F464140

General Info

Members Datasets Scaffolds Average Seq Length
564 328 1128 80

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100007771|Ga0070714_1000077716
Length 84
Sequence MRSAKTVNIHEAKTQLSKLVDEASKGEPFVIAKAGKPMVRVTALNVPVGTDVKRLGFMTGQISVPDDFDRMGQEEIERIFSGGK

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
319 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
320 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
321 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
325 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
326 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
327 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
328 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0.35
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0.53
Rhizoplane 5.32
Rhizosphere 90.25
Stem 0
Stem Tuber 0
Unclassified 22.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100007771 3300005435 Bacteria 8353
2 rootL2_10350662 3300003322 Bacteria 1126
3 Ga0065715_10056458 3300005293 Unclassified 774
4 Ga0070658_10234784 3300005327 Bacteria 1553
5 Ga0070658_10971130 3300005327 Unclassified 739
6 Ga0070676_10640928 3300005328 Unclassified 770
7 Ga0070676_11139028 3300005328 Bacteria 591
8 Ga0070683_100141963 3300005329 Bacteria 2275
9 Ga0070690_100219484 3300005330 Unclassified 1331
10 Ga0070690_100391662 3300005330 Bacteria 1018
11 Ga0068869_100797225 3300005334 Unclassified 811
12 Ga0068869_100805956 3300005334 Bacteria 807
13 Ga0068869_101250299 3300005334 Unclassified 654
14 Ga0070666_10146771 3300005335 Bacteria 1644
15 Ga0070666_10528175 3300005335 Bacteria 857
16 Ga0070680_100176881 3300005336 Bacteria 1796
17 Ga0070682_100015247 3300005337 Bacteria 4451
18 Ga0068868_100000111 3300005338 Bacteria 50857
19 Ga0068868_100005397 3300005338 Bacteria 8983
20 Ga0068868_100169192 3300005338 Bacteria 1808
21 Ga0070660_100465654 3300005339 Unclassified 1049
22 Ga0070660_100984542 3300005339 Unclassified 712
23 Ga0070689_100055014 3300005340 Bacteria 3082
24 Ga0070689_100356332 3300005340 Bacteria 1228
25 Ga0070691_10097094 3300005341 Bacteria 1460
26 Ga0070661_100018976 3300005344 Bacteria 4897
27 Ga0070661_100037667 3300005344 Bacteria 3518
28 Ga0070692_10186012 3300005345 Bacteria 1207
29 Ga0070669_100000032 3300005353 Bacteria 153549
30 Ga0070669_100128989 3300005353 Bacteria 1938
31 Ga0070675_100572479 3300005354 Bacteria 1023
32 Ga0070675_101291837 3300005354 Unclassified 672
33 Ga0070674_100250114 3300005356 Bacteria 1392
34 Ga0070659_100169915 3300005366 Bacteria 1785
35 Ga0070667_100017886 3300005367 Bacteria 5875
36 Ga0070709_11688252 3300005434 Unclassified 517
37 Ga0070714_100004134 3300005435 Bacteria 10911
38 Ga0070714_100731308 3300005435 Bacteria 956
39 Ga0070713_100002892 3300005436 Bacteria 11231
40 Ga0070713_101830474 3300005436 Bacteria 589
41 Ga0070713_102129534 3300005436 Bacteria 544
42 Ga0070710_10569795 3300005437 Bacteria 784
43 Ga0070711_100001861 3300005439 Bacteria 11790
44 Ga0070711_100227368 3300005439 Bacteria 1453
45 Ga0070705_100822965 3300005440 Bacteria 741
46 Ga0070694_100179059 3300005444 Bacteria 1567
47 Ga0070708_100164040 3300005445 Bacteria 2072
48 Ga0070708_100238009 3300005445 Bacteria 1709
49 Ga0070663_100007514 3300005455 Bacteria 6637
50 Ga0070663_100608433 3300005455 Unclassified 920
51 Ga0070678_100299976 3300005456 Bacteria 1365
52 Ga0070662_100006127 3300005457 Bacteria 7733
53 Ga0068867_100060454 3300005459 Bacteria 2811
54 Ga0068867_100827705 3300005459 Bacteria 828
55 Ga0068867_101655839 3300005459 Unclassified 599
56 Ga0070685_10195086 3300005466 Unclassified 1313
57 Ga0070685_10805195 3300005466 Unclassified 693
58 Ga0070706_100823414 3300005467 Bacteria 859
59 Ga0070706_100935995 3300005467 Unclassified 800
60 Ga0070707_101827458 3300005468 Bacteria 575
61 Ga0070707_102158994 3300005468 Bacteria 524
62 Ga0070698_100750608 3300005471 Bacteria 919
63 Ga0070699_100613762 3300005518 Unclassified 992
64 Ga0070699_101391723 3300005518 Bacteria 643
65 Ga0070679_100296962 3300005530 Bacteria 1566
66 Ga0070679_100388907 3300005530 Unclassified 1341
67 Ga0070684_100522773 3300005535 Unclassified 1100
68 Ga0070684_100657952 3300005535 Unclassified 975
69 Ga0070697_100042052 3300005536 Bacteria 3699
70 Ga0070697_100722006 3300005536 Unclassified 880
71 Ga0070697_101532725 3300005536 Bacteria 596
72 Ga0068853_100124789 3300005539 Bacteria 2299
73 Ga0068853_102168687 3300005539 Eukaryota 539
74 Ga0070686_100039404 3300005544 Bacteria 2944
75 Ga0070686_100173479 3300005544 Bacteria 1527
76 Ga0070695_100100415 3300005545 Bacteria 1948
77 Ga0070696_100054428 3300005546 Bacteria 2788
78 Ga0070693_100281171 3300005547 Bacteria 1114
79 Ga0070693_100387940 3300005547 Bacteria 965
80 Ga0070665_100007075 3300005548 Bacteria 11400
81 Ga0070665_100138785 3300005548 Bacteria 2434
82 Ga0070704_100273599 3300005549 Unclassified 1396
83 Ga0070704_101409418 3300005549 Bacteria 639
84 Ga0068855_100093108 3300005563 Bacteria 3475
85 Ga0068855_100232520 3300005563 Bacteria 2063
86 Ga0068855_100234741 3300005563 Bacteria 2051
87 Ga0068855_102111103 3300005563 Bacteria 567
88 Ga0070664_100171725 3300005564 Bacteria 1923
89 Ga0068857_101362187 3300005577 Unclassified 690
90 Ga0068854_100021982 3300005578 Bacteria 4337
91 Ga0068856_101092663 3300005614 Bacteria 815
92 Ga0068856_101853662 3300005614 Bacteria 614
93 Ga0068856_102364214 3300005614 Bacteria 539
94 Ga0068852_100044392 3300005616 Bacteria 3774
95 Ga0068852_101013282 3300005616 Bacteria 849
96 Ga0068859_100601567 3300005617 Unclassified 1192
97 Ga0068859_102052168 3300005617 Bacteria 631
98 Ga0068859_103104351 3300005617 Bacteria 506
99 Ga0068864_100150570 3300005618 Bacteria 2107
100 Ga0068864_100390280 3300005618 Unclassified 1321
101 Ga0068866_10083460 3300005718 Bacteria 1721
102 Ga0068861_100606648 3300005719 Bacteria 1005
103 Ga0068851_10039698 3300005834 Bacteria 2364
104 Ga0068870_10058804 3300005840 Bacteria 2059
105 Ga0068863_100172008 3300005841 Bacteria 2078
106 Ga0068863_100886002 3300005841 Unclassified 892
107 Ga0068858_100084721 3300005842 Bacteria 2948
108 Ga0068858_100460416 3300005842 Bacteria 1226
109 Ga0068858_102094252 3300005842 Unclassified 559
110 Ga0068858_102363451 3300005842 Bacteria 525
111 Ga0068860_100173262 3300005843 Bacteria 2085
112 Ga0068862_100069905 3300005844 Bacteria 3030
113 Ga0068862_100231112 3300005844 Bacteria 1678
114 Ga0068862_100245506 3300005844 Bacteria 1629
115 Ga0068862_102001527 3300005844 Bacteria 590
116 Ga0081455_10036912 3300005937 Bacteria 4344
117 Ga0081540_1172153 3300005983 Bacteria 822
118 Ga0081539_10033099 3300005985 Bacteria 3154
119 Ga0070717_10131842 3300006028 Unclassified 2150
120 Ga0070717_10667080 3300006028 Bacteria 944
121 Ga0075363_100781705 3300006048 Bacteria 580
122 Ga0070716_100343012 3300006173 Bacteria 1054
123 Ga0070716_101447815 3300006173 Unclassified 560
124 Ga0070712_101767201 3300006175 Unclassified 541
125 Ga0097621_100007468 3300006237 Bacteria 7820
126 Ga0097621_100118657 3300006237 Bacteria 2242
127 Ga0097621_100180653 3300006237 Unclassified 1823
128 Ga0068871_100251256 3300006358 Bacteria 1540
129 Ga0068871_100426917 3300006358 Bacteria 1184
130 Ga0075428_100222532 3300006844 Bacteria 2037
131 Ga0075430_100012350 3300006846 Bacteria 7263
132 Ga0075430_100563968 3300006846 Bacteria 939
133 Ga0075431_100001078 3300006847 Bacteria 24406
134 Ga0075431_100771433 3300006847 Bacteria 936
135 Ga0075433_10386780 3300006852 Bacteria 1235
136 Ga0075434_100196372 3300006871 Bacteria 2037
137 Ga0075434_100372190 3300006871 Bacteria 1449
138 Ga0075429_100001758 3300006880 Bacteria 17930
139 Ga0068865_100116179 3300006881 Bacteria 1982
140 Ga0068865_100232979 3300006881 Bacteria 1446
141 Ga0068865_101190485 3300006881 Bacteria 674
142 Ga0068865_101208042 3300006881 Bacteria 669
143 Ga0075436_100043719 3300006914 Bacteria 3089
144 Ga0075436_100892422 3300006914 Bacteria 665
145 Ga0097620_100601524 3300006931 Unclassified 1192
146 Ga0097620_102052363 3300006931 Bacteria 631
147 Ga0097620_103104669 3300006931 Bacteria 506
148 Ga0075435_100420242 3300007076 Bacteria 1151
149 Ga0075435_100592452 3300007076 Bacteria 961
150 Ga0075435_101773889 3300007076 Bacteria 542
151 Ga0105250_10081052 3300009092 Unclassified 1316
152 Ga0105250_10128190 3300009092 Unclassified 1046
153 Ga0105240_10055027 3300009093 Bacteria 4983
154 Ga0105240_10172441 3300009093 Bacteria 2560
155 Ga0111539_10138178 3300009094 Bacteria 2854
156 Ga0111539_10817638 3300009094 Bacteria 1084
157 Ga0111539_11058789 3300009094 Bacteria 943
158 Ga0105245_10000227 3300009098 Bacteria 53515
159 Ga0105245_10774428 3300009098 Unclassified 996
160 Ga0105245_10888875 3300009098 Unclassified 932
161 Ga0105247_10085318 3300009101 Bacteria 1997
162 Ga0114129_10001354 3300009147 Bacteria 32893
163 Ga0114129_10332267 3300009147 Bacteria 2018
164 Ga0114129_10599290 3300009147 Bacteria 1428
165 Ga0114129_11271032 3300009147 Bacteria 913
166 Ga0105243_10198788 3300009148 Bacteria 1757
167 Ga0105243_12443869 3300009148 Bacteria 561
168 Ga0105248_10017574 3300009177 Bacteria 7888
169 Ga0105237_10321548 3300009545 Unclassified 1551
170 Ga0105238_10128991 3300009551 Bacteria 2507
171 Ga0105238_10398256 3300009551 Bacteria 1370
172 Ga0105249_10048793 3300009553 Bacteria 3860
173 Ga0105249_10349198 3300009553 Bacteria 1498
174 Ga0099796_10018710 3300010159 Unclassified 2086
175 Ga0099796_10444621 3300010159 Unclassified 576
176 Ga0105246_10009434 3300011119 Bacteria 6014
177 Ga0157371_10033952 3300013102 Bacteria 3663
178 Ga0157370_10081697 3300013104 Bacteria 3041
179 Ga0157370_10726350 3300013104 Bacteria 906
180 Ga0157370_10809151 3300013104 Bacteria 852
181 Ga0157369_10007776 3300013105 Bacteria 12334
182 Ga0157369_10039529 3300013105 Bacteria 5155
183 Ga0157369_10395371 3300013105 Bacteria 1434
184 Ga0157369_10490259 3300013105 Bacteria 1272
185 Ga0157369_10885719 3300013105 Bacteria 916
186 Ga0157374_10011438 3300013296 Bacteria 7684
187 Ga0157374_10304668 3300013296 Bacteria 1577
188 Ga0157374_10370821 3300013296 Unclassified 1425
189 Ga0157374_10682367 3300013296 Bacteria 1040
190 Ga0157374_11890796 3300013296 Unclassified 623
191 Ga0157378_10227028 3300013297 Bacteria 1777
192 Ga0157378_11398418 3300013297 Bacteria 743
193 Ga0163162_10010703 3300013306 Bacteria 8922
194 Ga0157372_10065947 3300013307 Plasmid 4067
195 Ga0157372_10199394 3300013307 Bacteria 2318
196 Ga0157372_10215633 3300013307 Bacteria 2225
197 Ga0157372_10255882 3300013307 Bacteria 2033
198 Ga0157372_10550796 3300013307 Bacteria 1344
199 Ga0157372_10565820 3300013307 Bacteria 1325
200 Ga0157372_11546735 3300013307 Unclassified 764
201 Ga0157372_12681542 3300013307 Unclassified 572
202 Ga0157372_12881288 3300013307 Unclassified 551
203 Ga0157372_13433881 3300013307 Unclassified 504
204 Ga0157375_10111771 3300013308 Bacteria 2831
205 Ga0157375_10582837 3300013308 Bacteria 1279
206 Ga0163163_10093688 3300014325 Bacteria 3020
207 Ga0163163_10152012 3300014325 Unclassified 2358
208 Ga0163163_10194262 3300014325 Bacteria 2077
209 Ga0163163_10357212 3300014325 Unclassified 1517
210 Ga0163163_10566306 3300014325 Bacteria 1199
211 Ga0163163_11868652 3300014325 Unclassified 661
212 Ga0157380_13279386 3300014326 Bacteria 517
213 Ga0157379_10270951 3300014968 Bacteria 1544
214 Ga0157376_10066067 3300014969 Bacteria 3056
215 Ga0157376_10157322 3300014969 Bacteria 2056
216 Ga0157376_11423834 3300014969 Unclassified 725
217 Ga0163161_10174502 3300017792 Bacteria 1645
218 Ga0213872_10014745 3300021361 Bacteria 3642
219 Ga0213876_10000080 3300021384 Bacteria 109125
220 Ga0213875_10074221 3300021388 Bacteria 1587
221 Ga0209233_1043065 3300025261 Bacteria 965
222 Ga0207656_10220121 3300025321 Bacteria 922
223 Ga0207642_10070443 3300025899 Bacteria 1662
224 Ga0207680_10024742 3300025903 Bacteria 3300
225 Ga0207680_10289709 3300025903 Bacteria 1139
226 Ga0207680_10438183 3300025903 Bacteria 927
227 Ga0207680_11075907 3300025903 Bacteria 575
228 Ga0207647_10014687 3300025904 Bacteria 5394
229 Ga0207699_11299200 3300025906 Unclassified 538
230 Ga0207645_10323397 3300025907 Bacteria 1029
231 Ga0207705_10044489 3300025909 Bacteria 3191
232 Ga0207705_10068946 3300025909 Bacteria 2561
233 Ga0207705_10699773 3300025909 Unclassified 788
234 Ga0207684_10115306 3300025910 Bacteria 2301
235 Ga0207684_11045401 3300025910 Bacteria 682
236 Ga0207654_10004210 3300025911 Bacteria 7261
237 Ga0207707_10662232 3300025912 Bacteria 879
238 Ga0207695_10008610 3300025913 Bacteria 12746
239 Ga0207695_10065544 3300025913 Bacteria 3735
240 Ga0207671_10119685 3300025914 Bacteria 2012
241 Ga0207663_10005124 3300025916 Bacteria 6588
242 Ga0207660_10357489 3300025917 Bacteria 1171
243 Ga0207660_10360381 3300025917 Bacteria 1166
244 Ga0207657_10010615 3300025919 Bacteria 9179
245 Ga0207657_10356503 3300025919 Bacteria 1153
246 Ga0207649_10060159 3300025920 Bacteria 2386
247 Ga0207649_10085968 3300025920 Bacteria 2048
248 Ga0207652_10629882 3300025921 Bacteria 960
249 Ga0207681_10000052 3300025923 Bacteria 112273
250 Ga0207681_10272586 3300025923 Bacteria 1329
251 Ga0207694_10243092 3300025924 Unclassified 1471
252 Ga0207694_10277133 3300025924 Bacteria 1377
253 Ga0207659_11130823 3300025926 Unclassified 674
254 Ga0207687_10001334 3300025927 Bacteria 16866
255 Ga0207687_10001896 3300025927 Bacteria 14378
256 Ga0207687_10249732 3300025927 Unclassified 1410
257 Ga0207700_10074487 3300025928 Unclassified 2626
258 Ga0207700_10252557 3300025928 Unclassified 1507
259 Ga0207700_11896193 3300025928 Unclassified 522
260 Ga0207664_10006040 3300025929 Bacteria 8291
261 Ga0207664_10009805 3300025929 Bacteria 6740
262 Ga0207664_10049524 3300025929 Bacteria 3308
263 Ga0207706_10003535 3300025933 Bacteria 14924
264 Ga0207709_11443102 3300025935 Bacteria 570
265 Ga0207670_10018298 3300025936 Bacteria 4256
266 Ga0207670_10043053 3300025936 Bacteria 2980
267 Ga0207704_10126869 3300025938 Bacteria 1758
268 Ga0207665_11105158 3300025939 Bacteria 632
269 Ga0207711_10006797 3300025941 Bacteria 9612
270 Ga0207689_10027469 3300025942 Bacteria 4763
271 Ga0207689_10517016 3300025942 Bacteria 1001
272 Ga0207661_10106091 3300025944 Bacteria 2368
273 Ga0207667_10035581 3300025949 Bacteria 5341
274 Ga0207667_10037924 3300025949 Bacteria 5150
275 Ga0207667_11290645 3300025949 Bacteria 707
276 Ga0207667_11703001 3300025949 Bacteria 597
277 Ga0207712_10057564 3300025961 Bacteria 2743
278 Ga0207712_10078734 3300025961 Bacteria 2393
279 Ga0207712_10362946 3300025961 Bacteria 1207
280 Ga0207668_10343029 3300025972 Unclassified 1246
281 Ga0207640_10096141 3300025981 Bacteria 2064
282 Ga0207658_10132847 3300025986 Bacteria 2002
283 Ga0207677_10000007 3300026023 Bacteria 274553
284 Ga0207677_10001955 3300026023 Bacteria 10905
285 Ga0207677_10559011 3300026023 Bacteria 998
286 Ga0207703_10021672 3300026035 Bacteria 5030
287 Ga0207639_10285825 3300026041 Unclassified 1452
288 Ga0207639_10673736 3300026041 Bacteria 958
289 Ga0207678_10000405 3300026067 Bacteria 39009
290 Ga0207678_10492696 3300026067 Unclassified 1068
291 Ga0207702_10089329 3300026078 Bacteria 2694
292 Ga0207702_10619385 3300026078 Bacteria 1063
293 Ga0207702_10798410 3300026078 Bacteria 933
294 Ga0207702_11556712 3300026078 Unclassified 654
295 Ga0207641_10224349 3300026088 Bacteria 1744
296 Ga0207641_10805776 3300026088 Unclassified 929
297 Ga0207648_10012259 3300026089 Bacteria 8025
298 Ga0207648_10863807 3300026089 Bacteria 844
299 Ga0207676_11275578 3300026095 Unclassified 729
300 Ga0207674_10058300 3300026116 Bacteria 3912
301 Ga0207675_100065028 3300026118 Bacteria 3409
302 Ga0207683_10048955 3300026121 Bacteria 3698
303 Ga0207698_10993162 3300026142 Bacteria 850
304 Ga0207428_11282029 3300027907 Bacteria 508
305 Ga0207428_11314064 3300027907 Bacteria 501
306 Ga0268266_10036346 3300028379 Bacteria 4192
307 Ga0268266_12268173 3300028379 Bacteria 514
308 Ga0268265_10088523 3300028380 Bacteria 2467
309 Ga0268265_10216321 3300028380 Bacteria 1673
310 Ga0268265_11336885 3300028380 Bacteria 717
311 Ga0268265_12503022 3300028380 Bacteria 522
312 Ga0268264_10124117 3300028381 Bacteria 2279
313 Ga0307515_10036791 3300028794 Bacteria 7903
314 Ga0265338_10074759 3300028800 Bacteria 2879
315 Ga0265762_1004338 3300030760 Unclassified 2541
316 Ga0265760_10220218 3300031090 Bacteria 647
317 Ga0265325_10017596 3300031241 Bacteria 3972
318 Ga0265325_10346669 3300031241 Bacteria 656
319 Ga0265340_10028498 3300031247 Bacteria 2808
320 Ga0265327_10001155 3300031251 Bacteria 35957
321 Ga0265313_10130768 3300031595 Bacteria 1088
322 Ga0307508_10052913 3300031616 Bacteria 3605
323 Ga0373930_0009328 3300034816 Bacteria 1735
324 Ga0373958_0033465 3300034819 Bacteria 1020
325 Ga0373959_0027272 3300034820 Bacteria 1134
326 Ga0373938_0081545 3300034957 Unclassified 788
327 Ga0373928_0217543 3300035084 Unclassified 557
328 Ga0373934_0078937 3300035086 Unclassified 1321
329 Ga0373940_0019607 3300035088 Bacteria 1711
330 Ga0373940_0104227 3300035088 Bacteria 864
331 Ga0373949_0230801 3300035090 Unclassified 566
332 Ga0373952_0088473 3300035092 Bacteria 801
333 Ga0373923_0060334 3300035111 Unclassified 1610
334 Ga0373923_0234198 3300035111 Bacteria 856
335 Ga0373923_0666939 3300035111 Unclassified 515
336 Ga0373932_0059651 3300035112 Unclassified 1156
337 Ga0373936_0010348 3300035113 Bacteria 3519
338 Ga0373936_0075333 3300035113 Bacteria 1397
339 Ga0373941_0022754 3300035115 Bacteria 1782
340 Ga0373941_0063206 3300035115 Bacteria 1210
341 Ga0373945_0383350 3300035116 Bacteria 614
342 Ga0373945_0542374 3300035116 Unclassified 521
343 Ga0373945_0563293 3300035116 Bacteria 512
344 Ga0373953_0032146 3300035117 Bacteria 2045
345 Ga0373953_0069382 3300035117 Bacteria 1452
346 Ga0373953_0525073 3300035117 Unclassified 525
347 Ga0373954_0003645 3300035118 Bacteria 6554
348 Ga0373954_0071068 3300035118 Bacteria 1654
349 Ga0373956_0097545 3300035119 Unclassified 1360
350 Ga0373957_0037055 3300035120 Unclassified 1820
351 Ga0373957_0080938 3300035120 Bacteria 1282
352 Ga0373960_0106601 3300035121 Bacteria 914
353 Ga0373943_0160851 3300035170 Bacteria 1222
354 Ga0373946_0334325 3300035171 Unclassified 755
355 Ga0373955_0010168 3300035172 Bacteria 4435
356 Ga0373955_0159084 3300035172 Bacteria 1332
357 Ga0373942_0110292 3300035207 Unclassified 850
358 Ga0373942_0367106 3300035207 Bacteria 511
359 Ga0373961_0215861 3300035241 Unclassified 682
360 Ga0373924_0095830 3300035410 Unclassified 1273
361 Ga0373924_0230077 3300035410 Unclassified 819
362 Ga0373931_0049110 3300035691 Bacteria 2239
363 Ga0373931_0706416 3300035691 Bacteria 666
364 Ga0373935_0003649 3300035692 Bacteria 8967
365 Ga0373935_0038049 3300035692 Bacteria 3011
366 Ga0373927_0336809 3300035695 Bacteria 994
367 Ga0373933_0003987 3300035724 Bacteria 8141
368 Ga0373933_0027027 3300035724 Bacteria 3301
369 Ga0373933_0356229 3300035724 Bacteria 951
370 Ga0373947_0137392 3300035725 Unclassified 1565
371 Ga0373947_0366649 3300035725 Unclassified 968
372 Ga0373937_0010622 3300036401 Bacteria 8046
373 Ga0373937_0049957 3300036401 Bacteria 3830
374 Ga0373937_0071236 3300036401 Bacteria 3206
375 Ga0373937_0108850 3300036401 Bacteria 2577
376 Ga0373937_0113013 3300036401 Bacteria 2527
377 Ga0373937_0636320 3300036401 Unclassified 1012
378 Ga0373925_0125134 3300037068 Unclassified 1999
379 Ga0373925_0240246 3300037068 Bacteria 1450
380 Ga0373925_1515933 3300037068 Bacteria 548
381 Ga0395899_0023575 3300037312 Bacteria 4659
382 Ga0395900_0560724 3300037418 Bacteria 1086
383 Ga0395898_0002088 3300037466 Bacteria 24842
384 Ga0395898_0198344 3300037466 Bacteria 1917
385 Ga0395905_1368022 3300037471 Bacteria 612
386 Ga0395905_1564420 3300037471 Unclassified 564
387 Ga0436364_0601668 3300037853 Bacteria 4765
388 Ga0436364_0785418 3300037853 Unclassified 599
389 Ga0436364_1531940 3300037853 Bacteria 605
390 Ga0395901_0006373 3300038443 Bacteria 11956
391 Ga0395901_1959161 3300038443 Bacteria 533
392 Ga0395901_2143261 3300038443 Bacteria 504
393 Ga0436365_1645708 3300039437 Bacteria 58473
394 Ga0436365_1806800 3300039437 Bacteria 5510
395 Ga0436360_1057121 3300039438 Bacteria 842
396 Ga0436360_1298186 3300039438 Bacteria 699
397 Ga0436361_0690613 3300039447 Bacteria 706
398 Ga0436361_0736621 3300039447 Bacteria 7882
399 Ga0436361_0784652 3300039447 Bacteria 2039
400 Ga0436363_1057653 3300039450 Bacteria 535
401 Ga0436363_1330582 3300039450 Bacteria 830
402 Ga0436362_0006241 3300039453 Bacteria 528
403 Ga0436362_0441251 3300039453 Bacteria 4538
404 Ga0436362_0768974 3300039453 Bacteria 852
405 Ga0436362_1209886 3300039453 Bacteria 989
406 Ga0451802_1166583 3300041460 Bacteria 592
407 Ga0466969_0015812 3300044656 Bacteria 3955
408 Ga0466966_0044541 3300044684 Bacteria 2840
409 Ga0466966_0329318 3300044684 Unclassified 918
410 Ga0466961_0019466 3300044693 Bacteria 4366
411 Ga0466963_0012042 3300044694 Bacteria 5284
412 Ga0466971_0024740 3300044719 Unclassified 2680
413 Ga0466970_0139046 3300044765 Unclassified 1337
414 Ga0466957_0740823 3300044842 Bacteria 695
415 Ga0466959_0007851 3300045049 Bacteria 7511
416 Ga0466959_0037430 3300045049 Bacteria 3585
417 Ga0451576_0400182 3300045051 Bacteria 1440
418 Ga0451576_2753916 3300045051 Unclassified 500
419 Ga0466958_0273395 3300045836 Unclassified 1082
420 Ga0495592_0037455 3300046454 Bacteria 3652
421 Ga0495603_0506627 3300046455 Unclassified 691
422 Ga0495629_0490516 3300046459 Unclassified 829
423 Ga0495651_0063456 3300046462 Bacteria 2824
424 Ga0495651_0465009 3300046462 Unclassified 815
425 Ga0495651_0486219 3300046462 Bacteria 792
426 Ga0495653_0089080 3300046463 Bacteria 2262
427 Ga0495653_0136089 3300046463 Unclassified 1733
428 Ga0495580_0016912 3300046472 Bacteria 5465
429 Ga0495582_0255394 3300046473 Unclassified 1005
430 Ga0495639_0724914 3300046475 Unclassified 514
431 Ga0495664_0001420 3300046477 Bacteria 12706
432 Ga0495594_0450193 3300046499 Unclassified 732
433 Ga0495608_0566745 3300046511 Unclassified 683
434 Ga0495608_0595241 3300046511 Bacteria 664
435 Ga0495618_0478170 3300046514 Bacteria 753
436 Ga0495620_0001128 3300046515 Bacteria 16286
437 Ga0495628_0967265 3300046516 Bacteria 587
438 Ga0495630_0037095 3300046517 Unclassified 3644
439 Ga0495630_0771029 3300046517 Unclassified 735
440 Ga0495637_0001266 3300046520 Bacteria 15248
441 Ga0495652_0624741 3300046529 Unclassified 732
442 Ga0495654_0000004 3300046530 Bacteria 515304
443 Ga0495665_0568818 3300046531 Unclassified 568
444 Ga0495640_0106502 3300046533 Bacteria 1836
445 Ga0495640_0249561 3300046533 Bacteria 1112
446 Ga0495587_0010476 3300046536 Bacteria 5898
447 Ga0495621_0487030 3300046539 Unclassified 531
448 Ga0495645_0000124 3300046543 Bacteria 51967
449 Ga0495667_0002329 3300046559 Bacteria 12731
450 Ga0495625_0100534 3300046660 Bacteria 1988
451 Ga0495635_0030359 3300046663 Bacteria 3756
452 Ga0495635_0579135 3300046663 Unclassified 734
453 Ga0495657_0002597 3300046675 Bacteria 15115
454 Ga0495599_0019180 3300046678 Bacteria 4264
455 Ga0495623_0536347 3300046679 Unclassified 614
456 Ga0495646_0049188 3300046680 Bacteria 2559
457 Ga0495646_0609133 3300046680 Bacteria 554
458 Ga0495647_0028231 3300046681 Bacteria 2068
459 Ga0495658_0304874 3300046683 Unclassified 1008
460 Ga0495669_0174167 3300046684 Bacteria 1024
461 Ga0495669_0219688 3300046684 Unclassified 911
462 Ga0495600_0200897 3300046809 Unclassified 1280
463 Ga0495660_0076380 3300046810 Bacteria 1765
464 Ga0495604_0119944 3300047317 Bacteria 1905
465 Ga0495636_0280708 3300047318 Bacteria 776
466 Ga0495636_0493140 3300047318 Bacteria 592
467 Ga0495674_0016579 3300047319 Bacteria 6875
468 Ga0495674_0017271 3300047319 Bacteria 6713
469 Ga0495674_0931562 3300047319 Unclassified 669
470 Ga0495672_0011675 3300047320 Bacteria 6182
471 Ga0495680_0065095 3300047322 Bacteria 2793
472 Ga0495675_0009774 3300047444 Bacteria 5982
473 Ga0495684_0161119 3300047471 Bacteria 1673
474 Ga0495684_1085970 3300047471 Bacteria 503
475 Ga0495686_0505787 3300047472 Bacteria 636
476 Ga0495602_0000404 3300048088 Bacteria 40468
477 Ga0495602_0561991 3300048088 Unclassified 789
478 Ga0495615_0147838 3300048090 Bacteria 697
479 Ga0496100_0071269 3300048903 Unclassified 2320
480 Ga0496100_0107139 3300048903 Bacteria 1936
481 Ga0496102_0029383 3300048905 Bacteria 4919
482 Ga0496102_0943791 3300048905 Unclassified 784
483 Ga0496102_1239835 3300048905 Unclassified 665
484 Ga0496103_0130081 3300048906 Bacteria 1607
485 Ga0496104_0053811 3300048907 Bacteria 3804
486 Ga0496104_0404018 3300048907 Bacteria 1278
487 Ga0496105_0122756 3300048908 Unclassified 2141
488 Ga0496105_0676470 3300048908 Unclassified 794
489 Ga0496106_0062028 3300048909 Bacteria 2838
490 Ga0496106_0417192 3300048909 Bacteria 1079
491 Ga0496107_0104873 3300048910 Bacteria 2075
492 Ga0496108_0777157 3300048911 Unclassified 827
493 Ga0496109_0008252 3300048912 Bacteria 8845
494 Ga0496109_0653520 3300048912 Unclassified 988
495 Ga0496109_1138637 3300048912 Unclassified 717
496 Ga0496110_0085340 3300048913 Bacteria 2818
497 Ga0496110_0598113 3300048913 Bacteria 1001
498 Ga0496111_0423797 3300048914 Unclassified 983
499 Ga0496111_0809159 3300048914 Unclassified 678
500 Ga0496112_0123832 3300048915 Bacteria 2556
501 Ga0496112_0203887 3300048915 Bacteria 1936
502 Ga0496112_0318893 3300048915 Bacteria 1498
503 Ga0496112_1618582 3300048915 Unclassified 561
504 Ga0496113_0034764 3300048916 Bacteria 3680
505 Ga0496113_1167575 3300048916 Unclassified 602
506 Ga0496115_0100478 3300048918 Bacteria 2371
507 Ga0496115_0253009 3300048918 Bacteria 1450
508 Ga0496124_0000282 3300048927 Bacteria 96697
509 Ga0501032_1001344 3300049569 Unclassified 525
510 Ga0501033_0060170 3300049570 Bacteria 2803
511 Ga0501034_0205810 3300049571 Bacteria 1924
512 Ga0501034_0219629 3300049571 Bacteria 1853
513 Ga0501034_0902841 3300049571 Bacteria 771
514 Ga0501037_0245020 3300049573 Bacteria 1255
515 Ga0501041_0212901 3300049577 Unclassified 1212
516 Ga0501043_0096446 3300049579 Bacteria 2324
517 Ga0501046_0039288 3300049580 Bacteria 3791
518 Ga0501072_0006969 3300049588 Bacteria 8577
519 Ga0501073_0803432 3300049589 Bacteria 648
520 Ga0501074_1276484 3300049590 Unclassified 515
521 Ga0501080_0036534 3300049742 Bacteria 4585
522 Ga0501080_0413360 3300049742 Bacteria 1213
523 Ga0501081_1219232 3300049743 Bacteria 570
524 Ga0501083_0007473 3300049744 Bacteria 7741
525 Ga0501035_0106214 3300049822 Unclassified 2462
526 Ga0501035_0640747 3300049822 Bacteria 862
527 Ga0501044_0045920 3300049823 Bacteria 4524
528 nmdc:mga03n38_584889_c1 3300050490 Bacteria 634
529 nmdc:mga05p37_1465437_c1 3300050507 Bacteria 682
530 nmdc:mga05p37_412126_c1 3300050507 Bacteria 1575
531 nmdc:mga05p37_543_c1 3300050507 Bacteria 12741
532 nmdc:mga09592_1095_c1 3300050508 Bacteria 21497
533 nmdc:mga0qj67_1046_c1 3300050509 Bacteria 19154
534 nmdc:mga06r32_520_c1 3300050510 Bacteria 33185
535 nmdc:mga08y16_110858_c1 3300050511 Bacteria 2857
536 nmdc:mga08y16_290495_c1 3300050511 Bacteria 1686
537 nmdc:mga08y16_880707_c1 3300050511 Unclassified 883
538 nmdc:mga0n895_350791_c1 3300050512 Bacteria 1495
539 nmdc:mga0n895_362372_c1 3300050512 Bacteria 1468
540 nmdc:mga0n895_838766_c1 3300050512 Bacteria 907
541 nmdc:mga0rr50_1359302_c1 3300050513 Bacteria 602
542 nmdc:mga0rr50_845207_c1 3300050513 Bacteria 781
543 nmdc:mga08x19_310518_c1 3300050514 Unclassified 1096
544 nmdc:mga08x19_36744_c1 3300050514 Bacteria 3103
545 nmdc:mga0a205_179105_c1 3300050515 Bacteria 2014
546 nmdc:mga0a205_345993_c1 3300050515 Bacteria 1355
547 Ga0495601_0004096 3300053077 Bacteria 8403
548 Ga0495601_0065820 3300053077 Bacteria 2307
549 Ga0495612_0000167 3300053078 Bacteria 27522
550 Ga0495595_0081573 3300053084 Bacteria 1541
551 Ga0495619_0078296 3300053085 Bacteria 2222
552 Ga0495619_0728552 3300053085 Bacteria 673
553 Ga0495619_0736420 3300053085 Unclassified 669
554 Ga0500646_0005947 3300053090 Bacteria 3096
555 Ga0500652_153628 3300053131 Bacteria 954
556 Ga0500620_000482 3300053155 Bacteria 7046
557 Ga0500627_0123027 3300053158 Bacteria 1171
558 Ga0501084_0398215 3300054114 Bacteria 1163
559 Ga0501082_0004240 3300060353 Bacteria 12530
560 2869164063 2869162929 Bacteria 6399702
561 2889010279 2889010040 Bacteria 6749192
562 2924766262 2924762789 Bacteria 6561353
563 2987655369 2987652177 Bacteria 6969023
564 2987670813 2987666974 Bacteria 6509233
565 Ga0070714_100007771
566 rootL2_10350662
567 Ga0065715_10056458
568 Ga0070658_10234784
569 Ga0070658_10971130
570 Ga0070676_10640928
571 Ga0070676_11139028
572 Ga0070683_100141963
573 Ga0070690_100219484
574 Ga0070690_100391662
575 Ga0068869_100797225
576 Ga0068869_100805956
577 Ga0068869_101250299
578 Ga0070666_10146771
579 Ga0070666_10528175
580 Ga0070680_100176881
581 Ga0070682_100015247
582 Ga0068868_100000111
583 Ga0068868_100005397
584 Ga0068868_100169192
585 Ga0070660_100465654
586 Ga0070660_100984542
587 Ga0070689_100055014
588 Ga0070689_100356332
589 Ga0070691_10097094
590 Ga0070661_100018976
591 Ga0070661_100037667
592 Ga0070692_10186012
593 Ga0070669_100000032
594 Ga0070669_100128989
595 Ga0070675_100572479
596 Ga0070675_101291837
597 Ga0070674_100250114
598 Ga0070659_100169915
599 Ga0070667_100017886
600 Ga0070709_11688252
601 Ga0070714_100004134
602 Ga0070714_100731308
603 Ga0070713_100002892
604 Ga0070713_101830474
605 Ga0070713_102129534
606 Ga0070710_10569795
607 Ga0070711_100001861
608 Ga0070711_100227368
609 Ga0070705_100822965
610 Ga0070694_100179059
611 Ga0070708_100164040
612 Ga0070708_100238009
613 Ga0070663_100007514
614 Ga0070663_100608433
615 Ga0070678_100299976
616 Ga0070662_100006127
617 Ga0068867_100060454
618 Ga0068867_100827705
619 Ga0068867_101655839
620 Ga0070685_10195086
621 Ga0070685_10805195
622 Ga0070706_100823414
623 Ga0070706_100935995
624 Ga0070707_101827458
625 Ga0070707_102158994
626 Ga0070698_100750608
627 Ga0070699_100613762
628 Ga0070699_101391723
629 Ga0070679_100296962
630 Ga0070679_100388907
631 Ga0070684_100522773
632 Ga0070684_100657952
633 Ga0070697_100042052
634 Ga0070697_100722006
635 Ga0070697_101532725
636 Ga0068853_100124789
637 Ga0068853_102168687
638 Ga0070686_100039404
639 Ga0070686_100173479
640 Ga0070695_100100415
641 Ga0070696_100054428
642 Ga0070693_100281171
643 Ga0070693_100387940
644 Ga0070665_100007075
645 Ga0070665_100138785
646 Ga0070704_100273599
647 Ga0070704_101409418
648 Ga0068855_100093108
649 Ga0068855_100232520
650 Ga0068855_100234741
651 Ga0068855_102111103
652 Ga0070664_100171725
653 Ga0068857_101362187
654 Ga0068854_100021982
655 Ga0068856_101092663
656 Ga0068856_101853662
657 Ga0068856_102364214
658 Ga0068852_100044392
659 Ga0068852_101013282
660 Ga0068859_100601567
661 Ga0068859_102052168
662 Ga0068859_103104351
663 Ga0068864_100150570
664 Ga0068864_100390280
665 Ga0068866_10083460
666 Ga0068861_100606648
667 Ga0068851_10039698
668 Ga0068870_10058804
669 Ga0068863_100172008
670 Ga0068863_100886002
671 Ga0068858_100084721
672 Ga0068858_100460416
673 Ga0068858_102094252
674 Ga0068858_102363451
675 Ga0068860_100173262
676 Ga0068862_100069905
677 Ga0068862_100231112
678 Ga0068862_100245506
679 Ga0068862_102001527
680 Ga0081455_10036912
681 Ga0081540_1172153
682 Ga0081539_10033099
683 Ga0070717_10131842
684 Ga0070717_10667080
685 Ga0075363_100781705
686 Ga0070716_100343012
687 Ga0070716_101447815
688 Ga0070712_101767201
689 Ga0097621_100007468
690 Ga0097621_100118657
691 Ga0097621_100180653
692 Ga0068871_100251256
693 Ga0068871_100426917
694 Ga0075428_100222532
695 Ga0075430_100012350
696 Ga0075430_100563968
697 Ga0075431_100001078
698 Ga0075431_100771433
699 Ga0075433_10386780
700 Ga0075434_100196372
701 Ga0075434_100372190
702 Ga0075429_100001758
703 Ga0068865_100116179
704 Ga0068865_100232979
705 Ga0068865_101190485
706 Ga0068865_101208042
707 Ga0075436_100043719
708 Ga0075436_100892422
709 Ga0097620_100601524
710 Ga0097620_102052363
711 Ga0097620_103104669
712 Ga0075435_100420242
713 Ga0075435_100592452
714 Ga0075435_101773889
715 Ga0105250_10081052
716 Ga0105250_10128190
717 Ga0105240_10055027
718 Ga0105240_10172441
719 Ga0111539_10138178
720 Ga0111539_10817638
721 Ga0111539_11058789
722 Ga0105245_10000227
723 Ga0105245_10774428
724 Ga0105245_10888875
725 Ga0105247_10085318
726 Ga0114129_10001354
727 Ga0114129_10332267
728 Ga0114129_10599290
729 Ga0114129_11271032
730 Ga0105243_10198788
731 Ga0105243_12443869
732 Ga0105248_10017574
733 Ga0105237_10321548
734 Ga0105238_10128991
735 Ga0105238_10398256
736 Ga0105249_10048793
737 Ga0105249_10349198
738 Ga0099796_10018710
739 Ga0099796_10444621
740 Ga0105246_10009434
741 Ga0157371_10033952
742 Ga0157370_10081697
743 Ga0157370_10726350
744 Ga0157370_10809151
745 Ga0157369_10007776
746 Ga0157369_10039529
747 Ga0157369_10395371
748 Ga0157369_10490259
749 Ga0157369_10885719
750 Ga0157374_10011438
751 Ga0157374_10304668
752 Ga0157374_10370821
753 Ga0157374_10682367
754 Ga0157374_11890796
755 Ga0157378_10227028
756 Ga0157378_11398418
757 Ga0163162_10010703
758 Ga0157372_10065947
759 Ga0157372_10199394
760 Ga0157372_10215633
761 Ga0157372_10255882
762 Ga0157372_10550796
763 Ga0157372_10565820
764 Ga0157372_11546735
765 Ga0157372_12681542
766 Ga0157372_12881288
767 Ga0157372_13433881
768 Ga0157375_10111771
769 Ga0157375_10582837
770 Ga0163163_10093688
771 Ga0163163_10152012
772 Ga0163163_10194262
773 Ga0163163_10357212
774 Ga0163163_10566306
775 Ga0163163_11868652
776 Ga0157380_13279386
777 Ga0157379_10270951
778 Ga0157376_10066067
779 Ga0157376_10157322
780 Ga0157376_11423834
781 Ga0163161_10174502
782 Ga0213872_10014745
783 Ga0213876_10000080
784 Ga0213875_10074221
785 Ga0209233_1043065
786 Ga0207656_10220121
787 Ga0207642_10070443
788 Ga0207680_10024742
789 Ga0207680_10289709
790 Ga0207680_10438183
791 Ga0207680_11075907
792 Ga0207647_10014687
793 Ga0207699_11299200
794 Ga0207645_10323397
795 Ga0207705_10044489
796 Ga0207705_10068946
797 Ga0207705_10699773
798 Ga0207684_10115306
799 Ga0207684_11045401
800 Ga0207654_10004210
801 Ga0207707_10662232
802 Ga0207695_10008610
803 Ga0207695_10065544
804 Ga0207671_10119685
805 Ga0207663_10005124
806 Ga0207660_10357489
807 Ga0207660_10360381
808 Ga0207657_10010615
809 Ga0207657_10356503
810 Ga0207649_10060159
811 Ga0207649_10085968
812 Ga0207652_10629882
813 Ga0207681_10000052
814 Ga0207681_10272586
815 Ga0207694_10243092
816 Ga0207694_10277133
817 Ga0207659_11130823
818 Ga0207687_10001334
819 Ga0207687_10001896
820 Ga0207687_10249732
821 Ga0207700_10074487
822 Ga0207700_10252557
823 Ga0207700_11896193
824 Ga0207664_10006040
825 Ga0207664_10009805
826 Ga0207664_10049524
827 Ga0207706_10003535
828 Ga0207709_11443102
829 Ga0207670_10018298
830 Ga0207670_10043053
831 Ga0207704_10126869
832 Ga0207665_11105158
833 Ga0207711_10006797
834 Ga0207689_10027469
835 Ga0207689_10517016
836 Ga0207661_10106091
837 Ga0207667_10035581
838 Ga0207667_10037924
839 Ga0207667_11290645
840 Ga0207667_11703001
841 Ga0207712_10057564
842 Ga0207712_10078734
843 Ga0207712_10362946
844 Ga0207668_10343029
845 Ga0207640_10096141
846 Ga0207658_10132847
847 Ga0207677_10000007
848 Ga0207677_10001955
849 Ga0207677_10559011
850 Ga0207703_10021672
851 Ga0207639_10285825
852 Ga0207639_10673736
853 Ga0207678_10000405
854 Ga0207678_10492696
855 Ga0207702_10089329
856 Ga0207702_10619385
857 Ga0207702_10798410
858 Ga0207702_11556712
859 Ga0207641_10224349
860 Ga0207641_10805776
861 Ga0207648_10012259
862 Ga0207648_10863807
863 Ga0207676_11275578
864 Ga0207674_10058300
865 Ga0207675_100065028
866 Ga0207683_10048955
867 Ga0207698_10993162
868 Ga0207428_11282029
869 Ga0207428_11314064
870 Ga0268266_10036346
871 Ga0268266_12268173
872 Ga0268265_10088523
873 Ga0268265_10216321
874 Ga0268265_11336885
875 Ga0268265_12503022
876 Ga0268264_10124117
877 Ga0307515_10036791
878 Ga0265338_10074759
879 Ga0265762_1004338
880 Ga0265760_10220218
881 Ga0265325_10017596
882 Ga0265325_10346669
883 Ga0265340_10028498
884 Ga0265327_10001155
885 Ga0265313_10130768
886 Ga0307508_10052913
887 Ga0373930_0009328
888 Ga0373958_0033465
889 Ga0373959_0027272
890 Ga0373938_0081545
891 Ga0373928_0217543
892 Ga0373934_0078937
893 Ga0373940_0019607
894 Ga0373940_0104227
895 Ga0373949_0230801
896 Ga0373952_0088473
897 Ga0373923_0060334
898 Ga0373923_0234198
899 Ga0373923_0666939
900 Ga0373932_0059651
901 Ga0373936_0010348
902 Ga0373936_0075333
903 Ga0373941_0022754
904 Ga0373941_0063206
905 Ga0373945_0383350
906 Ga0373945_0542374
907 Ga0373945_0563293
908 Ga0373953_0032146
909 Ga0373953_0069382
910 Ga0373953_0525073
911 Ga0373954_0003645
912 Ga0373954_0071068
913 Ga0373956_0097545
914 Ga0373957_0037055
915 Ga0373957_0080938
916 Ga0373960_0106601
917 Ga0373943_0160851
918 Ga0373946_0334325
919 Ga0373955_0010168
920 Ga0373955_0159084
921 Ga0373942_0110292
922 Ga0373942_0367106
923 Ga0373961_0215861
924 Ga0373924_0095830
925 Ga0373924_0230077
926 Ga0373931_0049110
927 Ga0373931_0706416
928 Ga0373935_0003649
929 Ga0373935_0038049
930 Ga0373927_0336809
931 Ga0373933_0003987
932 Ga0373933_0027027
933 Ga0373933_0356229
934 Ga0373947_0137392
935 Ga0373947_0366649
936 Ga0373937_0010622
937 Ga0373937_0049957
938 Ga0373937_0071236
939 Ga0373937_0108850
940 Ga0373937_0113013
941 Ga0373937_0636320
942 Ga0373925_0125134
943 Ga0373925_0240246
944 Ga0373925_1515933
945 Ga0395899_0023575
946 Ga0395900_0560724
947 Ga0395898_0002088
948 Ga0395898_0198344
949 Ga0395905_1368022
950 Ga0395905_1564420
951 Ga0436364_0601668
952 Ga0436364_0785418
953 Ga0436364_1531940
954 Ga0395901_0006373
955 Ga0395901_1959161
956 Ga0395901_2143261
957 Ga0436365_1645708
958 Ga0436365_1806800
959 Ga0436360_1057121
960 Ga0436360_1298186
961 Ga0436361_0690613
962 Ga0436361_0736621
963 Ga0436361_0784652
964 Ga0436363_1057653
965 Ga0436363_1330582
966 Ga0436362_0006241
967 Ga0436362_0441251
968 Ga0436362_0768974
969 Ga0436362_1209886
970 Ga0451802_1166583
971 Ga0466969_0015812
972 Ga0466966_0044541
973 Ga0466966_0329318
974 Ga0466961_0019466
975 Ga0466963_0012042
976 Ga0466971_0024740
977 Ga0466970_0139046
978 Ga0466957_0740823
979 Ga0466959_0007851
980 Ga0466959_0037430
981 Ga0451576_0400182
982 Ga0451576_2753916
983 Ga0466958_0273395
984 Ga0495592_0037455
985 Ga0495603_0506627
986 Ga0495629_0490516
987 Ga0495651_0063456
988 Ga0495651_0465009
989 Ga0495651_0486219
990 Ga0495653_0089080
991 Ga0495653_0136089
992 Ga0495580_0016912
993 Ga0495582_0255394
994 Ga0495639_0724914
995 Ga0495664_0001420
996 Ga0495594_0450193
997 Ga0495608_0566745
998 Ga0495608_0595241
999 Ga0495618_0478170
1000 Ga0495620_0001128
1001 Ga0495628_0967265
1002 Ga0495630_0037095
1003 Ga0495630_0771029
1004 Ga0495637_0001266
1005 Ga0495652_0624741
1006 Ga0495654_0000004
1007 Ga0495665_0568818
1008 Ga0495640_0106502
1009 Ga0495640_0249561
1010 Ga0495587_0010476
1011 Ga0495621_0487030
1012 Ga0495645_0000124
1013 Ga0495667_0002329
1014 Ga0495625_0100534
1015 Ga0495635_0030359
1016 Ga0495635_0579135
1017 Ga0495657_0002597
1018 Ga0495599_0019180
1019 Ga0495623_0536347
1020 Ga0495646_0049188
1021 Ga0495646_0609133
1022 Ga0495647_0028231
1023 Ga0495658_0304874
1024 Ga0495669_0174167
1025 Ga0495669_0219688
1026 Ga0495600_0200897
1027 Ga0495660_0076380
1028 Ga0495604_0119944
1029 Ga0495636_0280708
1030 Ga0495636_0493140
1031 Ga0495674_0016579
1032 Ga0495674_0017271
1033 Ga0495674_0931562
1034 Ga0495672_0011675
1035 Ga0495680_0065095
1036 Ga0495675_0009774
1037 Ga0495684_0161119
1038 Ga0495684_1085970
1039 Ga0495686_0505787
1040 Ga0495602_0000404
1041 Ga0495602_0561991
1042 Ga0495615_0147838
1043 Ga0496100_0071269
1044 Ga0496100_0107139
1045 Ga0496102_0029383
1046 Ga0496102_0943791
1047 Ga0496102_1239835
1048 Ga0496103_0130081
1049 Ga0496104_0053811
1050 Ga0496104_0404018
1051 Ga0496105_0122756
1052 Ga0496105_0676470
1053 Ga0496106_0062028
1054 Ga0496106_0417192
1055 Ga0496107_0104873
1056 Ga0496108_0777157
1057 Ga0496109_0008252
1058 Ga0496109_0653520
1059 Ga0496109_1138637
1060 Ga0496110_0085340
1061 Ga0496110_0598113
1062 Ga0496111_0423797
1063 Ga0496111_0809159
1064 Ga0496112_0123832
1065 Ga0496112_0203887
1066 Ga0496112_0318893
1067 Ga0496112_1618582
1068 Ga0496113_0034764
1069 Ga0496113_1167575
1070 Ga0496115_0100478
1071 Ga0496115_0253009
1072 Ga0496124_0000282
1073 Ga0501032_1001344
1074 Ga0501033_0060170
1075 Ga0501034_0205810
1076 Ga0501034_0219629
1077 Ga0501034_0902841
1078 Ga0501037_0245020
1079 Ga0501041_0212901
1080 Ga0501043_0096446
1081 Ga0501046_0039288
1082 Ga0501072_0006969
1083 Ga0501073_0803432
1084 Ga0501074_1276484
1085 Ga0501080_0036534
1086 Ga0501080_0413360
1087 Ga0501081_1219232
1088 Ga0501083_0007473
1089 Ga0501035_0106214
1090 Ga0501035_0640747
1091 Ga0501044_0045920
1092 nmdc:mga03n38_584889_c1
1093 nmdc:mga05p37_1465437_c1
1094 nmdc:mga05p37_412126_c1
1095 nmdc:mga05p37_543_c1
1096 nmdc:mga09592_1095_c1
1097 nmdc:mga0qj67_1046_c1
1098 nmdc:mga06r32_520_c1
1099 nmdc:mga08y16_110858_c1
1100 nmdc:mga08y16_290495_c1
1101 nmdc:mga08y16_880707_c1
1102 nmdc:mga0n895_350791_c1
1103 nmdc:mga0n895_362372_c1
1104 nmdc:mga0n895_838766_c1
1105 nmdc:mga0rr50_1359302_c1
1106 nmdc:mga0rr50_845207_c1
1107 nmdc:mga08x19_310518_c1
1108 nmdc:mga08x19_36744_c1
1109 nmdc:mga0a205_179105_c1
1110 nmdc:mga0a205_345993_c1
1111 Ga0495601_0004096
1112 Ga0495601_0065820
1113 Ga0495612_0000167
1114 Ga0495595_0081573
1115 Ga0495619_0078296
1116 Ga0495619_0728552
1117 Ga0495619_0736420
1118 Ga0500646_0005947
1119 Ga0500652_153628
1120 Ga0500620_000482
1121 Ga0500627_0123027
1122 Ga0501084_0398215
1123 Ga0501082_0004240
1124 2869164063
1125 2889010279
1126 2924766262
1127 2987655369
1128 2987670813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

4

77

0.91

Map