 3300005616 Bacteria 4180
90 Ga0068852_100082928 3300005616 Bacteria 2850
91 Ga0068859_100002421 3300005617 Bacteria 18996
92 Ga0068859_100006002 3300005617 Bacteria 12342
93 Ga0068859_100301520 3300005617 Bacteria 1695
94 Ga0068864_100271200 3300005618 Bacteria 1581
95 Ga0068866_10000693 3300005718 Bacteria 15308
96 Ga0068851_10069260 3300005834 Bacteria 1822
97 Ga0068863_100000875 3300005841 Bacteria 30197
98 Ga0068858_100000702 3300005842 Bacteria 34951
99 Ga0068858_100072406 3300005842 Bacteria 3197
100 Ga0068858_100144866 3300005842 Bacteria 2231
101 Ga0068860_100000155 3300005843 Bacteria 111737
102 Ga0068860_100045119 3300005843 Bacteria 4202
103 Ga0068862_100000096 3300005844 Bacteria 104906
104 Ga0068862_100131570 3300005844 Bacteria 2213
105 Ga0068862_100234590 3300005844 Bacteria 1665
106 Ga0081455_10053197 3300005937 Bacteria 3460
107 Ga0070717_10009856 3300006028 Bacteria 7196
108 Ga0070717_10030635 3300006028 Bacteria 4322
109 Ga0070717_10033248 3300006028 Bacteria 4160
110 Ga0070717_10035447 3300006028 Bacteria 4039
111 Ga0070717_10162909 3300006028 Bacteria 1936
112 Ga0075365_10011937 3300006038 Bacteria 5132
113 Ga0075364_10010526 3300006051 Bacteria 5590
114 Ga0075364_10042181 3300006051 Bacteria 2964
115 Ga0070716_100015483 3300006173 Bacteria 3918
116 Ga0070716_100076886 3300006173 Bacteria 1979
117 Ga0070712_100001708 3300006175 Bacteria 13452
118 Ga0070712_100176990 3300006175 Bacteria 1659
119 Ga0070712_100200609 3300006175 Bacteria 1567
120 Ga0075362_10079505 3300006177 Bacteria 1510
121 Ga0075369_10010836 3300006186 Bacteria 3573
122 Ga0075369_10016484 3300006186 Bacteria 2983
123 Ga0075369_10056961 3300006186 Bacteria 1699
124 Ga0075433_10053946 3300006852 Bacteria 3506
125 Ga0075434_100000973 3300006871 Bacteria 23105
126 Ga0075434_100003144 3300006871 Bacteria 14720
127 Ga0068865_100141249 3300006881 Bacteria 1816
128 Ga0075436_100020072 3300006914 Bacteria 4585
129 Ga0075436_100025530 3300006914 Bacteria 4067
130 Ga0097620_100002421 3300006931 Bacteria 18996
131 Ga0097620_100006002 3300006931 Bacteria 12342
132 Ga0097620_100301517 3300006931 Bacteria 1695
133 Ga0075435_100000686 3300007076 Bacteria 20987
134 Ga0075435_100136860 3300007076 Bacteria 2052
135 Ga0099795_10013891 3300007788 Bacteria 2483
136 Ga0105250_10047964 3300009092 Bacteria 1713
137 Ga0111539_10173703 3300009094 Bacteria 2517
138 Ga0105245_10085258 3300009098 Bacteria 2895
139 Ga0105245_10092752 3300009098 Bacteria 2781
140 Ga0105247_10000040 3300009101 Bacteria 158975
141 Ga0105247_10002640 3300009101 Bacteria 12071
142 Ga0105247_10028341 3300009101 Bacteria 3388
143 Ga0105243_10090895 3300009148 Bacteria 2513
144 Ga0105243_10118314 3300009148 Bacteria 2229
145 Ga0105242_10002280 3300009176 Bacteria 15153
146 Ga0105248_10000095 3300009177 Bacteria 98093
147 Ga0105248_10040302 3300009177 Bacteria 5235
148 Ga0105248_10379762 3300009177 Bacteria 1591
149 Ga0105237_10017270 3300009545 Bacteria 7480
150 Ga0105237_10018942 3300009545 Bacteria 7114
151 Ga0105238_10009327 3300009551 Bacteria 9827
152 Ga0105249_10000069 3300009553 Bacteria 148118
153 Ga0105249_10116750 3300009553 Bacteria 2530
154 Ga0099796_10023761 3300010159 Bacteria 1918
155 Ga0105239_10018075 3300010375 Bacteria 7799
156 Ga0105239_10169490 3300010375 Bacteria 2441
157 Ga0105246_10079396 3300011119 Bacteria 2333
158 Ga0157370_10266577 3300013104 Unclassified 1582
159 Ga0157369_10355419 3300013105 Bacteria 1521
160 Ga0157374_10016149 3300013296 Bacteria 6561
161 Ga0157374_10018883 3300013296 Bacteria 6094
162 Ga0157374_10122562 3300013296 Bacteria 2511
163 Ga0157378_10426590 3300013297 Bacteria 1312
164 Ga0157372_10610012 3300013307 Bacteria 1272
165 Ga0157375_10355370 3300013308 Bacteria 1631
166 Ga0163163_10002322 3300014325 Bacteria 16069
167 Ga0163163_10015708 3300014325 Bacteria 7010
168 Ga0157380_10061072 3300014326 Bacteria 3014
169 Ga0157380_10314017 3300014326 Bacteria 1450
170 Ga0157379_10040522 3300014968 Bacteria 4157
171 Ga0157379_10249449 3300014968 Bacteria 1611
172 Ga0157376_10031034 3300014969 Bacteria 4274
173 Ga0157376_10101527 3300014969 Bacteria 2514
174 Ga0163161_10002504 3300017792 Bacteria 13102
175 Ga0206354_11526961 3300020081 Bacteria 1586
176 Ga0206353_11875344 3300020082 Bacteria 1697
177 Ga0206353_11969812 3300020082 Bacteria 4447
178 Ga0209051_1000495 3300025303 Bacteria 50813
179 Ga0209051_1001467 3300025303 Bacteria 19944
180 Ga0209051_1001554 3300025303 Bacteria 19000
181 Ga0209051_1008688 3300025303 Bacteria 5347
182 Ga0207682_10017608 3300025893 Bacteria 2790
183 Ga0207692_10001091 3300025898 Bacteria 9943
184 Ga0207692_10032688 3300025898 Bacteria 2502
185 Ga0207642_10003133 3300025899 Bacteria 5184
186 Ga0207710_10000050 3300025900 Bacteria 186453
187 Ga0207688_10005531 3300025901 Bacteria 6869
188 Ga0207688_10010094 3300025901 Bacteria 5136
189 Ga0207699_10018564 3300025906 Bacteria 3688
190 Ga0207705_10030438 3300025909 Bacteria 3852
191 Ga0207684_10064525 3300025910 Bacteria 3109
192 Ga0207707_10046885 3300025912 Bacteria 3764
193 Ga0207671_10012854 3300025914 Bacteria 6704
194 Ga0207671_10043331 3300025914 Bacteria 3328
195 Ga0207671_10168433 3300025914 Bacteria 1700
196 Ga0207693_10003456 3300025915 Bacteria 13479
197 Ga0207693_10014615 3300025915 Bacteria 6308
198 Ga0207693_10024643 3300025915 Bacteria 4772
199 Ga0207693_10027449 3300025915 Bacteria 4501
200 Ga0207693_10193967 3300025915 Bacteria 1598
201 Ga0207663_10000761 3300025916 Bacteria 14390
202 Ga0207663_10013317 3300025916 Bacteria 4467
203 Ga0207663_10016808 3300025916 Bacteria 4068
204 Ga0207663_10118435 3300025916 Bacteria 1809
205 Ga0207660_10093611 3300025917 Bacteria 2233
206 Ga0207657_10002421 3300025919 Bacteria 20160
207 Ga0207657_10055281 3300025919 Bacteria 3429
208 Ga0207652_10261733 3300025921 Bacteria 1560
209 Ga0207652_10366109 3300025921 Bacteria 1301
210 Ga0207646_10049354 3300025922 Bacteria 3770
211 Ga0207681_10001659 3300025923 Bacteria 14337
212 Ga0207694_10014379 3300025924 Bacteria 5965
213 Ga0207650_10130503 3300025925 Bacteria 1966
214 Ga0207650_10169011 3300025925 Bacteria 1737
215 Ga0207687_10000726 3300025927 Bacteria 22378
216 Ga0207687_10001829 3300025927 Bacteria 14637
217 Ga0207700_10102007 3300025928 Bacteria 2291
218 Ga0207664_10055183 3300025929 Bacteria 3152
219 Ga0207664_10097085 3300025929 Bacteria 2427
220 Ga0207664_10097881 3300025929 Bacteria 2418
221 Ga0207690_10071095 3300025932 Bacteria 2399
222 Ga0207706_10041828 3300025933 Bacteria 4062
223 Ga0207709_10082553 3300025935 Bacteria 2075
224 Ga0207670_10004534 3300025936 Bacteria 7495
225 Ga0207669_10017210 3300025937 Bacteria 3700
226 Ga0207704_10004079 3300025938 Bacteria 6655
227 Ga0207704_10025941 3300025938 Bacteria 3207
228 Ga0207665_10001419 3300025939 Bacteria 16123
229 Ga0207665_10119492 3300025939 Bacteria 1860
230 Ga0207665_10138818 3300025939 Bacteria 1731
231 Ga0207691_10216182 3300025940 Bacteria 1663
232 Ga0207711_10000082 3300025941 Bacteria 102386
233 Ga0207711_10022395 3300025941 Bacteria 5283
234 Ga0207689_10018387 3300025942 Bacteria 5897
235 Ga0207689_10056908 3300025942 Bacteria 3217
236 Ga0207689_10064979 3300025942 Bacteria 3001
237 Ga0207661_10076656 3300025944 Bacteria 2746
238 Ga0207661_10166480 3300025944 Bacteria 1916
239 Ga0207667_10069725 3300025949 Bacteria 3659
240 Ga0207651_10125754 3300025960 Bacteria 1953
241 Ga0207712_10000084 3300025961 Bacteria 107789
242 Ga0207712_10007914 3300025961 Bacteria 6714
243 Ga0207668_10000421 3300025972 Bacteria 26802
244 Ga0207668_10000840 3300025972 Bacteria 18553
245 Ga0207640_10077763 3300025981 Bacteria 2256
246 Ga0207658_10001072 3300025986 Bacteria 22180
247 Ga0207658_10007543 3300025986 Bacteria 7410
248 Ga0207677_10002377 3300026023 Bacteria 9850
249 Ga0207677_10010073 3300026023 Bacteria 5335
250 Ga0207677_10012527 3300026023 Bacteria 4879
251 Ga0207703_10049505 3300026035 Bacteria 3397
252 Ga0207703_10253810 3300026035 Bacteria 1586
253 Ga0207639_10047380 3300026041 Bacteria 3248
254 Ga0207678_10009411 3300026067 Bacteria 8598
255 Ga0207708_10000765 3300026075 Bacteria 24175
256 Ga0207708_10012465 3300026075 Bacteria 6336
257 Ga0207708_10016809 3300026075 Bacteria 5509
258 Ga0207708_10020303 3300026075 Bacteria 5011
259 Ga0207708_10024297 3300026075 Bacteria 4583
260 Ga0207702_10001802 3300026078 Bacteria 21101
261 Ga0207702_10047601 3300026078 Bacteria 3614
262 Ga0207641_10001941 3300026088 Bacteria 19856
263 Ga0207648_10017636 3300026089 Bacteria 6484
264 Ga0207648_10079925 3300026089 Bacteria 2852
265 Ga0207648_10138485 3300026089 Bacteria 2145
266 Ga0207676_10217823 3300026095 Bacteria 1698
267 Ga0207674_10006140 3300026116 Bacteria 14191
268 Ga0207674_10133232 3300026116 Bacteria 2448
269 Ga0207675_100001697 3300026118 Bacteria 22065
270 Ga0207683_10001526 3300026121 Bacteria 20849
271 Ga0207683_10180371 3300026121 Bacteria 1915
272 Ga0207698_10043479 3300026142 Bacteria 3366
273 Ga0207698_10166572 3300026142 Bacteria 1935
274 Ga0268266_10014782 3300028379 Bacteria 6705
275 Ga0268266_10041322 3300028379 Bacteria 3934
276 Ga0268266_10056039 3300028379 Bacteria 3390
277 Ga0268266_10212911 3300028379 Bacteria 1773
278 Ga0268265_10000106 3300028380 Bacteria 104924
279 Ga0268265_10113610 3300028380 Bacteria 2216
280 Ga0268264_10000219 3300028381 Bacteria 111751
281 Ga0268264_10004757 3300028381 Bacteria 11524
282 Ga0268264_10136960 3300028381 Bacteria 2178
283 Ga0265327_10001226 3300031251 Bacteria 34419
284 Ga0373926_0018957 3300035083 Bacteria 2371
285 Ga0373934_0039066 3300035086 Unclassified 1870
286 Ga0373934_0067950 3300035086 Bacteria 1424
287 Ga0373952_0017319 3300035092 Bacteria 1477
288 Ga0373923_0009343 3300035111 Bacteria 3536
289 Ga0373945_0002272 3300035116 Bacteria 6015
290 Ga0373943_0004009 3300035170 Bacteria 6699
291 Ga0373935_0005516 3300035692 Bacteria 7450
292 Ga0373947_0025944 3300035725 Bacteria 3419
293 Ga0373937_0031969 3300036401 Bacteria 4771
294 Ga0373937_0355070 3300036401 Bacteria 1389
295 Ga0316584_0012761 3300036712 Bacteria 5931
296 Ga0373925_0003339 3300037068 Bacteria 12461
297 Ga0373925_0081468 3300037068 Bacteria 2461
298 Ga0395900_0133255 3300037418 Bacteria 2546
299 Ga0395901_0021486 3300038443 Bacteria 6614
300 Ga0439465_0005830 3300041413 Bacteria 3922
301 Ga0439465_0030832 3300041413 Bacteria 1707
302 Ga0451789_0711422 3300041443 Bacteria 2641
303 Ga0439459_0005367 3300042438 Bacteria 2103
304 Ga0466969_0008103 3300044656 Bacteria 5577
305 Ga0466965_0001956 3300044683 Bacteria 8612
306 Ga0466965_0016591 3300044683 Bacteria 3508
307 Ga0466965_0019702 3300044683 Bacteria 3239
308 Ga0466966_0017754 3300044684 Bacteria 4697
309 Ga0466961_0008068 3300044693 Bacteria 6711
310 Ga0466963_0010539 3300044694 Bacteria 5599
311 Ga0466963_0032373 3300044694 Bacteria 3385
312 Ga0466971_0013997 3300044719 Bacteria 3525
313 Ga0466957_0002297 3300044842 Bacteria 10244
314 Ga0466957_0066073 3300044842 Bacteria 2229
315 Ga0466960_0000287 3300044901 Bacteria 17583
316 Ga0466960_0001045 3300044901 Bacteria 9916
317 Ga0466960_0001214 3300044901 Bacteria 9289
318 Ga0466959_0000918 3300045049 Bacteria 17449
319 Ga0466959_0005192 3300045049 Bacteria 8881
320 Ga0466959_0024195 3300045049 Bacteria 4498
321 Ga0466958_0017984 3300045836 Bacteria 4097
322 Ga0466958_0039309 3300045836 Bacteria 2842
323 Ga0466967_0021836 3300045976 Bacteria 5208
324 Ga0466967_0045783 3300045976 Bacteria 3803
325 Ga0466967_0048745 3300045976 Bacteria 3701
326 Ga0466967_0072494 3300045976 Bacteria 3087
327 Ga0466967_0085719 3300045976 Bacteria 2852
328 Ga0466967_0199185 3300045976 Bacteria 1896
329 Ga0466967_0221560 3300045976 Bacteria 1798
330 Ga0466967_0264629 3300045976 Bacteria 1646
331 Ga0495629_0082234 3300046459 Bacteria 2248
332 Ga0495638_0000781 3300046460 Bacteria 33599
333 Ga0495638_0001699 3300046460 Bacteria 19377
334 Ga0495641_0005697 3300046461 Bacteria 8293
335 Ga0495641_0015085 3300046461 Bacteria 4149
336 Ga0495651_0006526 3300046462 Bacteria 8910
337 Ga0495653_0000785 3300046463 Bacteria 24390
338 Ga0495580_0006167 3300046472 Bacteria 9798
339 Ga0495580_0023425 3300046472 Bacteria 4534
340 Ga0495582_0009780 3300046473 Bacteria 5282
341 Ga0495639_0000471 3300046475 Bacteria 19185
342 Ga0495662_0006365 3300046476 Bacteria 5901
343 Ga0495662_0015683 3300046476 Bacteria 3677
344 Ga0495664_0007841 3300046477 Bacteria 5943
345 Ga0495594_0013673 3300046499 Bacteria 4241
346 Ga0495594_0078867 3300046499 Bacteria 1838
347 Ga0495606_0086900 3300046507 Bacteria 1931
348 Ga0495608_0004770 3300046511 Bacteria 9696
349 Ga0495628_0007181 3300046516 Bacteria 9647
350 Ga0495666_0011565 3300046526 Bacteria 4400
351 Ga0495652_0003240 3300046529 Bacteria 16218
352 Ga0495665_0002795 3300046531 Bacteria 9420
353 Ga0495665_0005014 3300046531 Bacteria 7137
354 Ga0495640_0011380 3300046533 Bacteria 6846
355 Ga0495640_0027191 3300046533 Bacteria 4128
356 Ga0495586_0009266 3300046535 Bacteria 5235
357 Ga0495645_0010658 3300046543 Bacteria 6452
358 Ga0495667_0022206 3300046559 Bacteria 4276
359 Ga0495634_0014655 3300046642 Bacteria 5644
360 Ga0495635_0020259 3300046663 Bacteria 4633
361 Ga0495588_0009538 3300046674 Bacteria 4491
362 Ga0495657_0003230 3300046675 Bacteria 13405
363 Ga0495647_0008530 3300046681 Bacteria 3447
364 Ga0495613_0006986 3300046689 Bacteria 8413
365 Ga0495613_0018945 3300046689 Bacteria 5127
366 Ga0495600_0001129 3300046809 Bacteria 14572
367 Ga0495581_0005160 3300047315 Bacteria 7556
368 Ga0495581_0034700 3300047315 Bacteria 2918
369 Ga0495604_0002382 3300047317 Bacteria 15068
370 Ga0495604_0009577 3300047317 Bacteria 7661
371 Ga0495604_0103192 3300047317 Bacteria 2092
372 Ga0495674_0010872 3300047319 Bacteria 8606
373 Ga0495674_0019611 3300047319 Bacteria 6274
374 Ga0495672_0019173 3300047320 Bacteria 4520
375 Ga0495676_0022067 3300047321 Bacteria 5548
376 Ga0495676_0086048 3300047321 Bacteria 2367
377 Ga0495676_0158838 3300047321 Bacteria 1601
378 Ga0495680_0007912 3300047322 Bacteria 9696
379 Ga0495675_0006496 3300047444 Bacteria 7157
380 Ga0495675_0048531 3300047444 Bacteria 2700
381 Ga0495673_0002889 3300047469 Bacteria 11664
382 Ga0495684_0009902 3300047471 Bacteria 7358
383 Ga0495684_0034579 3300047471 Bacteria 3877
384 Ga0495684_0074924 3300047471 Bacteria 2571
385 Ga0495686_0000639 3300047472 Bacteria 48277
386 Ga0495593_0007190 3300047673 Bacteria 6527
387 Ga0495614_0000935 3300048089 Bacteria 12427
388 Ga0496100_0000524 3300048903 Bacteria 18300
389 Ga0496100_0000592 3300048903 Bacteria 17134
390 Ga0496100_0003747 3300048903 Bacteria 7959
391 Ga0496101_0000021 3300048904 Bacteria 217090
392 Ga0496101_0000190 3300048904 Bacteria 48412
393 Ga0496101_0001290 3300048904 Bacteria 14969
394 Ga0496101_0007690 3300048904 Bacteria 7002
395 Ga0496101_0007993 3300048904 Bacteria 6893
396 Ga0496101_0010795 3300048904 Bacteria 6043
397 Ga0496101_0015644 3300048904 Bacteria 5118
398 Ga0496101_0087810 3300048904 Bacteria 2309
399 Ga0496101_0184820 3300048904 Bacteria 1606
400 Ga0496102_0000001 3300048905 Bacteria 873433
401 Ga0496102_0000206 3300048905 Bacteria 79436
402 Ga0496102_0014629 3300048905 Bacteria 6821
403 Ga0496102_0018915 3300048905 Bacteria 6060
404 Ga0496102_0019906 3300048905 Bacteria 5918
405 Ga0496102_0057125 3300048905 Bacteria 3562
406 Ga0496102_0312722 3300048905 Bacteria 1480
407 Ga0496102_0397266 3300048905 Bacteria 1296
408 Ga0496103_0000007 3300048906 Bacteria 354915
409 Ga0496103_0000486 3300048906 Bacteria 33008
410 Ga0496103_0002584 3300048906 Bacteria 11340
411 Ga0496103_0005039 3300048906 Bacteria 7967
412 Ga0496103_0007156 3300048906 Bacteria 6654
413 Ga0496104_0089372 3300048907 Bacteria 2943
414 Ga0496105_0014012 3300048908 Bacteria 6378
415 Ga0496105_0071777 3300048908 Bacteria 2861
416 Ga0496105_0182152 3300048908 Bacteria 1720
417 Ga0496106_0000189 3300048909 Bacteria 43320
418 Ga0496106_0002591 3300048909 Bacteria 13460
419 Ga0496106_0005962 3300048909 Bacteria 9001
420 Ga0496106_0013249 3300048909 Bacteria 6087
421 Ga0496106_0024821 3300048909 Bacteria 4457
422 Ga0496106_0136652 3300048909 Bacteria 1926
423 Ga0496106_0208027 3300048909 Bacteria 1558
424 Ga0496107_0002382 3300048910 Bacteria 12162
425 Ga0496107_0009820 3300048910 Bacteria 6638
426 Ga0496107_0033947 3300048910 Bacteria 3652
427 Ga0496107_0035780 3300048910 Bacteria 3560
428 Ga0496107_0057149 3300048910 Bacteria 2820
429 Ga0496107_0088538 3300048910 Bacteria 2260
430 Ga0496107_0121340 3300048910 Bacteria 1926
431 Ga0496107_0177564 3300048910 Bacteria 1581
432 Ga0496108_0000471 3300048911 Bacteria 32268
433 Ga0496108_0002910 3300048911 Bacteria 13757
434 Ga0496108_0010593 3300048911 Bacteria 7481
435 Ga0496108_0100268 3300048911 Bacteria 2470
436 Ga0496109_0000042 3300048912 Bacteria 138654
437 Ga0496109_0004653 3300048912 Bacteria 11457
438 Ga0496109_0007073 3300048912 Bacteria 9469
439 Ga0496109_0008543 3300048912 Bacteria 8709
440 Ga0496109_0012956 3300048912 Bacteria 7209
441 Ga0496109_0042518 3300048912 Bacteria 4116
442 Ga0496109_0170680 3300048912 Bacteria 2040
443 Ga0496109_0210184 3300048912 Bacteria 1830
444 Ga0496110_0000285 3300048913 Bacteria 33083
445 Ga0496110_0032884 3300048913 Bacteria 4483
446 Ga0496110_0097968 3300048913 Bacteria 2627
447 Ga0496110_0230121 3300048913 Bacteria 1686
448 Ga0496111_0000283 3300048914 Bacteria 24566
449 Ga0496111_0006973 3300048914 Bacteria 7377
450 Ga0496111_0010737 3300048914 Bacteria 6159
451 Ga0496111_0091128 3300048914 Bacteria 2234
452 Ga0496112_0000903 3300048915 Bacteria 21392
453 Ga0496112_0046158 3300048915 Bacteria 4272
454 Ga0496112_0234847 3300048915 Bacteria 1787
455 Ga0496112_0272753 3300048915 Bacteria 1640
456 Ga0496112_0308895 3300048915 Bacteria 1526
457 Ga0496113_0006996 3300048916 Bacteria 7213
458 Ga0496113_0051480 3300048916 Bacteria 3073
459 Ga0496114_0001710 3300048917 Bacteria 16655
460 Ga0496114_0021117 3300048917 Bacteria 5294
461 Ga0496114_0027406 3300048917 Bacteria 4666
462 Ga0496114_0036555 3300048917 Bacteria 4059
463 Ga0496114_0078230 3300048917 Bacteria 2790
464 Ga0496114_0112099 3300048917 Bacteria 2338
465 Ga0496115_0002842 3300048918 Bacteria 12458
466 Ga0496115_0005443 3300048918 Bacteria 9261
467 Ga0496115_0009295 3300048918 Bacteria 7305
468 Ga0496115_0013474 3300048918 Bacteria 6186
469 Ga0496115_0036043 3300048918 Bacteria 3915
470 Ga0496116_0000018 3300048919 Bacteria 545877
471 Ga0496116_0014527 3300048919 Bacteria 6281
472 Ga0496116_0037261 3300048919 Bacteria 3393
473 Ga0496117_0000015 3300048920 Bacteria 583316
474 Ga0496117_0000687 3300048920 Bacteria 54044
475 Ga0496117_0026291 3300048920 Bacteria 4556
476 Ga0496118_0000012 3300048921 Bacteria 583316
477 Ga0496118_0000962 3300048921 Bacteria 44975
478 Ga0496118_0082466 3300048921 Bacteria 2252
479 Ga0496119_0001610 3300048922 Bacteria 26733
480 Ga0496119_0035616 3300048922 Bacteria 3259
481 Ga0496119_0067199 3300048922 Bacteria 2115
482 Ga0496120_0000195 3300048923 Bacteria 104031
483 Ga0496120_0076757 3300048923 Bacteria 1820
484 Ga0496121_0000002 3300048924 Bacteria 1494588
485 Ga0496121_0000809 3300048924 Bacteria 56983
486 Ga0496122_0000048 3300048925 Bacteria 269532
487 Ga0496123_0010717 3300048926 Bacteria 8056
488 Ga0496124_0000002 3300048927 Bacteria 1494588
489 Ga0496125_0000002 3300048928 Bacteria 1480920
490 Ga0496125_0015477 3300048928 Bacteria 7373
491 Ga0496126_0000009 3300048929 Bacteria 750350
492 Ga0496126_0000906 3300048929 Bacteria 51430
493 Ga0496126_0003932 3300048929 Bacteria 18197
494 Ga0496126_0100615 3300048929 Bacteria 2529
495 Ga0501032_0028055 3300049569 Bacteria 3868
496 Ga0501034_0125711 3300049571 Bacteria 2550
497 Ga0501034_0150622 3300049571 Bacteria 2302
498 Ga0501036_0124218 3300049572 Bacteria 2179
499 Ga0501038_0062257 3300049574 Bacteria 3188
500 Ga0501038_0104092 3300049574 Bacteria 2359
501 Ga0501039_0137024 3300049575 Bacteria 1922
502 Ga0501043_0016560 3300049579 Bacteria 5779
503 Ga0501043_0028513 3300049579 Bacteria 4383
504 Ga0501067_0000236 3300049583 Bacteria 30606
505 Ga0501067_0006741 3300049583 Bacteria 6369
506 Ga0501067_0115773 3300049583 Bacteria 1491
507 Ga0501068_0000202 3300049584 Bacteria 28454
508 Ga0501069_0000102 3300049585 Bacteria 39947
509 Ga0501070_0040914 3300049586 Bacteria 3862
510 Ga0501070_0152083 3300049586 Bacteria 1909
511 Ga0501035_0024534 3300049822 Bacteria 5529
512 Ga0501044_0009394 3300049823 Bacteria 10653
513 nmdc:mga03683_66958_c1 3300050489 Bacteria 1528
514 nmdc:mga00v17_1826_c1 3300050491 Bacteria 11016
515 nmdc:mga0yw44_19399_c1 3300050492 Bacteria 3749
516 nmdc:mga05p37_307774_c1 3300050507 Bacteria 1879
517 nmdc:mga08y16_53947_c1 3300050511 Bacteria 4201
518 nmdc:mga0n895_1489_c1 3300050512 Bacteria 17566
519 nmdc:mga0n895_27063_c1 3300050512 Bacteria 5443
520 nmdc:mga0rr50_17335_c1 3300050513 Bacteria 4806
521 nmdc:mga08x19_15907_c1 3300050514 Bacteria 4583
522 nmdc:mga08x19_65498_c1 3300050514 Bacteria 2360
523 nmdc:mga0a205_259848_c1 3300050515 Bacteria 1614
524 Ga0495601_0082473 3300053077 Bacteria 2064
525 Ga0495601_0137264 3300053077 Bacteria 1594
526 Ga0495612_0021729 3300053078 Bacteria 2574
527 Ga0495612_0047049 3300053078 Bacteria 1767
528 Ga0500635_0001010 3300053080 Bacteria 6736
529 Ga0495595_0002422 3300053084 Bacteria 7289
530 Ga0495619_0045868 3300053085 Bacteria 2872
531 Ga0495619_0073580 3300053085 Bacteria 2290
532 Ga0500643_019369 3300053087 Bacteria 2241
533 Ga0500556_0003190 3300053104 Bacteria 4885
534 Ga0500562_004436 3300053108 Bacteria 3552
535 Ga0500652_003253 3300053131 Bacteria 4914
536 Ga0500559_0031059 3300053136 Bacteria 2291
537 Ga0500616_0010073 3300053153 Bacteria 5678
538 Ga0500616_0018705 3300053153 Bacteria 3915
539 Ga0500620_017643 3300053155 Bacteria 2065
540 Ga0466962_0001898 3300061719 Bacteria 9842
541 Ga0466962_0090405 3300061719 Bacteria 1467
542 Ga0530510_0014675 3300061734 Bacteria 5531
543 8055176810 8055172936 Bacteria 9305943
544 2644014270 2643221601 Bacteria 7493239
545 2644175707 2643221631 Bacteria 8168043
546 2644487760 2643221687 Bacteria 6500351
547 2644489908 2643221687 Bacteria 6500351
548 2739205805 2738543005 Bacteria 5278128
549 2739364279 2738543034 Bacteria 6084756
550 2768647465 2767802112 Bacteria 6465194
551 2819742465 2818991472 Bacteria 10089953
552 2862710077 2862705112 Bacteria 6563286
553 2873319107 2873314349 Bacteria 8512634
554 2902795034 2902792274 Bacteria 7270173
555 2902840861 2902837492 Bacteria 6697721
556 2902841533 2902837492 Bacteria 6697721
557 2990047208 2990044586 Bacteria 6603797
558 2995467739 2995463766 Bacteria 8577691
559 8008488330 8008485437 Bacteria 7198341
560 8025530211 8025524527 Bacteria 7197316
561 8055066946 8055066027 Bacteria 9479577
562 8056066195 8056060235 Bacteria 7259403
563 8056450774 8056447290 Bacteria 7680491
564 JGI24745J21846_1002969
565 JGI24744J21845_10000359
566 Ga0055540_1001451
567 Ga0055540_1001925
568 Ga0055540_1002814
569 Ga0055540_1005837
570 Ga0070658_10011995
571 Ga0070676_10155550
572 Ga0070683_100000236
573 Ga0070683_100098861
574 Ga0070690_100014568
575 Ga0070670_100083928
576 Ga0070670_100202029
577 Ga0070677_10010713
578 Ga0068869_100016126
579 Ga0068869_100092837
580 Ga0068869_100232676
581 Ga0070666_10144702
582 Ga0070680_100196961
583 Ga0070682_100003664
584 Ga0068868_100003669
585 Ga0068868_100085264
586 Ga0070660_100006166
587 Ga0070689_100004896
588 Ga0070689_100111606
589 Ga0070691_10008852
590 Ga0070668_100004934
591 Ga0070669_100000385
592 Ga0070673_100149593
593 Ga0070688_100022601
594 Ga0070659_100058769
595 Ga0070667_100000308
596 Ga0070667_100001250
597 Ga0070667_100111677
598 Ga0070709_10028936
599 Ga0070714_100003617
600 Ga0070714_100013156
601 Ga0070714_100019404
602 Ga0070713_100032310
603 Ga0070710_10004789
604 Ga0070710_10110009
605 Ga0070701_10127920
606 Ga0070711_100001940
607 Ga0070711_100003880
608 Ga0070711_100048198
609 Ga0070711_100096339
610 Ga0070705_100033998
611 Ga0070700_100015736
612 Ga0070694_100006522
613 Ga0070663_100013063
614 Ga0070678_100000765
615 Ga0070678_100137944
616 Ga0070662_100023726
617 Ga0070681_10060573
618 Ga0068867_100002126
619 Ga0068867_100108546
620 Ga0070706_100008823
621 Ga0070706_100021243
622 Ga0070707_100028389
623 Ga0070707_100034988
624 Ga0070707_100035376
625 Ga0070679_100135382
626 Ga0070684_100001605
627 Ga0070684_100005379
628 Ga0070684_100087749
629 Ga0070684_100204279
630 Ga0068853_100004948
631 Ga0070686_100037837
632 Ga0070695_100006710
633 Ga0070696_100002116
634 Ga0070693_100018445
635 Ga0070665_100001277
636 Ga0070665_100008854
637 Ga0070665_100026011
638 Ga0070665_100413332
639 Ga0068855_100008166
640 Ga0068855_100115438
641 Ga0070664_100005547
642 Ga0070664_100069197
643 Ga0068857_100155317
644 Ga0068854_100000953
645 Ga0068854_100073353
646 Ga0068854_100075704
647 Ga0068856_100003239
648 Ga0068856_100031825
649 Ga0068856_100102098
650 Ga0068856_100134354
651 Ga0068852_100010135
652 Ga0068852_100035072
653 Ga0068852_100082928
654 Ga0068859_100002421
655 Ga0068859_100006002
656 Ga0068859_100301520
657 Ga0068864_100271200
658 Ga0068866_10000693
659 Ga0068851_10069260
660 Ga0068863_100000875
661 Ga0068858_100000702
662 Ga0068858_100072406
663 Ga0068858_100144866
664 Ga0068860_100000155
665 Ga0068860_100045119
666 Ga0068862_100000096
667 Ga0068862_100131570
668 Ga0068862_100234590
669 Ga0081455_10053197
670 Ga0070717_10009856
671 Ga0070717_10030635
672 Ga0070717_10033248
673 Ga0070717_10035447
674 Ga0070717_10162909
675 Ga0075365_10011937
676 Ga0075364_10010526
677 Ga0075364_10042181
678 Ga0070716_100015483
679 Ga0070716_100076886
680 Ga0070712_100001708
681 Ga0070712_100176990
682 Ga0070712_100200609
683 Ga0075362_10079505
684 Ga0075369_10010836
685 Ga0075369_10016484
686 Ga0075369_10056961
687 Ga0075433_10053946
688 Ga0075434_100000973
689 Ga0075434_100003144
690 Ga0068865_100141249
691 Ga0075436_100020072
692 Ga0075436_100025530
693 Ga0097620_100002421
694 Ga0097620_100006002
695 Ga0097620_100301517
696 Ga0075435_100000686
697 Ga0075435_100136860
698 Ga0099795_10013891
699 Ga0105250_10047964
700 Ga0111539_10173703
701 Ga0105245_10085258
702 Ga0105245_10092752
703 Ga0105247_10000040
704 Ga0105247_10002640
705 Ga0105247_10028341
706 Ga0105243_10090895
707 Ga0105243_10118314
708 Ga0105242_10002280
709 Ga0105248_10000095
710 Ga0105248_10040302
711 Ga0105248_10379762
712 Ga0105237_10017270
713 Ga0105237_10018942
714 Ga0105238_10009327
715 Ga0105249_10000069
716 Ga0105249_10116750
717 Ga0099796_10023761
718 Ga0105239_10018075
719 Ga0105239_10169490
720 Ga0105246_10079396
721 Ga0157370_10266577
722 Ga0157369_10355419
723 Ga0157374_10016149
724 Ga0157374_10018883
725 Ga0157374_10122562
726 Ga0157378_10426590
727 Ga0157372_10610012
728 Ga0157375_10355370
729 Ga0163163_10002322
730 Ga0163163_10015708
731 Ga0157380_10061072
732 Ga0157380_10314017
733 Ga0157379_10040522
734 Ga0157379_10249449
735 Ga0157376_10031034
736 Ga0157376_10101527
737 Ga0163161_10002504
738 Ga0206354_11526961
739 Ga0206353_11875344
740 Ga0206353_11969812
741 Ga0209051_1000495
742 Ga0209051_1001467
743 Ga0209051_1001554
744 Ga0209051_1008688
745 Ga0207682_10017608
746 Ga0207692_10001091
747 Ga0207692_10032688
748 Ga0207642_10003133
749 Ga0207710_10000050
750 Ga0207688_10005531
751 Ga0207688_10010094
752 Ga0207699_10018564
753 Ga0207705_10030438
754 Ga0207684_10064525
755 Ga0207707_10046885
756 Ga0207671_10012854
757 Ga0207671_10043331
758 Ga0207671_10168433
759 Ga0207693_10003456
760 Ga0207693_10014615
761 Ga0207693_10024643
762 Ga0207693_10027449
763 Ga0207693_10193967
764 Ga0207663_10000761
765 Ga0207663_10013317
766 Ga0207663_10016808
767 Ga0207663_10118435
768 Ga0207660_10093611
769 Ga0207657_10002421
770 Ga0207657_10055281
771 Ga0207652_10261733
772 Ga0207652_10366109
773 Ga0207646_10049354
774 Ga0207681_10001659
775 Ga0207694_10014379
776 Ga0207650_10130503
777 Ga0207650_10169011
778 Ga0207687_10000726
779 Ga0207687_10001829
780 Ga0207700_10102007
781 Ga0207664_10055183
782 Ga0207664_10097085
783 Ga0207664_10097881
784 Ga0207690_10071095
785 Ga0207706_10041828
786 Ga0207709_10082553
787 Ga0207670_10004534
788 Ga0207669_10017210
789 Ga0207704_10004079
790 Ga0207704_10025941
791 Ga0207665_10001419
792 Ga0207665_10119492
793 Ga0207665_10138818
794 Ga0207691_10216182
795 Ga0207711_10000082
796 Ga0207711_10022395
797 Ga0207689_10018387
798 Ga0207689_10056908
799 Ga0207689_10064979
800 Ga0207661_10076656
801 Ga0207661_10166480
802 Ga0207667_10069725
803 Ga0207651_10125754
804 Ga0207712_10000084
805 Ga0207712_10007914
806 Ga0207668_10000421
807 Ga0207668_10000840
808 Ga0207640_10077763
809 Ga0207658_10001072
810 Ga0207658_10007543
811 Ga0207677_10002377
812 Ga0207677_10010073
813 Ga0207677_10012527
814 Ga0207703_10049505
815 Ga0207703_10253810
816 Ga0207639_10047380
817 Ga0207678_10009411
818 Ga0207708_10000765
819 Ga0207708_10012465
820 Ga0207708_10016809
821 Ga0207708_10020303
822 Ga0207708_10024297
823 Ga0207702_10001802
824 Ga0207702_10047601
825 Ga0207641_10001941
826 Ga0207648_10017636
827 Ga0207648_10079925
828 Ga0207648_10138485
829 Ga0207676_10217823
830 Ga0207674_10006140
831 Ga0207674_10133232
832 Ga0207675_100001697
833 Ga0207683_10001526
834 Ga0207683_10180371
835 Ga0207698_10043479
836 Ga0207698_10166572
837 Ga0268266_10014782
838 Ga0268266_10041322
839 Ga0268266_10056039
840 Ga0268266_10212911
841 Ga0268265_10000106
842 Ga0268265_10113610
843 Ga0268264_10000219
844 Ga0268264_10004757
845 Ga0268264_10136960
846 Ga0265327_10001226
847 Ga0373926_0018957
848 Ga0373934_0039066
849 Ga0373934_0067950
850 Ga0373952_0017319
851 Ga0373923_0009343
852 Ga0373945_0002272
853 Ga0373943_0004009
854 Ga0373935_0005516
855 Ga0373947_0025944
856 Ga0373937_0031969
857 Ga0373937_0355070
858 Ga0316584_0012761
859 Ga0373925_0003339
860 Ga0373925_0081468
861 Ga0395900_0133255
862 Ga0395901_0021486
863 Ga0439465_0005830
864 Ga0439465_0030832
865 Ga0451789_0711422
866 Ga0439459_0005367
867 Ga0466969_0008103
868 Ga0466965_0001956
869 Ga0466965_0016591
870 Ga0466965_0019702
871 Ga0466966_0017754
872 Ga0466961_0008068
873 Ga0466963_0010539
874 Ga0466963_0032373
875 Ga0466971_0013997
876 Ga0466957_0002297
877 Ga0466957_0066073
878 Ga0466960_0000287
879 Ga0466960_0001045
880 Ga0466960_0001214
881 Ga0466959_0000918
882 Ga0466959_0005192
883 Ga0466959_0024195
884 Ga0466958_0017984
885 Ga0466958_0039309
886 Ga0466967_0021836
887 Ga0466967_0045783
888 Ga0466967_0048745
889 Ga0466967_0072494
890 Ga0466967_0085719
891 Ga0466967_0199185
892 Ga0466967_0221560
893 Ga0466967_0264629
894 Ga0495629_0082234
895 Ga0495638_0000781
896 Ga0495638_0001699
897 Ga0495641_0005697
898 Ga0495641_0015085
899 Ga0495651_0006526
900 Ga0495653_0000785
901 Ga0495580_0006167
902 Ga0495580_0023425
903 Ga0495582_0009780
904 Ga0495639_0000471
905 Ga0495662_0006365
906 Ga0495662_0015683
907 Ga0495664_0007841
908 Ga0495594_0013673
909 Ga0495594_0078867
910 Ga0495606_0086900
911 Ga0495608_0004770
912 Ga0495628_0007181
913 Ga0495666_0011565
914 Ga0495652_0003240
915 Ga0495665_0002795
916 Ga0495665_0005014
917 Ga0495640_0011380
918 Ga0495640_0027191
919 Ga0495586_0009266
920 Ga0495645_0010658
921 Ga0495667_0022206
922 Ga0495634_0014655
923 Ga0495635_0020259
924 Ga0495588_0009538
925 Ga0495657_0003230
926 Ga0495647_0008530
927 Ga0495613_0006986
928 Ga0495613_0018945
929 Ga0495600_0001129
930 Ga0495581_0005160
931 Ga0495581_0034700
932 Ga0495604_0002382
933 Ga0495604_0009577
934 Ga0495604_0103192
935 Ga0495674_0010872
936 Ga0495674_0019611
937 Ga0495672_0019173
938 Ga0495676_0022067
939 Ga0495676_0086048
940 Ga0495676_0158838
941 Ga0495680_0007912
942 Ga0495675_0006496
943 Ga0495675_0048531
944 Ga0495673_0002889
945 Ga0495684_0009902
946 Ga0495684_0034579
947 Ga0495684_0074924
948 Ga0495686_0000639
949 Ga0495593_0007190
950 Ga0495614_0000935
951 Ga0496100_0000524
952 Ga0496100_0000592
953 Ga0496100_0003747
954 Ga0496101_0000021
955 Ga0496101_0000190
956 Ga0496101_0001290
957 Ga0496101_0007690
958 Ga0496101_0007993
959 Ga0496101_0010795
960 Ga0496101_0015644
961 Ga0496101_0087810
962 Ga0496101_0184820
963 Ga0496102_0000001
964 Ga0496102_0000206
965 Ga0496102_0014629
966 Ga0496102_0018915
967 Ga0496102_0019906
968 Ga0496102_0057125
969 Ga0496102_0312722
970 Ga0496102_0397266
971 Ga0496103_0000007
972 Ga0496103_0000486
973 Ga0496103_0002584
974 Ga0496103_0005039
975 Ga0496103_0007156
976 Ga0496104_0089372
977 Ga0496105_0014012
978 Ga0496105_0071777
979 Ga0496105_0182152
980 Ga0496106_0000189
981 Ga0496106_0002591
982 Ga0496106_0005962
983 Ga0496106_0013249
984 Ga0496106_0024821
985 Ga0496106_0136652
986 Ga0496106_0208027
987 Ga0496107_0002382
988 Ga0496107_0009820
989 Ga0496107_0033947
990 Ga0496107_0035780
991 Ga0496107_0057149
992 Ga0496107_0088538
993 Ga0496107_0121340
994 Ga0496107_0177564
995 Ga0496108_0000471
996 Ga0496108_0002910
997 Ga0496108_0010593
998 Ga0496108_0100268
999 Ga0496109_0000042
1000 Ga0496109_0004653
1001 Ga0496109_0007073
1002 Ga0496109_0008543
1003 Ga0496109_0012956
1004 Ga0496109_0042518
1005 Ga0496109_0170680
1006 Ga0496109_0210184
1007 Ga0496110_0000285
1008 Ga0496110_0032884
1009 Ga0496110_0097968
1010 Ga0496110_0230121
1011 Ga0496111_0000283
1012 Ga0496111_0006973
1013 Ga0496111_0010737
1014 Ga0496111_0091128
1015 Ga0496112_0000903
1016 Ga0496112_0046158
1017 Ga0496112_0234847
1018 Ga0496112_0272753
1019 Ga0496112_0308895
1020 Ga0496113_0006996
1021 Ga0496113_0051480
1022 Ga0496114_0001710
1023 Ga0496114_0021117
1024 Ga0496114_0027406
1025 Ga0496114_0036555
1026 Ga0496114_0078230
1027 Ga0496114_0112099
1028 Ga0496115_0002842
1029 Ga0496115_0005443
1030 Ga0496115_0009295
1031 Ga0496115_0013474
1032 Ga0496115_0036043
1033 Ga0496116_0000018
1034 Ga0496116_0014527
1035 Ga0496116_0037261
1036 Ga0496117_0000015
1037 Ga0496117_0000687
1038 Ga0496117_0026291
1039 Ga0496118_0000012
1040 Ga0496118_0000962
1041 Ga0496118_0082466
1042 Ga0496119_0001610
1043 Ga0496119_0035616
1044 Ga0496119_0067199
1045 Ga0496120_0000195
1046 Ga0496120_0076757
1047 Ga0496121_0000002
1048 Ga0496121_0000809
1049 Ga0496122_0000048
1050 Ga0496123_0010717
1051 Ga0496124_0000002
1052 Ga0496125_0000002
1053 Ga0496125_0015477
1054 Ga0496126_0000009
1055 Ga0496126_0000906
1056 Ga0496126_0003932
1057 Ga0496126_0100615
1058 Ga0501032_0028055
1059 Ga0501034_0125711
1060 Ga0501034_0150622
1061 Ga0501036_0124218
1062 Ga0501038_0062257
1063 Ga0501038_0104092
1064 Ga0501039_0137024
1065 Ga0501043_0016560
1066 Ga0501043_0028513
1067 Ga0501067_0000236
1068 Ga0501067_0006741
1069 Ga0501067_0115773
1070 Ga0501068_0000202
1071 Ga0501069_0000102
1072 Ga0501070_0040914
1073 Ga0501070_0152083
1074 Ga0501035_0024534
1075 Ga0501044_0009394
1076 nmdc:mga03683_66958_c1
1077 nmdc:mga00v17_1826_c1
1078 nmdc:mga0yw44_19399_c1
1079 nmdc:mga05p37_307774_c1
1080 nmdc:mga08y16_53947_c1
1081 nmdc:mga0n895_1489_c1
1082 nmdc:mga0n895_27063_c1
1083 nmdc:mga0rr50_17335_c1
1084 nmdc:mga08x19_15907_c1
1085 nmdc:mga08x19_65498_c1
1086 nmdc:mga0a205_259848_c1
1087 Ga0495601_0082473
1088 Ga0495601_0137264
1089 Ga0495612_0021729
1090 Ga0495612_0047049
1091 Ga0500635_0001010
1092 Ga0495595_0002422
1093 Ga0495619_0045868
1094 Ga0495619_0073580
1095 Ga0500643_019369
1096 Ga0500556_0003190
1097 Ga0500562_004436
1098 Ga0500652_003253
1099 Ga0500559_0031059
1100 Ga0500616_0010073
1101 Ga0500616_0018705
1102 Ga0500620_017643
1103 Ga0466962_0001898
1104 Ga0466962_0090405
1105 Ga0530510_0014675
1106 8055176810
1107 2644014270
1108 2644175707
1109 2644487760
1110 2644489908
1111 2739205805
1112 2739364279
1113 2768647465
1114 2819742465
1115 2862710077
1116 2873319107
1117 2902795034
1118 2902840861
1119 2902841533
1120 2990047208
1121 2995467739
1122 8008488330
1123 8025530211
1124 8055066946
1125 8056066195
1126 8056450774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

117

442

0.88

PF04389

Peptidase_M28

Peptidase family M28

103

225

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pxd-assembly1.cif.gz_B the crystal structure of ecaah in complex with allantoate 0.9135 3 402
5i4m-assembly1.cif.gz_B crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis 0.9034 4 408
8aq0-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c 0.9027 4 406
8c46-assembly1.cif.gz_B n-carbamoyl-beta-alanine amidohydrolases from rhizobium radiobacter mdc 8606 0.8997 4 404
4pxe-assembly1.cif.gz_B the crystal structure of atuah in complex with glyoxylate 0.899 4 404
ID Description Score Start End Superfamily
3n5fB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9754 214 325 3.30.70.360
5tp4B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9737 214 325 3.30.70.360
af_Q655X8_256_387_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9606 214 324 3.40.630.10
af_C0P5R8_269_385_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9537 214 325 3.40.630.10
5i4mA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9537 214 322 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A2N8BRA3-F1-model_v4 Zn-dependent hydrolase 0.9707 214 285 GO:0016813
AF-A0A6D1VGB2-F1-model_v4 deleted 0.9633 8 404
AF-A0A6G6WLX7-F1-model_v4 Allantoate amidohydrolase 0.958 8 407 GO:0016813
GO:0046872
AF-A0A3G1J1A2-F1-model_v4 Zn-dependent hydrolase 0.9576 3 372 GO:0016813
GO:0046872
AF-A0A1I6IJF7-F1-model_v4 N-carbamoyl-L-amino-acid hydrolase 0.9569 1 406 GO:0016813
GO:0046872

Map