F464147

General Info

Members Datasets Scaffolds Average Seq Length
564 363 1126 312

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100159759|Ga0068857_1001597592
Length 330
Sequence MRPSLPGLDPRAAMTTSTRKRSIPRQRQPELERDIARSPSLGYEAPETGLVRCLAHGFPSPLVRWHFHEDYELHLITETSGKAFIGDWIGPFQPGHLVLCGPRLPHNWISLDVPEGGAAGRDRVIQFRHEPIEHAAAEIPELREVMQLLERARHGIEFFGMSQQAQTHWDAIKAARGVRRLGRFLECMADLAQCTDYRLLSSVQMQGAQGIEGDAQVDQINDIVNRITSNMAESISMSDVAAELGMSESRFSRFFRRSTGNSFTDFVNRVRINSACHLLMQTDHYVTDICYQVGFNNVANFNRRFLEIKGMTPSEFRKQADTRFGGGISS

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
164 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
173 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
202 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
203 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
208 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
211 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
282 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
293 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
298 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
299 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
302 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
303 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
304 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
305 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
306 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
307 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
312 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
315 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
316 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
317 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
318 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
321 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
322 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
323 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
324 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
325 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
326 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
327 2643221658 Variovorax sp. Root411 Isolate Unclassified
328 2643221672 Variovorax sp. Root434 Isolate Unclassified
329 2643221683 Variovorax sp. Root473 Isolate Unclassified
330 2721755523 Delftia sp. HK171 Isolate Unclassified
331 2738541277 Variovorax sp. GV051 Isolate Unclassified
332 2738541307 Variovorax sp. GV008 Isolate Unclassified
333 2738543013 Variovorax sp. BT01 Isolate Unclassified
334 2738543019 Variovorax sp. GV040 Isolate Unclassified
335 2818991446 Variovorax sp. 1180 Isolate Unclassified
336 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
337 2831864461 Roseateles noduli HZ7 Isolate Nodule
338 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
339 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
340 2842677519 Variovorax sp. R-72495 Isolate Unclassified
341 2842747753 Variovorax sp. R-72060 Isolate Unclassified
342 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
343 2885198086 Variovorax sp. 679 Isolate Unclassified
344 2885211737 Variovorax sp. 553 Isolate Unclassified
345 2899924645 Variovorax sp. 369 Isolate Unclassified
346 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
347 2904456579 Variovorax sp. 2002 Isolate Unclassified
348 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
349 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
350 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
351 2928037797 Variovorax sp. 1126 Isolate Unclassified
352 2928044640 Variovorax sp. 1128 Isolate Unclassified
353 2928051484 Variovorax sp. 1133 Isolate Unclassified
354 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
355 2928070936 Variovorax gossypii 1167 Isolate Unclassified
356 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
357 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
358 2929520902 Variovorax beijingensis 502 Isolate Unclassified
359 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
360 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
361 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
362 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
363 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 0
Isolates 7.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.96
Nodule 1.24
Rhizoplane 3.37
Rhizosphere 53.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100159759 3300005577 Bacteria 2044
2 JGI24740J21852_10014995 3300001979 Bacteria 2842
3 JGI24739J22299_10013835 3300001989 Bacteria 2940
4 JGI24739J22299_10043806 3300001989 Bacteria 1477
5 JGI25154J39366_1001254 3300002738 Bacteria 9533
6 JGI25157J39369_1000199 3300002741 Bacteria 50810
7 JGI25150J39212_1001865 3300002774 Bacteria 5556
8 JGI25159J45721_1006802 3300002987 Bacteria 3364
9 JGI25159J45721_1010765 3300002987 Bacteria 2301
10 JGI25159J45721_1011127 3300002987 Bacteria 2230
11 JGI25151J46595_10002493 3300003187 Bacteria 10995
12 rootL2_10062417 3300003322 Bacteria 1555
13 Ga0055535_1000286 3300003761 Bacteria 53400
14 Ga0055542_1000080 3300003762 Bacteria 129634
15 Ga0055526_1006456 3300003771 Bacteria 6359
16 Ga0055526_1018554 3300003771 Bacteria 2590
17 Ga0055526_1020918 3300003771 Bacteria 2301
18 Ga0055537_1001147 3300003773 Bacteria 11333
19 Ga0055537_1017345 3300003773 Bacteria 1187
20 Ga0055536_1007310 3300003781 Bacteria 4967
21 Ga0055534_1001199 3300003784 Bacteria 10910
22 Ga0055534_1004097 3300003784 Bacteria 4345
23 Ga0055534_1008457 3300003784 Bacteria 2329
24 Ga0055528_1036084 3300003790 Bacteria 1187
25 Ga0055530_10003765 3300003791 Bacteria 8370
26 Ga0055540_1003315 3300003792 Bacteria 7848
27 Ga0055540_1032905 3300003792 Bacteria 1179
28 Ga0055531_10004533 3300003794 Bacteria 8426
29 Ga0055543_1001804 3300004625 Bacteria 7901
30 Ga0055543_1003991 3300004625 Bacteria 4148
31 Ga0065165_1001023 3300005262 Bacteria 33959
32 Ga0065165_1013931 3300005262 Bacteria 3154
33 Ga0065165_1023367 3300005262 Bacteria 2098
34 Ga0065707_10087081 3300005295 Bacteria 5175
35 Ga0070676_10296232 3300005328 Bacteria 1095
36 Ga0070683_100202003 3300005329 Bacteria 1887
37 Ga0070683_100311895 3300005329 Bacteria 1497
38 Ga0070690_100024000 3300005330 Bacteria 3747
39 Ga0068869_100297623 3300005334 Bacteria 1302
40 Ga0068868_100322084 3300005338 Bacteria 1317
41 Ga0070660_100025146 3300005339 Bacteria 4424
42 Ga0070661_100129704 3300005344 Bacteria 1893
43 Ga0070675_100133034 3300005354 Bacteria 2121
44 Ga0070674_100122233 3300005356 Bacteria 1929
45 Ga0070674_100264122 3300005356 Bacteria 1357
46 Ga0070673_100093450 3300005364 Bacteria 2463
47 Ga0070659_100076497 3300005366 Bacteria 2669
48 Ga0070667_100036966 3300005367 Bacteria 4094
49 Ga0070667_100141980 3300005367 Bacteria 2104
50 Ga0070678_100025246 3300005456 Bacteria 3994
51 Ga0070662_100010608 3300005457 Bacteria 6057
52 Ga0070662_100112514 3300005457 Bacteria 2076
53 Ga0068867_100004283 3300005459 Bacteria 10043
54 Ga0070685_10115033 3300005466 Bacteria 1663
55 Ga0070706_100000388 3300005467 Bacteria 52771
56 Ga0070707_100071369 3300005468 Bacteria 3346
57 Ga0070698_100421808 3300005471 Bacteria 1269
58 Ga0070684_100404125 3300005535 Bacteria 1259
59 Ga0070665_100016667 3300005548 Bacteria 7363
60 Ga0070665_100155233 3300005548 Bacteria 2291
61 Ga0068855_100019384 3300005563 Bacteria 8173
62 Ga0068855_100391845 3300005563 Bacteria 1523
63 Ga0070664_100003941 3300005564 Bacteria 11968
64 Ga0070664_100047752 3300005564 Bacteria 3617
65 Ga0070664_100443559 3300005564 Bacteria 1191
66 Ga0068857_100000643 3300005577 Bacteria 25778
67 Ga0068854_100018408 3300005578 Bacteria 4688
68 Ga0068856_100011642 3300005614 Bacteria 8532
69 Ga0068852_100026629 3300005616 Bacteria 4704
70 Ga0068852_100031429 3300005616 Bacteria 4381
71 Ga0068859_100039119 3300005617 Bacteria 4757
72 Ga0068859_100264579 3300005617 Bacteria 1811
73 Ga0068859_100796317 3300005617 Bacteria 1033
74 Ga0068866_10039101 3300005718 Bacteria 2341
75 Ga0068861_100003803 3300005719 Bacteria 10080
76 Ga0068861_100020935 3300005719 Bacteria 4694
77 Ga0068851_10008974 3300005834 Bacteria 4638
78 Ga0068870_10208328 3300005840 Bacteria 1189
79 Ga0068863_100329760 3300005841 Bacteria 1484
80 Ga0068863_100368200 3300005841 Bacteria 1402
81 Ga0068860_100019424 3300005843 Bacteria 6590
82 Ga0068860_100201055 3300005843 Bacteria 1931
83 Ga0068860_100625975 3300005843 Bacteria 1083
84 Ga0068862_100027196 3300005844 Bacteria 4814
85 Ga0068862_100050422 3300005844 Bacteria 3557
86 Ga0068862_100061092 3300005844 Bacteria 3239
87 Ga0075365_10014301 3300006038 Bacteria 4772
88 Ga0075368_10074386 3300006042 Bacteria 1376
89 Ga0075368_10086232 3300006042 Bacteria 1281
90 Ga0075363_100015241 3300006048 Bacteria 3775
91 Ga0075363_100021061 3300006048 Bacteria 3278
92 Ga0075364_10034294 3300006051 Bacteria 3273
93 Ga0075362_10024734 3300006177 Bacteria 2550
94 Ga0075362_10029390 3300006177 Bacteria 2368
95 Ga0075362_10035780 3300006177 Bacteria 2169
96 Ga0075367_10018219 3300006178 Bacteria 3870
97 Ga0075367_10045095 3300006178 Bacteria 2587
98 Ga0075367_10059629 3300006178 Bacteria 2273
99 Ga0075366_10002902 3300006195 Bacteria 8904
100 Ga0075366_10004500 3300006195 Bacteria 7478
101 Ga0075366_10005751 3300006195 Bacteria 6732
102 Ga0075366_10013970 3300006195 Bacteria 4580
103 Ga0075366_10020940 3300006195 Bacteria 3799
104 Ga0075366_10025007 3300006195 Bacteria 3485
105 Ga0075366_10026682 3300006195 Bacteria 3384
106 Ga0075370_10000635 3300006353 Bacteria 13598
107 Ga0075370_10003110 3300006353 Bacteria 7834
108 Ga0075370_10004190 3300006353 Bacteria 6962
109 Ga0075370_10023580 3300006353 Bacteria 3390
110 Ga0075370_10030426 3300006353 Bacteria 3012
111 Ga0075370_10036768 3300006353 Bacteria 2751
112 Ga0075370_10049246 3300006353 Bacteria 2388
113 Ga0075370_10100417 3300006353 Bacteria 1674
114 Ga0075370_10190108 3300006353 Bacteria 1210
115 Ga0068865_100012454 3300006881 Bacteria 5353
116 Ga0068865_100134829 3300006881 Bacteria 1854
117 Ga0097620_100039122 3300006931 Bacteria 4757
118 Ga0097620_100264589 3300006931 Bacteria 1811
119 Ga0097620_100796298 3300006931 Bacteria 1033
120 Ga0079104_1000016 3300006946 Bacteria 313865
121 Ga0079104_1013872 3300006946 Bacteria 2462
122 Ga0099826_10000498 3300006948 Bacteria 19180
123 Ga0105244_10013907 3300009036 Bacteria 4675
124 Ga0105250_10001094 3300009092 Bacteria 15299
125 Ga0105240_10076158 3300009093 Bacteria 4137
126 Ga0105240_10308219 3300009093 Bacteria 1809
127 Ga0105245_10098769 3300009098 Bacteria 2698
128 Ga0105245_10136482 3300009098 Bacteria 2306
129 Ga0105245_10227316 3300009098 Bacteria 1803
130 Ga0105245_10592584 3300009098 Bacteria 1134
131 Ga0114129_10025979 3300009147 Bacteria 8293
132 Ga0105243_10005637 3300009148 Bacteria 9747
133 Ga0105243_10007314 3300009148 Bacteria 8491
134 Ga0105243_10097271 3300009148 Bacteria 2436
135 Ga0105243_10128360 3300009148 Bacteria 2148
136 Ga0105242_10047066 3300009176 Bacteria 3501
137 Ga0105242_10235149 3300009176 Bacteria 1644
138 Ga0105237_10037619 3300009545 Bacteria 4889
139 Ga0105237_10048563 3300009545 Bacteria 4266
140 Ga0105237_10313130 3300009545 Bacteria 1573
141 Ga0105238_10120658 3300009551 Bacteria 2601
142 Ga0105249_10337813 3300009553 Bacteria 1522
143 Ga0105239_10013427 3300010375 Bacteria 9100
144 Ga0105239_10171788 3300010375 Bacteria 2424
145 Ga0105239_10176307 3300010375 Bacteria 2391
146 Ga0157373_10099715 3300013100 Bacteria 2044
147 Ga0157371_10029559 3300013102 Bacteria 3961
148 Ga0157370_10029709 3300013104 Bacteria 5360
149 Ga0157370_10304179 3300013104 Bacteria 1472
150 Ga0157369_10080034 3300013105 Bacteria 3499
151 Ga0157369_10102395 3300013105 Bacteria 3052
152 Ga0157378_10015862 3300013297 Bacteria 6597
153 Ga0157378_10146509 3300013297 Bacteria 2197
154 Ga0163162_10721334 3300013306 Bacteria 1118
155 Ga0157372_10172260 3300013307 Bacteria 2504
156 Ga0157372_10230769 3300013307 Bacteria 2146
157 Ga0157375_10014275 3300013308 Bacteria 7081
158 Ga0157375_10126005 3300013308 Bacteria 2676
159 Ga0157375_10382629 3300013308 Bacteria 1574
160 Ga0157375_10524596 3300013308 Bacteria 1347
161 Ga0182008_10001323 3300014497 Bacteria 16876
162 Ga0182008_10001893 3300014497 Bacteria 13569
163 Ga0182008_10039147 3300014497 Bacteria 2370
164 Ga0182008_10083166 3300014497 Bacteria 1576
165 Ga0157379_10199818 3300014968 Bacteria 1808
166 Ga0182006_1012165 3300015261 Bacteria 3769
167 Ga0182007_10008063 3300015262 Bacteria 4351
168 Ga0183362_10001 3300015683 Bacteria 2046624
169 Ga0163161_10005510 3300017792 Bacteria 8773
170 Ga0163161_10045327 3300017792 Bacteria 3171
171 Ga0163161_10046136 3300017792 Bacteria 3143
172 Ga0213872_10085291 3300021361 Bacteria 1416
173 Ga0213876_10178945 3300021384 Bacteria 1128
174 Ga0209436_114702 3300025208 Bacteria 1237
175 Ga0209674_100064 3300025226 Bacteria 265769
176 Ga0209672_101674 3300025228 Bacteria 7189
177 Ga0209147_100450 3300025229 Bacteria 25862
178 Ga0209563_100099 3300025230 Bacteria 153336
179 Ga0207427_100844 3300025231 Bacteria 13690
180 Ga0209258_100093 3300025242 Bacteria 223559
181 Ga0209258_100453 3300025242 Bacteria 45277
182 Ga0209258_100808 3300025242 Bacteria 18236
183 Ga0207425_1000715 3300025245 Bacteria 17861
184 Ga0209646_1000060 3300025246 Bacteria 256386
185 Ga0209026_1000049 3300025250 Bacteria 255273
186 Ga0209677_100954 3300025253 Bacteria 14070
187 Ga0209677_102445 3300025253 Bacteria 6985
188 Ga0209677_104629 3300025253 Bacteria 3886
189 Ga0209148_1000007 3300025254 Bacteria 1592273
190 Ga0209148_1007934 3300025254 Bacteria 2166
191 Ga0209759_1000272 3300025256 Bacteria 73495
192 Ga0209129_1000024 3300025258 Bacteria 417268
193 Ga0209129_1005353 3300025258 Bacteria 4578
194 Ga0209565_1000098 3300025263 Bacteria 132021
195 Ga0209565_1000583 3300025263 Bacteria 24687
196 Ga0209565_1001746 3300025263 Bacteria 8869
197 Ga0209455_1000157 3300025272 Bacteria 119719
198 Ga0209673_1000058 3300025273 Bacteria 269028
199 Ga0209673_1002614 3300025273 Bacteria 12098
200 Ga0209673_1002934 3300025273 Bacteria 10732
201 Ga0209673_1020420 3300025273 Bacteria 2346
202 Ga0209130_1000757 3300025284 Bacteria 28010
203 Ga0209130_1002913 3300025284 Bacteria 7846
204 Ga0209130_1007852 3300025284 Bacteria 3231
205 Ga0209675_1000010 3300025291 Bacteria 541927
206 Ga0209675_1006671 3300025291 Bacteria 4582
207 Ga0209675_1008554 3300025291 Bacteria 3741
208 Ga0209675_1008940 3300025291 Bacteria 3601
209 Ga0209676_1000028 3300025292 Bacteria 559745
210 Ga0209676_1000317 3300025292 Bacteria 94105
211 Ga0209676_1000367 3300025292 Bacteria 84271
212 Ga0209676_1003347 3300025292 Bacteria 9998
213 Ga0209676_1020966 3300025292 Bacteria 2204
214 Ga0209025_1000194 3300025294 Bacteria 148593
215 Ga0209025_1001452 3300025294 Bacteria 31103
216 Ga0209025_1001526 3300025294 Bacteria 29626
217 Ga0209025_1010030 3300025294 Bacteria 6486
218 Ga0209025_1015699 3300025294 Bacteria 4540
219 Ga0209025_1019317 3300025294 Bacteria 3794
220 Ga0209564_1000008 3300025295 Bacteria 953227
221 Ga0209564_1000344 3300025295 Bacteria 88136
222 Ga0209564_1001028 3300025295 Bacteria 34353
223 Ga0209758_1000510 3300025297 Bacteria 62591
224 Ga0209758_1012342 3300025297 Bacteria 4793
225 Ga0209050_1000072 3300025298 Bacteria 293619
226 Ga0209050_1000786 3300025298 Bacteria 45131
227 Ga0209050_1006264 3300025298 Bacteria 7124
228 Ga0209256_1000151 3300025299 Bacteria 145299
229 Ga0209256_1000256 3300025299 Bacteria 94699
230 Ga0207426_1000049 3300025302 Bacteria 401954
231 Ga0207426_1000315 3300025302 Bacteria 94699
232 Ga0209051_1000015 3300025303 Bacteria 546798
233 Ga0209051_1000056 3300025303 Bacteria 271616
234 Ga0209051_1000894 3300025303 Bacteria 29840
235 Ga0209051_1001079 3300025303 Bacteria 25303
236 Ga0209051_1001096 3300025303 Bacteria 24968
237 Ga0209257_1000037 3300025304 Bacteria 612915
238 Ga0209257_1004421 3300025304 Bacteria 10909
239 Ga0209257_1004591 3300025304 Bacteria 10527
240 Ga0209257_1011962 3300025304 Bacteria 4087
241 Ga0207656_10001300 3300025321 Bacteria 8211
242 Ga0207696_1016135 3300025711 Bacteria 2507
243 Ga0207655_1003837 3300025728 Bacteria 10952
244 Ga0207645_10238765 3300025907 Bacteria 1200
245 Ga0207643_10181400 3300025908 Bacteria 1274
246 Ga0207705_10144464 3300025909 Bacteria 1779
247 Ga0207684_10006285 3300025910 Bacteria 10836
248 Ga0207654_10100393 3300025911 Bacteria 1782
249 Ga0207695_10073418 3300025913 Bacteria 3486
250 Ga0207695_10085364 3300025913 Bacteria 3186
251 Ga0207695_10238069 3300025913 Bacteria 1722
252 Ga0207671_10030763 3300025914 Bacteria 4001
253 Ga0207671_10102589 3300025914 Bacteria 2168
254 Ga0207649_10199262 3300025920 Bacteria 1413
255 Ga0207646_10044087 3300025922 Bacteria 4004
256 Ga0207687_10058118 3300025927 Bacteria 2720
257 Ga0207687_10144215 3300025927 Bacteria 1810
258 Ga0207687_10386795 3300025927 Bacteria 1147
259 Ga0207644_10137219 3300025931 Bacteria 1880
260 Ga0207690_10016847 3300025932 Bacteria 4453
261 Ga0207706_10006170 3300025933 Bacteria 11129
262 Ga0207686_10047616 3300025934 Bacteria 2651
263 Ga0207686_10118135 3300025934 Bacteria 1800
264 Ga0207709_10000117 3300025935 Bacteria 122667
265 Ga0207709_10000587 3300025935 Bacteria 30442
266 Ga0207709_10019655 3300025935 Bacteria 3801
267 Ga0207669_10101506 3300025937 Bacteria 1903
268 Ga0207669_10296435 3300025937 Bacteria 1227
269 Ga0207704_10032479 3300025938 Bacteria 2955
270 Ga0207691_10051737 3300025940 Bacteria 3754
271 Ga0207711_10264924 3300025941 Bacteria 1580
272 Ga0207689_10051455 3300025942 Bacteria 3396
273 Ga0207689_10094734 3300025942 Bacteria 2452
274 Ga0207689_10183674 3300025942 Bacteria 1725
275 Ga0207689_10325431 3300025942 Bacteria 1276
276 Ga0207661_10175879 3300025944 Bacteria 1866
277 Ga0207679_10154489 3300025945 Bacteria 1872
278 Ga0207679_10267782 3300025945 Bacteria 1460
279 Ga0207667_10104617 3300025949 Bacteria 2920
280 Ga0207667_10163905 3300025949 Bacteria 2286
281 Ga0207667_10527990 3300025949 Bacteria 1195
282 Ga0207651_10095847 3300025960 Bacteria 2186
283 Ga0207712_10466021 3300025961 Bacteria 1074
284 Ga0207658_10049045 3300025986 Bacteria 3100
285 Ga0207658_10214692 3300025986 Bacteria 1615
286 Ga0207677_10052699 3300026023 Bacteria 2765
287 Ga0207677_10203707 3300026023 Bacteria 1575
288 Ga0207677_10353751 3300026023 Bacteria 1232
289 Ga0207703_10450961 3300026035 Bacteria 1201
290 Ga0207639_10028052 3300026041 Bacteria 4106
291 Ga0207639_10073052 3300026041 Bacteria 2688
292 Ga0207678_10020544 3300026067 Bacteria 5789
293 Ga0207678_10225758 3300026067 Bacteria 1603
294 Ga0207702_10003218 3300026078 Bacteria 15082
295 Ga0207648_10008269 3300026089 Bacteria 10104
296 Ga0207648_10028772 3300026089 Bacteria 4926
297 Ga0207648_10119908 3300026089 Bacteria 2313
298 Ga0207674_10001652 3300026116 Bacteria 28693
299 Ga0207674_10113483 3300026116 Bacteria 2683
300 Ga0207675_100009803 3300026118 Bacteria 8966
301 Ga0207675_100080204 3300026118 Bacteria 3060
302 Ga0207683_10050234 3300026121 Bacteria 3652
303 Ga0207683_10088143 3300026121 Bacteria 2761
304 Ga0207698_10035164 3300026142 Bacteria 3662
305 Ga0207698_10565782 3300026142 Bacteria 1116
306 Ga0209281_1000017 3300027111 Bacteria 583251
307 Ga0209970_1000287 3300027614 Bacteria 8341
308 Ga0209282_1020331 3300027666 Bacteria 4206
309 Ga0268266_10062898 3300028379 Bacteria 3204
310 Ga0268265_10026776 3300028380 Bacteria 4105
311 Ga0268264_10372947 3300028381 Bacteria 1364
312 Ga0268264_10388760 3300028381 Bacteria 1338
313 Ga0265336_10000040 3300028666 Bacteria 138266
314 Ga0307515_10000137 3300028794 Bacteria 173516
315 Ga0307515_10000221 3300028794 Bacteria 141099
316 Ga0307515_10000777 3300028794 Bacteria 73454
317 Ga0307515_10070037 3300028794 Bacteria 4781
318 Ga0307515_10108747 3300028794 Bacteria 3263
319 Ga0265324_10001932 3300029957 Bacteria 11118
320 Ga0316176_1070259 3300030732 Bacteria 1599
321 Ga0314311_1074579 3300030733 Bacteria 5783
322 Ga0265327_10000640 3300031251 Bacteria 56812
323 Ga0265327_10008506 3300031251 Bacteria 7629
324 Ga0307513_10000029 3300031456 Bacteria 191823
325 Ga0307513_10001667 3300031456 Bacteria 31752
326 Ga0307513_10071296 3300031456 Bacteria 3627
327 Ga0307513_10074508 3300031456 Bacteria 3529
328 Ga0307509_10169074 3300031507 Bacteria 2069
329 Ga0307408_100000246 3300031548 Bacteria 56179
330 Ga0307408_100009802 3300031548 Bacteria 6314
331 Ga0307508_10000141 3300031616 Bacteria 85739
332 Ga0307508_10238600 3300031616 Bacteria 1416
333 Ga0307514_10035594 3300031649 Bacteria 3962
334 Ga0307514_10200284 3300031649 Bacteria 1256
335 Ga0307516_10000155 3300031730 Bacteria 85605
336 Ga0307516_10001176 3300031730 Bacteria 36553
337 Ga0307516_10001709 3300031730 Bacteria 30164
338 Ga0307516_10004703 3300031730 Bacteria 16697
339 Ga0307405_10009141 3300031731 Bacteria 5069
340 Ga0307405_10112474 3300031731 Bacteria 1847
341 Ga0307405_10128723 3300031731 Bacteria 1745
342 Ga0307406_10001082 3300031901 Bacteria 15165
343 Ga0307406_10006015 3300031901 Bacteria 6662
344 Ga0307412_10107672 3300031911 Bacteria 1984
345 Ga0307412_10131167 3300031911 Bacteria 1820
346 Ga0307412_10155167 3300031911 Bacteria 1694
347 Ga0307412_10383535 3300031911 Bacteria 1139
348 Ga0307416_100008180 3300032002 Bacteria 6723
349 Ga0307416_100088462 3300032002 Bacteria 2648
350 Ga0307416_100376310 3300032002 Bacteria 1448
351 Ga0307507_10094543 3300033179 Bacteria 2540
352 Ga0373944_0045699 3300035089 Bacteria 1367
353 Ga0373931_0008810 3300035691 Bacteria 4800
354 Ga0373937_0044882 3300036401 Bacteria 4038
355 Ga0373925_0012106 3300037068 Bacteria 6244
356 Ga0395898_0140581 3300037466 Bacteria 2311
357 Ga0395905_0004450 3300037471 Bacteria 14564
358 Ga0395901_0010895 3300038443 Bacteria 9215
359 Ga0436365_0179555 3300039437 Bacteria 1326
360 Ga0436361_0064311 3300039447 Bacteria 6486
361 Ga0436361_0276783 3300039447 Bacteria 2279
362 Ga0436361_0691237 3300039447 Bacteria 8011
363 Ga0436361_1092231 3300039447 Bacteria 4132
364 Ga0439439_0001487 3300041406 Bacteria 4686
365 Ga0439439_0017146 3300041406 Bacteria 1778
366 Ga0451793_1648312 3300041452 Bacteria 2658
367 Ga0451802_2098710 3300041460 Bacteria 1597
368 Ga0451807_0108644 3300041486 Bacteria 1601
369 Ga0451853_3940933 3300041512 Bacteria 1038
370 Ga0439431_0016587 3300041997 Bacteria 1725
371 Ga0439431_0043738 3300041997 Bacteria 1147
372 Ga0439433_0004117 3300041999 Bacteria 3127
373 Ga0439442_001303 3300042002 Bacteria 4959
374 Ga0439445_0003027 3300042004 Bacteria 3764
375 Ga0439432_028680 3300042006 Bacteria 1812
376 Ga0439449_0000254 3300042007 Bacteria 19110
377 Ga0439449_0006594 3300042007 Bacteria 4438
378 Ga0439462_0022952 3300042015 Bacteria 1634
379 Ga0450920_026994 3300042122 Bacteria 1122
380 Ga0450906_001491 3300042145 Bacteria 5106
381 Ga0450906_005561 3300042145 Bacteria 2584
382 Ga0439434_0005516 3300042435 Bacteria 3696
383 Ga0439434_0009062 3300042435 Bacteria 2925
384 Ga0450918_010010 3300042531 Bacteria 1656
385 Ga0450893_0002594 3300042532 Bacteria 2826
386 Ga0466969_0004140 3300044656 Bacteria 7700
387 Ga0466972_0001854 3300044658 Bacteria 10359
388 Ga0466972_0079632 3300044658 Bacteria 1560
389 Ga0453683_0001704 3300044673 Bacteria 18282
390 Ga0466965_0024200 3300044683 Bacteria 2935
391 Ga0466966_0083702 3300044684 Bacteria 1984
392 Ga0466961_0038822 3300044693 Bacteria 3053
393 Ga0466964_0005324 3300044706 Bacteria 4777
394 Ga0453684_0384314 3300044712 Bacteria 1576
395 Ga0466971_0038951 3300044719 Bacteria 2133
396 Ga0466968_0048165 3300044735 Bacteria 1813
397 Ga0466970_0022480 3300044765 Bacteria 3291
398 Ga0466957_0037756 3300044842 Bacteria 2908
399 Ga0466960_0034753 3300044901 Bacteria 2352
400 Ga0466959_0009180 3300045049 Bacteria 7023
401 Ga0451576_0005405 3300045051 Bacteria 16037
402 Ga0466958_0008426 3300045836 Bacteria 5717
403 Ga0495627_015346 3300046453 Bacteria 2646
404 Ga0495592_0297626 3300046454 Bacteria 1050
405 Ga0495629_0084603 3300046459 Bacteria 2213
406 Ga0495638_0027538 3300046460 Bacteria 3678
407 Ga0495651_0149998 3300046462 Bacteria 1682
408 Ga0495650_0063482 3300046471 Bacteria 1472
409 Ga0495580_0082501 3300046472 Bacteria 2241
410 Ga0495639_0010835 3300046475 Bacteria 3927
411 Ga0495585_0069617 3300046492 Bacteria 1920
412 Ga0495606_0008149 3300046507 Bacteria 9177
413 Ga0495608_0099213 3300046511 Bacteria 1879
414 Ga0495616_0003991 3300046513 Bacteria 9382
415 Ga0495620_0003885 3300046515 Bacteria 8525
416 Ga0495628_0235432 3300046516 Bacteria 1371
417 Ga0495628_0356895 3300046516 Bacteria 1074
418 Ga0495631_0003913 3300046518 Bacteria 8043
419 Ga0495632_0039077 3300046519 Bacteria 2398
420 Ga0495637_0011511 3300046520 Bacteria 4247
421 Ga0495642_0047257 3300046528 Bacteria 1762
422 Ga0495652_0258746 3300046529 Bacteria 1286
423 Ga0495654_0029206 3300046530 Bacteria 2812
424 Ga0495586_0119700 3300046535 Bacteria 1470
425 Ga0495621_0013009 3300046539 Bacteria 2608
426 Ga0495656_0000114 3300046615 Bacteria 31389
427 Ga0495668_0033715 3300046616 Bacteria 2875
428 Ga0495625_0000294 3300046660 Bacteria 77321
429 Ga0495625_0008695 3300046660 Bacteria 8621
430 Ga0495588_0024588 3300046674 Bacteria 2993
431 Ga0495588_0077703 3300046674 Bacteria 1731
432 Ga0495647_0005004 3300046681 Bacteria 4339
433 Ga0495649_0000270 3300046694 Bacteria 46170
434 Ga0495589_0026302 3300046794 Bacteria 2949
435 Ga0495660_0037101 3300046810 Bacteria 2716
436 Ga0495676_0020316 3300047321 Bacteria 5830
437 Ga0495681_0040685 3300047470 Bacteria 2262
438 Ga0495593_0009903 3300047673 Bacteria 5527
439 Ga0496100_0029685 3300048903 Bacteria 3384
440 Ga0496101_0003936 3300048904 Bacteria 9282
441 Ga0496101_0257882 3300048904 Bacteria 1359
442 Ga0496102_0007549 3300048905 Bacteria 9296
443 Ga0496102_0021838 3300048905 Bacteria 5665
444 Ga0496104_0001619 3300048907 Bacteria 19424
445 Ga0496105_0003397 3300048908 Bacteria 11774
446 Ga0496107_0035127 3300048910 Bacteria 3594
447 Ga0496108_0065778 3300048911 Bacteria 3056
448 Ga0496109_0136456 3300048912 Bacteria 2292
449 Ga0496111_0071375 3300048914 Bacteria 2527
450 Ga0496112_0376116 3300048915 Bacteria 1362
451 Ga0496114_0094860 3300048917 Bacteria 2538
452 Ga0496116_0023802 3300048919 Bacteria 4551
453 Ga0496116_0144007 3300048919 Bacteria 1335
454 Ga0496117_0010951 3300048920 Bacteria 8173
455 Ga0496118_0017904 3300048921 Bacteria 6426
456 Ga0496118_0058254 3300048921 Bacteria 2888
457 Ga0496119_0012317 3300048922 Bacteria 6962
458 Ga0496122_0083672 3300048925 Bacteria 2211
459 Ga0496123_0014852 3300048926 Bacteria 6427
460 Ga0496124_0093603 3300048927 Bacteria 2445
461 Ga0496125_0052493 3300048928 Bacteria 3352
462 Ga0496125_0079343 3300048928 Bacteria 2519
463 Ga0496125_0108402 3300048928 Bacteria 2020
464 Ga0496126_0060332 3300048929 Bacteria 3412
465 Ga0501262_000138 3300049759 Bacteria 9065
466 Ga0501265_004384 3300049762 Bacteria 1606
467 nmdc:mga03n38_80013_c1 3300050490 Bacteria 1534
468 nmdc:mga00v17_64072_c1 3300050491 Bacteria 2265
469 nmdc:mga0yw44_245496_c1 3300050492 Bacteria 1191
470 nmdc:mga0k408_12512_c1 3300050493 Bacteria 4639
471 nmdc:mga0k408_19510_c1 3300050493 Bacteria 3790
472 nmdc:mga0k408_250046_c1 3300050493 Bacteria 1059
473 nmdc:mga0k408_32098_c1 3300050493 Bacteria 3000
474 nmdc:mga0k408_66920_c1 3300050493 Bacteria 2093
475 nmdc:mga06z11_83836_c1 3300050494 Bacteria 1716
476 nmdc:mga06z11_8825_c1 3300050494 Bacteria 4222
477 nmdc:mga07m45_125706_c1 3300050496 Bacteria 1483
478 nmdc:mga07m45_141133_c1 3300050496 Bacteria 1395
479 nmdc:mga07m45_210645_c1 3300050496 Bacteria 1131
480 nmdc:mga07m45_37567_c1 3300050496 Bacteria 2701
481 nmdc:mga07m45_47327_c1 3300050496 Bacteria 2418
482 nmdc:mga07m45_5751_c1 3300050496 Bacteria 6205
483 nmdc:mga07m45_966_c2 3300050496 Bacteria 8224
484 nmdc:mga05p37_42453_c1 3300050507 Bacteria 5587
485 nmdc:mga0sz30_112190_c1 3300050516 Bacteria 1195
486 Ga0495601_0111487 3300053077 Bacteria 1772
487 Ga0500610_0072486 3300053079 Bacteria 1796
488 Ga0500635_0000243 3300053080 Bacteria 23803
489 Ga0500643_017857 3300053087 Bacteria 2365
490 Ga0500644_0003211 3300053088 Bacteria 4045
491 Ga0500651_0000057 3300053093 Bacteria 72615
492 Ga0500566_0099850 3300053094 Bacteria 1593
493 Ga0500650_0019041 3300053098 Bacteria 2989
494 Ga0500555_038217 3300053103 Bacteria 1343
495 Ga0500562_028761 3300053108 Bacteria 1461
496 Ga0500571_000038 3300053110 Bacteria 41284
497 Ga0500593_000984 3300053117 Bacteria 10398
498 Ga0500593_006723 3300053117 Bacteria 4618
499 Ga0500594_0000390 3300053118 Bacteria 9816
500 Ga0500607_005933 3300053121 Bacteria 7854
501 Ga0500607_039435 3300053121 Bacteria 2564
502 Ga0500608_016963 3300053122 Bacteria 3300
503 Ga0500628_001932 3300053129 Bacteria 3485
504 Ga0500655_001260 3300053133 Bacteria 4809
505 Ga0500658_0000408 3300053134 Bacteria 18668
506 Ga0500658_0001506 3300053134 Bacteria 9333
507 Ga0500658_0015246 3300053134 Bacteria 2851
508 Ga0500559_0006861 3300053136 Bacteria 5103
509 Ga0500568_0007904 3300053139 Bacteria 5176
510 Ga0500574_038913 3300053141 Bacteria 1318
511 Ga0500586_044798 3300053145 Bacteria 1512
512 Ga0500616_0011515 3300053153 Bacteria 5216
513 Ga0500616_0032745 3300053153 Bacteria 2840
514 Ga0500627_0002652 3300053158 Bacteria 5358
515 Ga0500634_0027640 3300053161 Bacteria 3091
516 Ga0500638_003779 3300053162 Bacteria 5694
517 Ga0500625_038758 3300053729 Bacteria 2249
518 Ga0500661_002140 3300055283 Bacteria 3727
519 Ga0466962_0031832 3300061719 Bacteria 2525
520 2513230030 2513020051 Bacteria 6053213
521 2587754344 2585428062 Bacteria 6842168
522 2599620677 2599185214 Bacteria 8209958
523 2599673976 2599185226 Bacteria 8233575
524 2599678707 2599185227 Bacteria 8246414
525 2599690188 2599185229 Bacteria 8216126
526 2644161511 2643221628 Bacteria 5745828
527 2644324235 2643221658 Bacteria 6064537
528 2644399467 2643221672 Bacteria 6322190
529 2644465037 2643221683 Bacteria 5749203
530 2722881879 2721755523 Bacteria 6430384
531 2738720525 2738541277 Bacteria 7458140
532 2738884099 2738541307 Bacteria 8606193
533 2739250197 2738543013 Bacteria 5618633
534 2739279724 2738543019 Bacteria 7459457
535 2819601204 2818991446 Bacteria 7757362
536 2831271475 2831265667 Bacteria 7184833
537 2831869180 2831864461 Bacteria 6502356
538 2838055379 2838054893 Bacteria 7451788
539 2839144825 2839138175 Bacteria 6549354
540 2842680535 2842677519 Bacteria 5615038
541 2842751914 2842747753 Bacteria 5578255
542 2885192398 2885192300 Bacteria 5882526
543 2885201546 2885198086 Bacteria 7212419
544 2885215743 2885211737 Bacteria 7212420
545 2899927449 2899924645 Bacteria 7487985
546 2904450824 2904449895 Bacteria 6927402
547 2904459673 2904456579 Bacteria 6819253
548 2904548071 2904541872 Bacteria 8915136
549 2919462650 2919462493 Bacteria 5817112
550 2919705269 2919704043 Bacteria 5560311
551 2928042639 2928037797 Bacteria 7273642
552 2928048934 2928044640 Bacteria 7271509
553 2928055268 2928051484 Bacteria 7773759
554 2928068696 2928064002 Bacteria 7419480
555 2928073393 2928070936 Bacteria 8062541
556 2928090051 2928084124 Bacteria 7159212
557 2929161534 2929160207 Bacteria 9075316
558 2929521772 2929520902 Bacteria 6765052
559 2932423907 2932422444 Bacteria 4678430
560 2945913998 2945909444 Bacteria 7065066
561 2945973600 2945972063 Bacteria 6086495
562 2945990607 2945984333 Bacteria 7358892
563 2954770785 2954767861 Bacteria 5535784
564 Ga0068857_100159759
565 JGI24740J21852_10014995
566 JGI24739J22299_10013835
567 JGI24739J22299_10043806
568 JGI25154J39366_1001254
569 JGI25157J39369_1000199
570 JGI25150J39212_1001865
571 JGI25159J45721_1006802
572 JGI25159J45721_1010765
573 JGI25159J45721_1011127
574 JGI25151J46595_10002493
575 rootL2_10062417
576 Ga0055535_1000286
577 Ga0055542_1000080
578 Ga0055526_1006456
579 Ga0055526_1018554
580 Ga0055526_1020918
581 Ga0055537_1001147
582 Ga0055537_1017345
583 Ga0055536_1007310
584 Ga0055534_1001199
585 Ga0055534_1004097
586 Ga0055534_1008457
587 Ga0055528_1036084
588 Ga0055530_10003765
589 Ga0055540_1003315
590 Ga0055540_1032905
591 Ga0055531_10004533
592 Ga0055543_1001804
593 Ga0055543_1003991
594 Ga0065165_1001023
595 Ga0065165_1013931
596 Ga0065165_1023367
597 Ga0065707_10087081
598 Ga0070676_10296232
599 Ga0070683_100202003
600 Ga0070683_100311895
601 Ga0070690_100024000
602 Ga0068869_100297623
603 Ga0068868_100322084
604 Ga0070660_100025146
605 Ga0070661_100129704
606 Ga0070675_100133034
607 Ga0070674_100122233
608 Ga0070674_100264122
609 Ga0070673_100093450
610 Ga0070659_100076497
611 Ga0070667_100036966
612 Ga0070667_100141980
613 Ga0070678_100025246
614 Ga0070662_100010608
615 Ga0070662_100112514
616 Ga0068867_100004283
617 Ga0070685_10115033
618 Ga0070706_100000388
619 Ga0070707_100071369
620 Ga0070698_100421808
621 Ga0070684_100404125
622 Ga0070665_100016667
623 Ga0070665_100155233
624 Ga0068855_100019384
625 Ga0068855_100391845
626 Ga0070664_100003941
627 Ga0070664_100047752
628 Ga0070664_100443559
629 Ga0068857_100000643
630 Ga0068854_100018408
631 Ga0068856_100011642
632 Ga0068852_100026629
633 Ga0068852_100031429
634 Ga0068859_100039119
635 Ga0068859_100264579
636 Ga0068859_100796317
637 Ga0068866_10039101
638 Ga0068861_100003803
639 Ga0068861_100020935
640 Ga0068851_10008974
641 Ga0068870_10208328
642 Ga0068863_100329760
643 Ga0068863_100368200
644 Ga0068860_100019424
645 Ga0068860_100201055
646 Ga0068860_100625975
647 Ga0068862_100027196
648 Ga0068862_100050422
649 Ga0068862_100061092
650 Ga0075365_10014301
651 Ga0075368_10074386
652 Ga0075368_10086232
653 Ga0075363_100015241
654 Ga0075363_100021061
655 Ga0075364_10034294
656 Ga0075362_10024734
657 Ga0075362_10029390
658 Ga0075362_10035780
659 Ga0075367_10018219
660 Ga0075367_10045095
661 Ga0075367_10059629
662 Ga0075366_10002902
663 Ga0075366_10004500
664 Ga0075366_10005751
665 Ga0075366_10013970
666 Ga0075366_10020940
667 Ga0075366_10025007
668 Ga0075366_10026682
669 Ga0075370_10000635
670 Ga0075370_10003110
671 Ga0075370_10004190
672 Ga0075370_10023580
673 Ga0075370_10030426
674 Ga0075370_10036768
675 Ga0075370_10049246
676 Ga0075370_10100417
677 Ga0075370_10190108
678 Ga0068865_100012454
679 Ga0068865_100134829
680 Ga0097620_100039122
681 Ga0097620_100264589
682 Ga0097620_100796298
683 Ga0079104_1000016
684 Ga0079104_1013872
685 Ga0099826_10000498
686 Ga0105244_10013907
687 Ga0105250_10001094
688 Ga0105240_10076158
689 Ga0105240_10308219
690 Ga0105245_10098769
691 Ga0105245_10136482
692 Ga0105245_10227316
693 Ga0105245_10592584
694 Ga0114129_10025979
695 Ga0105243_10005637
696 Ga0105243_10007314
697 Ga0105243_10097271
698 Ga0105243_10128360
699 Ga0105242_10047066
700 Ga0105242_10235149
701 Ga0105237_10037619
702 Ga0105237_10048563
703 Ga0105237_10313130
704 Ga0105238_10120658
705 Ga0105249_10337813
706 Ga0105239_10013427
707 Ga0105239_10171788
708 Ga0105239_10176307
709 Ga0157373_10099715
710 Ga0157371_10029559
711 Ga0157370_10029709
712 Ga0157370_10304179
713 Ga0157369_10080034
714 Ga0157369_10102395
715 Ga0157378_10015862
716 Ga0157378_10146509
717 Ga0163162_10721334
718 Ga0157372_10172260
719 Ga0157372_10230769
720 Ga0157375_10014275
721 Ga0157375_10126005
722 Ga0157375_10382629
723 Ga0157375_10524596
724 Ga0182008_10001323
725 Ga0182008_10001893
726 Ga0182008_10039147
727 Ga0182008_10083166
728 Ga0157379_10199818
729 Ga0182006_1012165
730 Ga0182007_10008063
731 Ga0183362_10001
732 Ga0163161_10005510
733 Ga0163161_10045327
734 Ga0163161_10046136
735 Ga0213872_10085291
736 Ga0213876_10178945
737 Ga0209436_114702
738 Ga0209674_100064
739 Ga0209672_101674
740 Ga0209147_100450
741 Ga0209563_100099
742 Ga0207427_100844
743 Ga0209258_100093
744 Ga0209258_100453
745 Ga0209258_100808
746 Ga0207425_1000715
747 Ga0209646_1000060
748 Ga0209026_1000049
749 Ga0209677_100954
750 Ga0209677_102445
751 Ga0209677_104629
752 Ga0209148_1000007
753 Ga0209148_1007934
754 Ga0209759_1000272
755 Ga0209129_1000024
756 Ga0209129_1005353
757 Ga0209565_1000098
758 Ga0209565_1000583
759 Ga0209565_1001746
760 Ga0209455_1000157
761 Ga0209673_1000058
762 Ga0209673_1002614
763 Ga0209673_1002934
764 Ga0209673_1020420
765 Ga0209130_1000757
766 Ga0209130_1002913
767 Ga0209130_1007852
768 Ga0209675_1000010
769 Ga0209675_1006671
770 Ga0209675_1008554
771 Ga0209675_1008940
772 Ga0209676_1000028
773 Ga0209676_1000317
774 Ga0209676_1000367
775 Ga0209676_1003347
776 Ga0209676_1020966
777 Ga0209025_1000194
778 Ga0209025_1001452
779 Ga0209025_1001526
780 Ga0209025_1010030
781 Ga0209025_1015699
782 Ga0209025_1019317
783 Ga0209564_1000008
784 Ga0209564_1000344
785 Ga0209564_1001028
786 Ga0209758_1000510
787 Ga0209758_1012342
788 Ga0209050_1000072
789 Ga0209050_1000786
790 Ga0209050_1006264
791 Ga0209256_1000151
792 Ga0209256_1000256
793 Ga0207426_1000049
794 Ga0207426_1000315
795 Ga0209051_1000015
796 Ga0209051_1000056
797 Ga0209051_1000894
798 Ga0209051_1001079
799 Ga0209051_1001096
800 Ga0209257_1000037
801 Ga0209257_1004421
802 Ga0209257_1004591
803 Ga0209257_1011962
804 Ga0207656_10001300
805 Ga0207696_1016135
806 Ga0207655_1003837
807 Ga0207645_10238765
808 Ga0207643_10181400
809 Ga0207705_10144464
810 Ga0207684_10006285
811 Ga0207654_10100393
812 Ga0207695_10073418
813 Ga0207695_10085364
814 Ga0207695_10238069
815 Ga0207671_10030763
816 Ga0207671_10102589
817 Ga0207649_10199262
818 Ga0207646_10044087
819 Ga0207687_10058118
820 Ga0207687_10144215
821 Ga0207687_10386795
822 Ga0207644_10137219
823 Ga0207690_10016847
824 Ga0207706_10006170
825 Ga0207686_10047616
826 Ga0207686_10118135
827 Ga0207709_10000117
828 Ga0207709_10000587
829 Ga0207709_10019655
830 Ga0207669_10101506
831 Ga0207669_10296435
832 Ga0207704_10032479
833 Ga0207691_10051737
834 Ga0207711_10264924
835 Ga0207689_10051455
836 Ga0207689_10094734
837 Ga0207689_10183674
838 Ga0207689_10325431
839 Ga0207661_10175879
840 Ga0207679_10154489
841 Ga0207679_10267782
842 Ga0207667_10104617
843 Ga0207667_10163905
844 Ga0207667_10527990
845 Ga0207651_10095847
846 Ga0207712_10466021
847 Ga0207658_10049045
848 Ga0207658_10214692
849 Ga0207677_10052699
850 Ga0207677_10203707
851 Ga0207677_10353751
852 Ga0207703_10450961
853 Ga0207639_10028052
854 Ga0207639_10073052
855 Ga0207678_10020544
856 Ga0207678_10225758
857 Ga0207702_10003218
858 Ga0207648_10008269
859 Ga0207648_10028772
860 Ga0207648_10119908
861 Ga0207674_10001652
862 Ga0207674_10113483
863 Ga0207675_100009803
864 Ga0207675_100080204
865 Ga0207683_10050234
866 Ga0207683_10088143
867 Ga0207698_10035164
868 Ga0207698_10565782
869 Ga0209281_1000017
870 Ga0209970_1000287
871 Ga0209282_1020331
872 Ga0268266_10062898
873 Ga0268265_10026776
874 Ga0268264_10372947
875 Ga0268264_10388760
876 Ga0265336_10000040
877 Ga0307515_10000137
878 Ga0307515_10000221
879 Ga0307515_10000777
880 Ga0307515_10070037
881 Ga0307515_10108747
882 Ga0265324_10001932
883 Ga0316176_1070259
884 Ga0314311_1074579
885 Ga0265327_10000640
886 Ga0265327_10008506
887 Ga0307513_10000029
888 Ga0307513_10001667
889 Ga0307513_10071296
890 Ga0307513_10074508
891 Ga0307509_10169074
892 Ga0307408_100000246
893 Ga0307408_100009802
894 Ga0307508_10000141
895 Ga0307508_10238600
896 Ga0307514_10035594
897 Ga0307514_10200284
898 Ga0307516_10000155
899 Ga0307516_10001176
900 Ga0307516_10001709
901 Ga0307516_10004703
902 Ga0307405_10009141
903 Ga0307405_10112474
904 Ga0307405_10128723
905 Ga0307406_10001082
906 Ga0307406_10006015
907 Ga0307412_10107672
908 Ga0307412_10131167
909 Ga0307412_10155167
910 Ga0307412_10383535
911 Ga0307416_100008180
912 Ga0307416_100088462
913 Ga0307416_100376310
914 Ga0307507_10094543
915 Ga0373944_0045699
916 Ga0373931_0008810
917 Ga0373937_0044882
918 Ga0373925_0012106
919 Ga0395898_0140581
920 Ga0395905_0004450
921 Ga0395901_0010895
922 Ga0436365_0179555
923 Ga0436361_0064311
924 Ga0436361_0276783
925 Ga0436361_0691237
926 Ga0436361_1092231
927 Ga0439439_0001487
928 Ga0439439_0017146
929 Ga0451793_1648312
930 Ga0451802_2098710
931 Ga0451807_0108644
932 Ga0451853_3940933
933 Ga0439431_0016587
934 Ga0439431_0043738
935 Ga0439433_0004117
936 Ga0439442_001303
937 Ga0439445_0003027
938 Ga0439432_028680
939 Ga0439449_0000254
940 Ga0439449_0006594
941 Ga0439462_0022952
942 Ga0450920_026994
943 Ga0450906_001491
944 Ga0450906_005561
945 Ga0439434_0005516
946 Ga0439434_0009062
947 Ga0450918_010010
948 Ga0450893_0002594
949 Ga0466969_0004140
950 Ga0466972_0001854
951 Ga0466972_0079632
952 Ga0453683_0001704
953 Ga0466965_0024200
954 Ga0466966_0083702
955 Ga0466961_0038822
956 Ga0466964_0005324
957 Ga0453684_0384314
958 Ga0466971_0038951
959 Ga0466968_0048165
960 Ga0466970_0022480
961 Ga0466957_0037756
962 Ga0466960_0034753
963 Ga0466959_0009180
964 Ga0451576_0005405
965 Ga0466958_0008426
966 Ga0495627_015346
967 Ga0495592_0297626
968 Ga0495629_0084603
969 Ga0495638_0027538
970 Ga0495651_0149998
971 Ga0495650_0063482
972 Ga0495580_0082501
973 Ga0495639_0010835
974 Ga0495585_0069617
975 Ga0495606_0008149
976 Ga0495608_0099213
977 Ga0495616_0003991
978 Ga0495620_0003885
979 Ga0495628_0235432
980 Ga0495628_0356895
981 Ga0495631_0003913
982 Ga0495632_0039077
983 Ga0495637_0011511
984 Ga0495642_0047257
985 Ga0495652_0258746
986 Ga0495654_0029206
987 Ga0495586_0119700
988 Ga0495621_0013009
989 Ga0495656_0000114
990 Ga0495668_0033715
991 Ga0495625_0000294
992 Ga0495625_0008695
993 Ga0495588_0024588
994 Ga0495588_0077703
995 Ga0495647_0005004
996 Ga0495649_0000270
997 Ga0495589_0026302
998 Ga0495660_0037101
999 Ga0495676_0020316
1000 Ga0495681_0040685
1001 Ga0495593_0009903
1002 Ga0496100_0029685
1003 Ga0496101_0003936
1004 Ga0496101_0257882
1005 Ga0496102_0007549
1006 Ga0496102_0021838
1007 Ga0496104_0001619
1008 Ga0496105_0003397
1009 Ga0496107_0035127
1010 Ga0496108_0065778
1011 Ga0496109_0136456
1012 Ga0496111_0071375
1013 Ga0496112_0376116
1014 Ga0496114_0094860
1015 Ga0496116_0023802
1016 Ga0496116_0144007
1017 Ga0496117_0010951
1018 Ga0496118_0017904
1019 Ga0496118_0058254
1020 Ga0496119_0012317
1021 Ga0496122_0083672
1022 Ga0496123_0014852
1023 Ga0496124_0093603
1024 Ga0496125_0052493
1025 Ga0496125_0079343
1026 Ga0496125_0108402
1027 Ga0496126_0060332
1028 Ga0501262_000138
1029 Ga0501265_004384
1030 nmdc:mga03n38_80013_c1
1031 nmdc:mga00v17_64072_c1
1032 nmdc:mga0yw44_245496_c1
1033 nmdc:mga0k408_12512_c1
1034 nmdc:mga0k408_19510_c1
1035 nmdc:mga0k408_250046_c1
1036 nmdc:mga0k408_32098_c1
1037 nmdc:mga0k408_66920_c1
1038 nmdc:mga06z11_83836_c1
1039 nmdc:mga06z11_8825_c1
1040 nmdc:mga07m45_125706_c1
1041 nmdc:mga07m45_141133_c1
1042 nmdc:mga07m45_210645_c1
1043 nmdc:mga07m45_37567_c1
1044 nmdc:mga07m45_47327_c1
1045 nmdc:mga07m45_5751_c1
1046 nmdc:mga07m45_966_c2
1047 nmdc:mga05p37_42453_c1
1048 nmdc:mga0sz30_112190_c1
1049 Ga0495601_0111487
1050 Ga0500610_0072486
1051 Ga0500635_0000243
1052 Ga0500643_017857
1053 Ga0500644_0003211
1054 Ga0500651_0000057
1055 Ga0500566_0099850
1056 Ga0500650_0019041
1057 Ga0500555_038217
1058 Ga0500562_028761
1059 Ga0500571_000038
1060 Ga0500593_000984
1061 Ga0500593_006723
1062 Ga0500594_0000390
1063 Ga0500607_005933
1064 Ga0500607_039435
1065 Ga0500608_016963
1066 Ga0500628_001932
1067 Ga0500655_001260
1068 Ga0500658_0000408
1069 Ga0500658_0001506
1070 Ga0500658_0015246
1071 Ga0500559_0006861
1072 Ga0500568_0007904
1073 Ga0500574_038913
1074 Ga0500586_044798
1075 Ga0500616_0011515
1076 Ga0500616_0032745
1077 Ga0500627_0002652
1078 Ga0500634_0027640
1079 Ga0500638_003779
1080 Ga0500625_038758
1081 Ga0500661_002140
1082 Ga0466962_0031832
1083 2513230030
1084 2587754344
1085 2599620677
1086 2599673976
1087 2599678707
1088 2599690188
1089 2644161511
1090 2644324235
1091 2644399467
1092 2644465037
1093 2722881879
1094 2738720525
1095 2738884099
1096 2739250197
1097 2739279724
1098 2819601204
1099 2831271475
1100 2831869180
1101 2838055379
1102 2839144825
1103 2842680535
1104 2842751914
1105 2885192398
1106 2885201546
1107 2885215743
1108 2899927449
1109 2904450824
1110 2904459673
1111 2904548071
1112 2919462650
1113 2919705269
1114 2928042639
1115 2928048934
1116 2928055268
1117 2928068696
1118 2928073393
1119 2928090051
1120 2929161534
1121 2929521772
1122 2932423907
1123 2945913998
1124 2945973600
1125 2945990607
1126 2954770785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

240

319

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

280

318

0.95

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

227

268

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9359 213 307
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9203 208 307
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9063 199 312
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8761 199 305
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.8753 199 312
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9742 259 312 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9708 263 305 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9683 250 308 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9667 259 306 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9396 262 305 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I3UER9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9696 213 308 GO:0003700
GO:0043565
AF-A0A069SXS9-F1-model_v4 deleted 0.968 215 311
AF-A0A1A3SUE6-F1-model_v4 Transcriptional regulator 0.9647 207 307 GO:0003700
GO:0043565
AF-A0A2V2E0K2-F1-model_v4 Stage 0 sporulation protein A homolog 0.9553 209 311 GO:0000160
GO:0003700
GO:0043565
AF-A0A807WU71-F1-model_v4 deleted 0.9546 201 309

Map