F464148

General Info

Members Datasets Scaffolds Average Seq Length
564 385 1128 240

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100423067|Ga0068854_1004230672
Length 282
Sequence MLLGRASRLIAVLDLQRRMVIAIARPGRSAKLSEARVAVVSGAAQGIGAATARRLASDGHAVALIDLDENACKDGVDAILADGGQATAIGCDVADESAVAAAFETIAAQLGAPTILVNNAGIIRDNLLFKMPVDDFDAVLNVHLRGAFLMSRAAQRFMTGQRFGRIVNLSSVAALGNRGQTNYSAAKAGVQGFTKTLAIELGPFGVTVNAIAPGFIQTDMTAATAERIGVPFEEFIASASEQIPVRRVGQPEDIAHTVSFLVSEGAGFVSGQIIYLAGGPTC

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
177 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
199 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
200 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
203 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
299 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
303 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
325 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
326 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
347 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
348 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
349 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
352 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
355 2501939600 Micromonospora sp. L5 Isolate Unclassified
356 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
357 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
358 2643221576 Nocardioides sp. Root614 Isolate Unclassified
359 2643221590 Nocardioides sp. Root682 Isolate Unclassified
360 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
361 2643221604 Nocardioides sp. Root190 Isolate Unclassified
362 2643221617 Nocardioides sp. Root79 Isolate Unclassified
363 2643221620 Nocardioides sp. Root240 Isolate Unclassified
364 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
365 2643221638 Duganella sp. Root336D2 Isolate Unclassified
366 2643221692 Nocardia sp. Root136 Isolate Unclassified
367 2738543010 Bacillus sp. YR335 Isolate Unclassified
368 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
369 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
370 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
371 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
372 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
373 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
374 2857553236 Duganella sp. R-74557 Isolate Unclassified
375 2862574272 Streptomyces sp. AcE210 Isolate Nodule
376 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
377 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
378 2891562705 Microbispora tritici MT50 Isolate Unclassified
379 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
380 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
381 649633069 Micromonospora sp. L5 Isolate Unclassified
382 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
383 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
384 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
385 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 1.6
Isolates 5.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.3
Nodule 0.53
Rhizoplane 4.96
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100423067 3300005578 Bacteria 1107
2 JGI24736J21556_1001712 3300001904 Bacteria 3954
3 JGI24741J21665_1000010 3300001915 Bacteria 44368
4 JGI24740J21852_10008764 3300001979 Bacteria 4013
5 JGI24739J22299_10000064 3300001989 Bacteria 29745
6 JGI24737J22298_10001765 3300001990 Bacteria 7737
7 JGI24743J22301_10011629 3300001991 Bacteria 1589
8 JGI24750J21931_1023946 3300002070 Bacteria 869
9 JGI24738J21930_10033544 3300002075 Bacteria 1046
10 JGI25158J39367_1001766 3300002739 Bacteria 3689
11 JGI25152J39213_1003851 3300002773 Bacteria 4950
12 JGI25150J39212_1005125 3300002774 Bacteria 2829
13 JGI25150J39212_1011438 3300002774 Bacteria 1609
14 JGI25153J46596_10008450 3300003215 Bacteria 4921
15 rootL2_10103237 3300003322 Bacteria 1177
16 JGI25161J50226_1009399 3300003374 Bacteria 1395
17 Ga0055539_1000034 3300003752 Bacteria 223400
18 Ga0055533_1006415 3300003756 Bacteria 1736
19 Ga0055525_1000538 3300003759 Bacteria 18074
20 Ga0055529_1000403 3300003763 Bacteria 45873
21 Ga0055526_1005592 3300003771 Bacteria 7164
22 Ga0055537_1006604 3300003773 Bacteria 2913
23 Ga0055524_1000234 3300003775 Bacteria 58774
24 Ga0055524_1006560 3300003775 Bacteria 5033
25 Ga0055524_1008881 3300003775 Bacteria 4137
26 Ga0055524_1016262 3300003775 Bacteria 2675
27 Ga0055534_1011123 3300003784 Bacteria 1845
28 Ga0055534_1011642 3300003784 Bacteria 1777
29 Ga0055528_1002474 3300003790 Bacteria 9876
30 Ga0055530_10008671 3300003791 Bacteria 4027
31 Ga0055531_10033093 3300003794 Bacteria 1673
32 Ga0070683_100014373 3300005329 Bacteria 6924
33 Ga0070683_100506973 3300005329 Bacteria 1153
34 Ga0070682_100018971 3300005337 Bacteria 4028
35 Ga0068868_100223154 3300005338 Bacteria 1578
36 Ga0070660_100004481 3300005339 Bacteria 9653
37 Ga0070687_100109015 3300005343 Bacteria 1564
38 Ga0070661_100198773 3300005344 Bacteria 1531
39 Ga0070668_100004901 3300005347 Bacteria 9920
40 Ga0070668_100130364 3300005347 Bacteria 2018
41 Ga0070668_100503163 3300005347 Bacteria 1049
42 Ga0070669_100208607 3300005353 Bacteria 1540
43 Ga0070674_100194342 3300005356 Bacteria 1562
44 Ga0070688_100271507 3300005365 Bacteria 1215
45 Ga0070659_100009247 3300005366 Bacteria 7234
46 Ga0070659_100074720 3300005366 Bacteria 2700
47 Ga0070659_100130848 3300005366 Bacteria 2038
48 Ga0070713_100686314 3300005436 Bacteria 977
49 Ga0070701_10047723 3300005438 Bacteria 2206
50 Ga0070711_100061196 3300005439 Bacteria 2620
51 Ga0070700_100022720 3300005441 Bacteria 3663
52 Ga0070708_100031336 3300005445 Bacteria 4601
53 Ga0070708_100058196 3300005445 Bacteria 3443
54 Ga0070708_100113950 3300005445 Bacteria 2487
55 Ga0070681_10325911 3300005458 Bacteria 1446
56 Ga0068867_100240219 3300005459 Bacteria 1469
57 Ga0070685_10039955 3300005466 Bacteria 2668
58 Ga0070706_100004098 3300005467 Bacteria 14173
59 Ga0070706_100016881 3300005467 Bacteria 6743
60 Ga0070706_100507853 3300005467 Bacteria 1121
61 Ga0070707_100003448 3300005468 Bacteria 14946
62 Ga0070707_100166915 3300005468 Bacteria 2145
63 Ga0070698_100077837 3300005471 Bacteria 3315
64 Ga0070698_100089243 3300005471 Bacteria 3067
65 Ga0070699_100000298 3300005518 Bacteria 47855
66 Ga0070699_100134048 3300005518 Bacteria 2184
67 Ga0070684_100020890 3300005535 Bacteria 5434
68 Ga0070684_100035439 3300005535 Bacteria 4270
69 Ga0070684_100642438 3300005535 Bacteria 988
70 Ga0070697_100056441 3300005536 Bacteria 3195
71 Ga0068853_100001500 3300005539 Bacteria 16952
72 Ga0068853_100043128 3300005539 Bacteria 3860
73 Ga0070672_100028650 3300005543 Bacteria 4167
74 Ga0068855_100001045 3300005563 Bacteria 34361
75 Ga0068857_100033467 3300005577 Bacteria 4545
76 Ga0068854_100001196 3300005578 Bacteria 15559
77 Ga0068856_100045173 3300005614 Bacteria 4336
78 Ga0070702_100008749 3300005615 Bacteria 4920
79 Ga0070702_100009006 3300005615 Bacteria 4864
80 Ga0068852_100000924 3300005616 Bacteria 19430
81 Ga0068852_100066930 3300005616 Bacteria 3139
82 Ga0068852_100785124 3300005616 Bacteria 966
83 Ga0068864_100096470 3300005618 Bacteria 2617
84 Ga0068866_10004804 3300005718 Bacteria 5545
85 Ga0068866_10029454 3300005718 Bacteria 2626
86 Ga0068861_100067139 3300005719 Bacteria 2767
87 Ga0068851_10007031 3300005834 Bacteria 5161
88 Ga0068870_10004500 3300005840 Bacteria 6002
89 Ga0081538_10016227 3300005981 Bacteria 5724
90 Ga0081538_10054394 3300005981 Bacteria 2368
91 Ga0081538_10086006 3300005981 Bacteria 1648
92 Ga0081540_1088150 3300005983 Bacteria 1373
93 Ga0081539_10005489 3300005985 Bacteria 12888
94 Ga0070717_10016423 3300006028 Bacteria 5738
95 Ga0070717_10092781 3300006028 Bacteria 2551
96 Ga0075365_10006611 3300006038 Bacteria 6399
97 Ga0075365_10012036 3300006038 Bacteria 5117
98 Ga0075368_10004447 3300006042 Bacteria 4753
99 Ga0075363_100039933 3300006048 Bacteria 2472
100 Ga0075364_10015616 3300006051 Bacteria 4712
101 Ga0070712_100015119 3300006175 Bacteria 4963
102 Ga0075362_10002027 3300006177 Bacteria 6670
103 Ga0075362_10128102 3300006177 Bacteria 1205
104 Ga0097621_100256897 3300006237 Bacteria 1532
105 Ga0075370_10135981 3300006353 Bacteria 1436
106 Ga0075428_100000043 3300006844 Bacteria 102004
107 Ga0075428_100101410 3300006844 Bacteria 3138
108 Ga0075428_100184363 3300006844 Bacteria 2258
109 Ga0075428_100214647 3300006844 Bacteria 2079
110 Ga0068865_100025194 3300006881 Bacteria 3909
111 Ga0068865_100171162 3300006881 Bacteria 1665
112 Ga0068865_100439834 3300006881 Bacteria 1076
113 Ga0105251_10001505 3300009011 Bacteria 20012
114 Ga0105244_10001347 3300009036 Bacteria 20009
115 Ga0105250_10002004 3300009092 Bacteria 10550
116 Ga0105240_10029849 3300009093 Bacteria 7096
117 Ga0111539_10231013 3300009094 Bacteria 2154
118 Ga0105245_10036539 3300009098 Bacteria 4364
119 Ga0105245_10042569 3300009098 Bacteria 4053
120 Ga0105245_10371493 3300009098 Bacteria 1422
121 Ga0114129_10140385 3300009147 Bacteria 3312
122 Ga0105243_10033259 3300009148 Bacteria 3987
123 Ga0105243_10084645 3300009148 Bacteria 2597
124 Ga0105241_10000156 3300009174 Bacteria 49491
125 Ga0105237_10068545 3300009545 Bacteria 3541
126 Ga0105238_10000079 3300009551 Bacteria 109619
127 Ga0105238_10007164 3300009551 Bacteria 11153
128 Ga0105238_10037915 3300009551 Bacteria 4898
129 Ga0105238_10322401 3300009551 Bacteria 1531
130 Ga0105238_10606292 3300009551 Bacteria 1103
131 Ga0105249_10061179 3300009553 Bacteria 3455
132 Ga0105249_10117819 3300009553 Bacteria 2519
133 Ga0105239_10034546 3300010375 Bacteria 5552
134 Ga0105239_10050416 3300010375 Bacteria 4566
135 Ga0105239_10151901 3300010375 Bacteria 2584
136 Ga0105239_10399812 3300010375 Bacteria 1555
137 Ga0157369_10002092 3300013105 Bacteria 24134
138 Ga0157369_10272408 3300013105 Bacteria 1764
139 Ga0157378_10023032 3300013297 Bacteria 5483
140 Ga0163162_10077494 3300013306 Bacteria 3388
141 Ga0157372_10087937 3300013307 Bacteria 3527
142 Ga0157372_10259217 3300013307 Bacteria 2019
143 Ga0157375_10041467 3300013308 Bacteria 4445
144 Ga0157375_10273672 3300013308 Bacteria 1851
145 Ga0157380_10019890 3300014326 Bacteria 5010
146 Ga0157380_10323137 3300014326 Bacteria 1431
147 Ga0157377_10399380 3300014745 Bacteria 936
148 Ga0157376_10606287 3300014969 Bacteria 1090
149 Ga0163161_10100949 3300017792 Bacteria 2148
150 Ga0206353_10256792 3300020082 Bacteria 2425
151 Ga0206353_11163641 3300020082 Bacteria 1956
152 Ga0206353_11427395 3300020082 Bacteria 1352
153 Ga0213872_10000263 3300021361 Bacteria 45483
154 Ga0213872_10111713 3300021361 Bacteria 1213
155 Ga0224712_10056235 3300022467 Bacteria 1550
156 Ga0209436_100291 3300025208 Bacteria 23121
157 Ga0209784_100003 3300025224 Bacteria 1379451
158 Ga0209784_100293 3300025224 Bacteria 27186
159 Ga0209566_100002 3300025225 Bacteria 2614868
160 Ga0209674_100008 3300025226 Bacteria 1076909
161 Ga0209563_100004 3300025230 Bacteria 1814108
162 Ga0207425_1000001 3300025245 Bacteria 2525432
163 Ga0207425_1001467 3300025245 Bacteria 9823
164 Ga0207425_1001639 3300025245 Bacteria 9024
165 Ga0209677_100009 3300025253 Bacteria 749530
166 Ga0209129_1000001 3300025258 Bacteria 1452436
167 Ga0209129_1005030 3300025258 Bacteria 4863
168 Ga0209565_1000902 3300025263 Bacteria 16045
169 Ga0209565_1001159 3300025263 Bacteria 12725
170 Ga0209565_1009721 3300025263 Bacteria 2421
171 Ga0209565_1014062 3300025263 Bacteria 1851
172 Ga0209455_1000037 3300025272 Bacteria 464097
173 Ga0209673_1004849 3300025273 Bacteria 7033
174 Ga0209675_1000769 3300025291 Bacteria 21492
175 Ga0209675_1005996 3300025291 Bacteria 4973
176 Ga0209675_1009461 3300025291 Bacteria 3443
177 Ga0209564_1001707 3300025295 Bacteria 20758
178 Ga0209564_1003112 3300025295 Bacteria 11717
179 Ga0209758_1000073 3300025297 Bacteria 276262
180 Ga0209758_1002044 3300025297 Bacteria 21637
181 Ga0209050_1000046 3300025298 Bacteria 386466
182 Ga0209256_1000044 3300025299 Bacteria 337264
183 Ga0209256_1002001 3300025299 Bacteria 18236
184 Ga0209256_1010975 3300025299 Bacteria 3700
185 Ga0207426_1002103 3300025302 Bacteria 13707
186 Ga0207426_1003407 3300025302 Bacteria 8683
187 Ga0209257_1000068 3300025304 Bacteria 341291
188 Ga0207656_10009161 3300025321 Bacteria 3670
189 Ga0207655_1001563 3300025728 Bacteria 20594
190 Ga0207713_1001245 3300025735 Bacteria 21110
191 Ga0207642_10013933 3300025899 Bacteria 2949
192 Ga0207688_10003187 3300025901 Bacteria 8951
193 Ga0207688_10081152 3300025901 Bacteria 1852
194 Ga0207647_10000033 3300025904 Bacteria 100573
195 Ga0207647_10016687 3300025904 Bacteria 5006
196 Ga0207647_10127528 3300025904 Bacteria 1497
197 Ga0207643_10007047 3300025908 Bacteria 6023
198 Ga0207684_10012883 3300025910 Bacteria 7241
199 Ga0207654_10008183 3300025911 Bacteria 5274
200 Ga0207695_10002681 3300025913 Bacteria 25984
201 Ga0207671_10041228 3300025914 Bacteria 3416
202 Ga0207693_10383838 3300025915 Bacteria 1099
203 Ga0207662_10107878 3300025918 Bacteria 1733
204 Ga0207657_10001739 3300025919 Bacteria 23466
205 Ga0207657_10060954 3300025919 Bacteria 3237
206 Ga0207657_10063062 3300025919 Bacteria 3171
207 Ga0207646_10000520 3300025922 Bacteria 51319
208 Ga0207646_10171736 3300025922 Bacteria 1958
209 Ga0207694_10001799 3300025924 Bacteria 17857
210 Ga0207694_10020030 3300025924 Bacteria 5059
211 Ga0207694_10093762 3300025924 Bacteria 2372
212 Ga0207694_10419684 3300025924 Bacteria 1114
213 Ga0207687_10051445 3300025927 Bacteria 2872
214 Ga0207687_10075707 3300025927 Bacteria 2416
215 Ga0207690_10032879 3300025932 Bacteria 3331
216 Ga0207706_10037034 3300025933 Bacteria 4332
217 Ga0207709_10054871 3300025935 Bacteria 2459
218 Ga0207709_10107392 3300025935 Bacteria 1859
219 Ga0207704_10031843 3300025938 Bacteria 2976
220 Ga0207665_10021790 3300025939 Bacteria 4215
221 Ga0207691_10015968 3300025940 Bacteria 7133
222 Ga0207711_10365708 3300025941 Bacteria 1337
223 Ga0207661_10027976 3300025944 Bacteria 4313
224 Ga0207661_10036828 3300025944 Bacteria 3822
225 Ga0207661_10199282 3300025944 Bacteria 1759
226 Ga0207661_10313984 3300025944 Bacteria 1408
227 Ga0207661_10381712 3300025944 Bacteria 1275
228 Ga0207667_10002487 3300025949 Bacteria 22974
229 Ga0207651_10068255 3300025960 Bacteria 2506
230 Ga0207712_10092846 3300025961 Bacteria 2226
231 Ga0207668_10008120 3300025972 Bacteria 6248
232 Ga0207668_10073671 3300025972 Bacteria 2448
233 Ga0207640_10000460 3300025981 Bacteria 24848
234 Ga0207658_10050613 3300025986 Bacteria 3058
235 Ga0207639_10072126 3300026041 Bacteria 2703
236 Ga0207678_10095644 3300026067 Bacteria 2538
237 Ga0207708_10000589 3300026075 Bacteria 28085
238 Ga0207702_10000793 3300026078 Bacteria 33517
239 Ga0207648_10013560 3300026089 Bacteria 7577
240 Ga0207648_10402734 3300026089 Bacteria 1240
241 Ga0207676_10249445 3300026095 Bacteria 1597
242 Ga0207674_10013896 3300026116 Bacteria 8909
243 Ga0207674_10378173 3300026116 Bacteria 1369
244 Ga0207675_100017896 3300026118 Bacteria 6608
245 Ga0207675_100591083 3300026118 Bacteria 1112
246 Ga0207698_10013410 3300026142 Bacteria 5407
247 Ga0207698_10101581 3300026142 Bacteria 2385
248 Ga0207698_10906986 3300026142 Bacteria 889
249 Ga0209282_1000001 3300027666 Bacteria 2450367
250 Ga0207428_10159418 3300027907 Bacteria 1714
251 Ga0207428_10206860 3300027907 Bacteria 1476
252 Ga0268264_10278872 3300028381 Bacteria 1565
253 Ga0265327_10004040 3300031251 Bacteria 13324
254 Ga0307513_10027389 3300031456 Bacteria 6544
255 Ga0307408_100000387 3300031548 Bacteria 40174
256 Ga0307408_100001210 3300031548 Bacteria 19453
257 Ga0307408_100021297 3300031548 Bacteria 4386
258 Ga0307408_100628375 3300031548 Bacteria 957
259 Ga0307405_10011285 3300031731 Bacteria 4673
260 Ga0307405_10153812 3300031731 Bacteria 1621
261 Ga0307405_10463048 3300031731 Bacteria 1008
262 Ga0307413_10253647 3300031824 Bacteria 1307
263 Ga0307413_10532512 3300031824 Bacteria 949
264 Ga0307410_10019242 3300031852 Bacteria 4148
265 Ga0307410_10049971 3300031852 Bacteria 2809
266 Ga0307406_10081331 3300031901 Bacteria 2154
267 Ga0307406_10445333 3300031901 Bacteria 1038
268 Ga0307407_10060291 3300031903 Bacteria 2214
269 Ga0307407_10088370 3300031903 Bacteria 1893
270 Ga0307409_100003060 3300031995 Bacteria 8946
271 Ga0307409_100016843 3300031995 Bacteria 4851
272 Ga0307409_100075207 3300031995 Bacteria 2703
273 Ga0307409_100468805 3300031995 Bacteria 1219
274 Ga0307416_100014685 3300032002 Bacteria 5380
275 Ga0307416_100020341 3300032002 Bacteria 4733
276 Ga0307416_100404222 3300032002 Bacteria 1404
277 Ga0307416_100683726 3300032002 Bacteria 1114
278 Ga0307411_10608273 3300032005 Bacteria 941
279 Ga0307415_100009535 3300032126 Bacteria 5449
280 Ga0307415_100062968 3300032126 Bacteria 2575
281 Ga0316583_10015566 3300032133 Bacteria 2736
282 Ga0373950_0005439 3300034818 Bacteria 1904
283 Ga0373934_0223708 3300035086 Bacteria 776
284 Ga0373940_0009630 3300035088 Bacteria 2250
285 Ga0373953_0011082 3300035117 Bacteria 3153
286 Ga0373954_0062890 3300035118 Bacteria 1754
287 Ga0373956_0006754 3300035119 Bacteria 4602
288 Ga0373943_0147097 3300035170 Bacteria 1274
289 Ga0373946_0010767 3300035171 Bacteria 3396
290 Ga0373955_0024911 3300035172 Bacteria 3065
291 Ga0373955_0210507 3300035172 Bacteria 1159
292 Ga0373955_0300068 3300035172 Bacteria 968
293 Ga0373942_0000328 3300035207 Bacteria 12928
294 Ga0373924_0125566 3300035410 Bacteria 1115
295 Ga0373935_0002124 3300035692 Bacteria 11241
296 Ga0373935_0022512 3300035692 Bacteria 3865
297 Ga0373933_0008466 3300035724 Bacteria 5611
298 Ga0373933_0175706 3300035724 Bacteria 1364
299 Ga0373947_0000003 3300035725 Bacteria 345338
300 Ga0373937_0138239 3300036401 Bacteria 2278
301 Ga0373937_0237763 3300036401 Bacteria 1716
302 Ga0373937_0542575 3300036401 Bacteria 1104
303 Ga0373925_0304351 3300037068 Bacteria 1288
304 Ga0373925_0387683 3300037068 Bacteria 1138
305 Ga0395900_0286281 3300037418 Bacteria 1638
306 Ga0395900_0680420 3300037418 Bacteria 963
307 Ga0395898_0196859 3300037466 Bacteria 1925
308 Ga0395905_0618281 3300037471 Bacteria 985
309 Ga0436364_1208927 3300037853 Bacteria 3598
310 Ga0395901_0049393 3300038443 Bacteria 4371
311 Ga0395901_0248924 3300038443 Bacteria 1852
312 Ga0395901_0850247 3300038443 Bacteria 898
313 Ga0400485_14387 3300038735 Bacteria 23975
314 Ga0400488_33105 3300038741 Bacteria 11860
315 Ga0400486_21500 3300038742 Bacteria 94371
316 Ga0436361_0080172 3300039447 Bacteria 39325
317 Ga0436361_0181426 3300039447 Bacteria 1331
318 Ga0436361_0715182 3300039447 Bacteria 1054
319 Ga0451795_0766239 3300041456 Bacteria 3862
320 Ga0451849_0593111 3300041505 Bacteria 1036
321 Ga0439445_0025124 3300042004 Bacteria 1518
322 Ga0439432_069941 3300042006 Bacteria 1071
323 Ga0439449_0005087 3300042007 Bacteria 5057
324 Ga0439455_0019950 3300042012 Bacteria 1585
325 Ga0450893_0028985 3300042532 Bacteria 981
326 Ga0451577_0010831 3300042876 Bacteria 8668
327 Ga0466969_0009652 3300044656 Bacteria 5115
328 Ga0466969_0010424 3300044656 Bacteria 4926
329 Ga0466969_0070638 3300044656 Bacteria 1679
330 Ga0466969_0086919 3300044656 Bacteria 1485
331 Ga0466972_0047727 3300044658 Bacteria 2070
332 Ga0466965_0048033 3300044683 Bacteria 2114
333 Ga0466966_0001445 3300044684 Bacteria 15254
334 Ga0466966_0096362 3300044684 Bacteria 1832
335 Ga0466961_0064476 3300044693 Bacteria 2328
336 Ga0466961_0122029 3300044693 Bacteria 1635
337 Ga0466963_0388672 3300044694 Bacteria 983
338 Ga0453684_0032889 3300044712 Bacteria 7242
339 Ga0466971_0023125 3300044719 Bacteria 2770
340 Ga0466970_0006879 3300044765 Bacteria 5694
341 Ga0466970_0026432 3300044765 Bacteria 3041
342 Ga0466970_0031436 3300044765 Bacteria 2803
343 Ga0466957_0090956 3300044842 Bacteria 1912
344 Ga0466957_0113013 3300044842 Bacteria 1724
345 Ga0466957_0450243 3300044842 Bacteria 887
346 Ga0466960_0035516 3300044901 Bacteria 2330
347 Ga0466960_0260535 3300044901 Bacteria 966
348 Ga0466959_0062467 3300045049 Bacteria 2706
349 Ga0466959_0069963 3300045049 Bacteria 2542
350 Ga0466958_0011513 3300045836 Bacteria 4982
351 Ga0466958_0077113 3300045836 Bacteria 2046
352 Ga0466958_0087969 3300045836 Bacteria 1919
353 Ga0466967_0135634 3300045976 Bacteria 2289
354 Ga0466967_0144720 3300045976 Bacteria 2216
355 Ga0466967_0313568 3300045976 Bacteria 1511
356 Ga0466967_0488696 3300045976 Bacteria 1207
357 Ga0495627_000007 3300046453 Bacteria 575915
358 Ga0495592_0024366 3300046454 Bacteria 4601
359 Ga0495590_0008695 3300046457 Bacteria 3866
360 Ga0495629_0000012 3300046459 Bacteria 230331
361 Ga0495629_0067480 3300046459 Bacteria 2496
362 Ga0495638_0061151 3300046460 Bacteria 2328
363 Ga0495641_0111554 3300046461 Bacteria 1220
364 Ga0495651_0003407 3300046462 Bacteria 12194
365 Ga0495653_0058177 3300046463 Bacteria 2939
366 Ga0495582_0021655 3300046473 Bacteria 3517
367 Ga0495639_0026775 3300046475 Bacteria 2550
368 Ga0495662_0001123 3300046476 Bacteria 13186
369 Ga0495594_0004998 3300046499 Bacteria 6823
370 Ga0495607_0004150 3300046501 Bacteria 10781
371 Ga0495583_0004868 3300046506 Bacteria 9379
372 Ga0495606_0004181 3300046507 Bacteria 14633
373 Ga0495608_0002781 3300046511 Bacteria 12555
374 Ga0495608_0020655 3300046511 Bacteria 4524
375 Ga0495616_0058898 3300046513 Bacteria 1890
376 Ga0495628_0090078 3300046516 Bacteria 2374
377 Ga0495630_0158389 3300046517 Bacteria 1723
378 Ga0495644_0027912 3300046523 Bacteria 2137
379 Ga0495663_0031250 3300046525 Bacteria 1581
380 Ga0495652_0050203 3300046529 Bacteria 3567
381 Ga0495640_0020229 3300046533 Bacteria 4901
382 Ga0495640_0197073 3300046533 Bacteria 1278
383 Ga0495586_0241308 3300046535 Bacteria 1030
384 Ga0495587_0213049 3300046536 Bacteria 1090
385 Ga0495609_0002949 3300046538 Bacteria 10058
386 Ga0495609_0003102 3300046538 Bacteria 9742
387 Ga0495645_0044434 3300046543 Bacteria 3240
388 Ga0495667_0010954 3300046559 Bacteria 6127
389 Ga0495668_0000173 3300046616 Bacteria 95830
390 Ga0495668_0026989 3300046616 Bacteria 3254
391 Ga0495634_0016004 3300046642 Bacteria 5372
392 Ga0495634_0035279 3300046642 Bacteria 3427
393 Ga0495625_0001016 3300046660 Bacteria 37004
394 Ga0495625_0001679 3300046660 Bacteria 25832
395 Ga0495635_0001451 3300046663 Bacteria 15860
396 Ga0495635_0007651 3300046663 Bacteria 7537
397 Ga0495659_0004469 3300046664 Bacteria 4405
398 Ga0495661_0017969 3300046665 Bacteria 4660
399 Ga0495588_0064304 3300046674 Bacteria 1903
400 Ga0495657_0010506 3300046675 Bacteria 6965
401 Ga0495599_0115489 3300046678 Bacteria 1670
402 Ga0495623_0013784 3300046679 Bacteria 5240
403 Ga0495623_0033174 3300046679 Bacteria 3313
404 Ga0495646_0055862 3300046680 Bacteria 2368
405 Ga0495658_0000057 3300046683 Bacteria 56081
406 Ga0495669_0006988 3300046684 Bacteria 4726
407 Ga0495613_0002697 3300046689 Bacteria 13325
408 Ga0495613_0042904 3300046689 Bacteria 3345
409 Ga0495670_0180051 3300046691 Bacteria 1116
410 Ga0495600_0025215 3300046809 Bacteria 3831
411 Ga0495600_0352495 3300046809 Bacteria 922
412 Ga0495660_0003426 3300046810 Bacteria 9818
413 Ga0495660_0014659 3300046810 Bacteria 4533
414 Ga0495581_0000007 3300047315 Bacteria 67949
415 Ga0495604_0000834 3300047317 Bacteria 25747
416 Ga0495604_0014104 3300047317 Bacteria 6371
417 Ga0495636_0036491 3300047318 Bacteria 2027
418 Ga0495674_0029245 3300047319 Bacteria 5020
419 Ga0495674_0035379 3300047319 Bacteria 4507
420 Ga0495676_0159505 3300047321 Bacteria 1597
421 Ga0495676_0167164 3300047321 Bacteria 1551
422 Ga0495680_0012974 3300047322 Bacteria 7295
423 Ga0495680_0025226 3300047322 Bacteria 4923
424 Ga0495675_0016249 3300047444 Bacteria 4707
425 Ga0495675_0019337 3300047444 Bacteria 4325
426 Ga0495675_0060814 3300047444 Bacteria 2393
427 Ga0495685_070498 3300047447 Bacteria 1171
428 Ga0495685_120163 3300047447 Bacteria 863
429 Ga0495681_0004664 3300047470 Bacteria 9291
430 Ga0495681_0022872 3300047470 Bacteria 3334
431 Ga0495684_0022700 3300047471 Bacteria 4826
432 Ga0495684_0064187 3300047471 Bacteria 2790
433 Ga0495686_0425048 3300047472 Bacteria 709
434 Ga0495602_0036059 3300048088 Bacteria 4606
435 Ga0495614_0048470 3300048089 Bacteria 1821
436 Ga0495626_0000267 3300048091 Bacteria 58992
437 Ga0496101_0131350 3300048904 Bacteria 1902
438 Ga0496101_0213712 3300048904 Bacteria 1495
439 Ga0496102_0011650 3300048905 Bacteria 7588
440 Ga0496103_0006680 3300048906 Bacteria 6884
441 Ga0496104_0054457 3300048907 Bacteria 3781
442 Ga0496104_0140678 3300048907 Bacteria 2318
443 Ga0496104_0457814 3300048907 Bacteria 1187
444 Ga0496105_0025490 3300048908 Bacteria 4814
445 Ga0496105_0119845 3300048908 Bacteria 2170
446 Ga0496107_0187159 3300048910 Bacteria 1538
447 Ga0496107_0385983 3300048910 Bacteria 1042
448 Ga0496108_0350621 3300048911 Bacteria 1288
449 Ga0496108_0628073 3300048911 Bacteria 935
450 Ga0496109_0224892 3300048912 Bacteria 1765
451 Ga0496110_0067955 3300048913 Bacteria 3154
452 Ga0496110_0172103 3300048913 Bacteria 1965
453 Ga0496110_0319209 3300048913 Bacteria 1415
454 Ga0496111_0006048 3300048914 Bacteria 7820
455 Ga0496112_0007764 3300048915 Bacteria 9544
456 Ga0496112_0667391 3300048915 Bacteria 969
457 Ga0496114_0053585 3300048917 Bacteria 3362
458 Ga0496114_0100343 3300048917 Bacteria 2470
459 Ga0496114_0108317 3300048917 Bacteria 2378
460 Ga0496114_0124774 3300048917 Bacteria 2218
461 Ga0496114_0207152 3300048917 Bacteria 1719
462 Ga0496114_0682967 3300048917 Bacteria 901
463 Ga0496115_0386796 3300048918 Bacteria 1137
464 Ga0496117_0024021 3300048920 Bacteria 4837
465 Ga0496118_0014701 3300048921 Bacteria 7313
466 Ga0496120_0002693 3300048923 Bacteria 17433
467 Ga0501306_001055 3300049127 Bacteria 2451
468 Ga0501310_000580 3300049130 Bacteria 3210
469 Ga0495678_000004 3300049459 Bacteria 532920
470 Ga0495678_140658 3300049459 Bacteria 790
471 Ga0495682_0078456 3300049460 Bacteria 1188
472 Ga0501311_001778 3300049527 Bacteria 1956
473 Ga0501315_000655 3300049531 Bacteria 2533
474 Ga0501315_006228 3300049531 Bacteria 1322
475 Ga0501031_0043843 3300049568 Bacteria 2918
476 Ga0501032_0228082 3300049569 Bacteria 1211
477 Ga0501033_0124002 3300049570 Bacteria 1873
478 Ga0501036_0086867 3300049572 Bacteria 2643
479 Ga0501038_0081904 3300049574 Bacteria 2718
480 Ga0501039_0018878 3300049575 Bacteria 5294
481 Ga0501040_0017199 3300049576 Bacteria 4799
482 Ga0501042_0257449 3300049578 Bacteria 1259
483 Ga0501047_0515297 3300049581 Bacteria 1022
484 Ga0501048_0147412 3300049582 Bacteria 1664
485 Ga0501067_0081461 3300049583 Bacteria 1794
486 Ga0501068_0072495 3300049584 Bacteria 2103
487 Ga0501069_0317516 3300049585 Bacteria 915
488 Ga0501070_0029135 3300049586 Bacteria 4630
489 Ga0501071_0006292 3300049587 Bacteria 7704
490 Ga0501072_0039929 3300049588 Bacteria 3684
491 Ga0501075_0031277 3300049591 Bacteria 3949
492 Ga0501076_0055369 3300049592 Bacteria 3145
493 Ga0501077_0047277 3300049593 Bacteria 2734
494 Ga0501216_037931 3300049660 Bacteria 912
495 Ga0501227_002589 3300049665 Bacteria 3970
496 Ga0501238_001798 3300049671 Bacteria 2498
497 Ga0501079_0125998 3300049741 Bacteria 1992
498 Ga0501080_0203794 3300049742 Bacteria 1815
499 Ga0501081_0347039 3300049743 Bacteria 1093
500 Ga0501083_0051045 3300049744 Bacteria 2782
501 Ga0501279_001917 3300049775 Bacteria 2740
502 Ga0501279_017062 3300049775 Bacteria 1015
503 Ga0501035_0024558 3300049822 Bacteria 5527
504 Ga0501044_0345679 3300049823 Bacteria 1408
505 Ga0501045_0035555 3300049824 Bacteria 3617
506 nmdc:mga00v17_7749_c1 3300050491 Bacteria 5753
507 nmdc:mga0yw44_2105_c1 3300050492 Bacteria 8331
508 nmdc:mga0yw44_230237_c1 3300050492 Bacteria 1230
509 nmdc:mga0yw44_42147_c1 3300050492 Bacteria 2721
510 nmdc:mga0yw44_7060_c1 3300050492 Bacteria 5497
511 nmdc:mga06z11_106199_c1 3300050494 Bacteria 1548
512 nmdc:mga07m45_2591_c1 3300050496 Bacteria 7827
513 nmdc:mga09592_270402_c1 3300050508 Bacteria 1474
514 nmdc:mga0qj67_306087_c1 3300050509 Bacteria 1287
515 nmdc:mga06r32_67353_c1 3300050510 Bacteria 3456
516 nmdc:mga08y16_200494_c1 3300050511 Bacteria 2068
517 nmdc:mga08y16_715192_c1 3300050511 Bacteria 1000
518 nmdc:mga0sz30_110914_c1 3300050516 Bacteria 1202
519 Ga0495601_0034528 3300053077 Bacteria 3156
520 Ga0495619_0024511 3300053085 Bacteria 3870
521 Ga0500644_0000050 3300053088 Bacteria 71907
522 Ga0500650_0032643 3300053098 Bacteria 2372
523 Ga0500573_0027068 3300053140 Bacteria 3296
524 Ga0500577_0009374 3300053142 Bacteria 2838
525 Ga0500577_0035092 3300053142 Bacteria 1786
526 Ga0500577_0092583 3300053142 Bacteria 1224
527 Ga0501084_0215614 3300054114 Bacteria 1619
528 Ga0590075_001853 3300059424 Bacteria 5139
529 Ga0590077_006260 3300059426 Bacteria 2440
530 Ga0501082_0093468 3300060353 Bacteria 2598
531 Ga0530510_0016407 3300061734 Bacteria 5242
532 Ga0530510_0239506 3300061734 Bacteria 1350
533 2501941593 2501939600 Bacteria 6907073
534 2552113964 2551306166 Bacteria 9731570
535 2552113984 2551306166 Bacteria 9731570
536 2643786923 2643221554 Bacteria 6603920
537 2643889919 2643221576 Bacteria 5214352
538 2643958975 2643221590 Bacteria 5214697
539 2644019523 2643221601 Bacteria 7493239
540 2644033872 2643221604 Bacteria 5014917
541 2644102618 2643221617 Bacteria 5139111
542 2644118280 2643221620 Bacteria 5134593
543 2644180590 2643221631 Bacteria 8168043
544 2644215988 2643221638 Bacteria 6579467
545 2644512161 2643221692 Bacteria 7282860
546 2739232751 2738543010 Bacteria 5583595
547 2808849892 2808606360 Bacteria 4404006
548 2808899010 2808606371 Bacteria 4251511
549 2812319649 2811994871 Bacteria 4497550
550 2812331707 2811994874 Bacteria 5367947
551 2819739170 2818991472 Bacteria 10089953
552 2856742713 2856741275 Bacteria 8096094
553 2857554480 2857553236 Bacteria 6166726
554 2862575323 2862574272 Bacteria 10567477
555 2885271109 2885270888 Bacteria 9831543
556 2887480904 2887478801 Bacteria 8972725
557 2891565010 2891562705 Bacteria 8039471
558 2995468117 2995463766 Bacteria 8577691
559 3006826896 3006826541 Bacteria 4678913
560 649816049 649633069 Bacteria 6962533
561 8001785422 8001781756 Bacteria 9586736
562 8003861676 8003856774 Bacteria 7675274
563 8022894106 8022893055 Bacteria 5300455
564 8055159749 8055157932 Bacteria 6429399
565 Ga0068854_100423067
566 JGI24736J21556_1001712
567 JGI24741J21665_1000010
568 JGI24740J21852_10008764
569 JGI24739J22299_10000064
570 JGI24737J22298_10001765
571 JGI24743J22301_10011629
572 JGI24750J21931_1023946
573 JGI24738J21930_10033544
574 JGI25158J39367_1001766
575 JGI25152J39213_1003851
576 JGI25150J39212_1005125
577 JGI25150J39212_1011438
578 JGI25153J46596_10008450
579 rootL2_10103237
580 JGI25161J50226_1009399
581 Ga0055539_1000034
582 Ga0055533_1006415
583 Ga0055525_1000538
584 Ga0055529_1000403
585 Ga0055526_1005592
586 Ga0055537_1006604
587 Ga0055524_1000234
588 Ga0055524_1006560
589 Ga0055524_1008881
590 Ga0055524_1016262
591 Ga0055534_1011123
592 Ga0055534_1011642
593 Ga0055528_1002474
594 Ga0055530_10008671
595 Ga0055531_10033093
596 Ga0070683_100014373
597 Ga0070683_100506973
598 Ga0070682_100018971
599 Ga0068868_100223154
600 Ga0070660_100004481
601 Ga0070687_100109015
602 Ga0070661_100198773
603 Ga0070668_100004901
604 Ga0070668_100130364
605 Ga0070668_100503163
606 Ga0070669_100208607
607 Ga0070674_100194342
608 Ga0070688_100271507
609 Ga0070659_100009247
610 Ga0070659_100074720
611 Ga0070659_100130848
612 Ga0070713_100686314
613 Ga0070701_10047723
614 Ga0070711_100061196
615 Ga0070700_100022720
616 Ga0070708_100031336
617 Ga0070708_100058196
618 Ga0070708_100113950
619 Ga0070681_10325911
620 Ga0068867_100240219
621 Ga0070685_10039955
622 Ga0070706_100004098
623 Ga0070706_100016881
624 Ga0070706_100507853
625 Ga0070707_100003448
626 Ga0070707_100166915
627 Ga0070698_100077837
628 Ga0070698_100089243
629 Ga0070699_100000298
630 Ga0070699_100134048
631 Ga0070684_100020890
632 Ga0070684_100035439
633 Ga0070684_100642438
634 Ga0070697_100056441
635 Ga0068853_100001500
636 Ga0068853_100043128
637 Ga0070672_100028650
638 Ga0068855_100001045
639 Ga0068857_100033467
640 Ga0068854_100001196
641 Ga0068856_100045173
642 Ga0070702_100008749
643 Ga0070702_100009006
644 Ga0068852_100000924
645 Ga0068852_100066930
646 Ga0068852_100785124
647 Ga0068864_100096470
648 Ga0068866_10004804
649 Ga0068866_10029454
650 Ga0068861_100067139
651 Ga0068851_10007031
652 Ga0068870_10004500
653 Ga0081538_10016227
654 Ga0081538_10054394
655 Ga0081538_10086006
656 Ga0081540_1088150
657 Ga0081539_10005489
658 Ga0070717_10016423
659 Ga0070717_10092781
660 Ga0075365_10006611
661 Ga0075365_10012036
662 Ga0075368_10004447
663 Ga0075363_100039933
664 Ga0075364_10015616
665 Ga0070712_100015119
666 Ga0075362_10002027
667 Ga0075362_10128102
668 Ga0097621_100256897
669 Ga0075370_10135981
670 Ga0075428_100000043
671 Ga0075428_100101410
672 Ga0075428_100184363
673 Ga0075428_100214647
674 Ga0068865_100025194
675 Ga0068865_100171162
676 Ga0068865_100439834
677 Ga0105251_10001505
678 Ga0105244_10001347
679 Ga0105250_10002004
680 Ga0105240_10029849
681 Ga0111539_10231013
682 Ga0105245_10036539
683 Ga0105245_10042569
684 Ga0105245_10371493
685 Ga0114129_10140385
686 Ga0105243_10033259
687 Ga0105243_10084645
688 Ga0105241_10000156
689 Ga0105237_10068545
690 Ga0105238_10000079
691 Ga0105238_10007164
692 Ga0105238_10037915
693 Ga0105238_10322401
694 Ga0105238_10606292
695 Ga0105249_10061179
696 Ga0105249_10117819
697 Ga0105239_10034546
698 Ga0105239_10050416
699 Ga0105239_10151901
700 Ga0105239_10399812
701 Ga0157369_10002092
702 Ga0157369_10272408
703 Ga0157378_10023032
704 Ga0163162_10077494
705 Ga0157372_10087937
706 Ga0157372_10259217
707 Ga0157375_10041467
708 Ga0157375_10273672
709 Ga0157380_10019890
710 Ga0157380_10323137
711 Ga0157377_10399380
712 Ga0157376_10606287
713 Ga0163161_10100949
714 Ga0206353_10256792
715 Ga0206353_11163641
716 Ga0206353_11427395
717 Ga0213872_10000263
718 Ga0213872_10111713
719 Ga0224712_10056235
720 Ga0209436_100291
721 Ga0209784_100003
722 Ga0209784_100293
723 Ga0209566_100002
724 Ga0209674_100008
725 Ga0209563_100004
726 Ga0207425_1000001
727 Ga0207425_1001467
728 Ga0207425_1001639
729 Ga0209677_100009
730 Ga0209129_1000001
731 Ga0209129_1005030
732 Ga0209565_1000902
733 Ga0209565_1001159
734 Ga0209565_1009721
735 Ga0209565_1014062
736 Ga0209455_1000037
737 Ga0209673_1004849
738 Ga0209675_1000769
739 Ga0209675_1005996
740 Ga0209675_1009461
741 Ga0209564_1001707
742 Ga0209564_1003112
743 Ga0209758_1000073
744 Ga0209758_1002044
745 Ga0209050_1000046
746 Ga0209256_1000044
747 Ga0209256_1002001
748 Ga0209256_1010975
749 Ga0207426_1002103
750 Ga0207426_1003407
751 Ga0209257_1000068
752 Ga0207656_10009161
753 Ga0207655_1001563
754 Ga0207713_1001245
755 Ga0207642_10013933
756 Ga0207688_10003187
757 Ga0207688_10081152
758 Ga0207647_10000033
759 Ga0207647_10016687
760 Ga0207647_10127528
761 Ga0207643_10007047
762 Ga0207684_10012883
763 Ga0207654_10008183
764 Ga0207695_10002681
765 Ga0207671_10041228
766 Ga0207693_10383838
767 Ga0207662_10107878
768 Ga0207657_10001739
769 Ga0207657_10060954
770 Ga0207657_10063062
771 Ga0207646_10000520
772 Ga0207646_10171736
773 Ga0207694_10001799
774 Ga0207694_10020030
775 Ga0207694_10093762
776 Ga0207694_10419684
777 Ga0207687_10051445
778 Ga0207687_10075707
779 Ga0207690_10032879
780 Ga0207706_10037034
781 Ga0207709_10054871
782 Ga0207709_10107392
783 Ga0207704_10031843
784 Ga0207665_10021790
785 Ga0207691_10015968
786 Ga0207711_10365708
787 Ga0207661_10027976
788 Ga0207661_10036828
789 Ga0207661_10199282
790 Ga0207661_10313984
791 Ga0207661_10381712
792 Ga0207667_10002487
793 Ga0207651_10068255
794 Ga0207712_10092846
795 Ga0207668_10008120
796 Ga0207668_10073671
797 Ga0207640_10000460
798 Ga0207658_10050613
799 Ga0207639_10072126
800 Ga0207678_10095644
801 Ga0207708_10000589
802 Ga0207702_10000793
803 Ga0207648_10013560
804 Ga0207648_10402734
805 Ga0207676_10249445
806 Ga0207674_10013896
807 Ga0207674_10378173
808 Ga0207675_100017896
809 Ga0207675_100591083
810 Ga0207698_10013410
811 Ga0207698_10101581
812 Ga0207698_10906986
813 Ga0209282_1000001
814 Ga0207428_10159418
815 Ga0207428_10206860
816 Ga0268264_10278872
817 Ga0265327_10004040
818 Ga0307513_10027389
819 Ga0307408_100000387
820 Ga0307408_100001210
821 Ga0307408_100021297
822 Ga0307408_100628375
823 Ga0307405_10011285
824 Ga0307405_10153812
825 Ga0307405_10463048
826 Ga0307413_10253647
827 Ga0307413_10532512
828 Ga0307410_10019242
829 Ga0307410_10049971
830 Ga0307406_10081331
831 Ga0307406_10445333
832 Ga0307407_10060291
833 Ga0307407_10088370
834 Ga0307409_100003060
835 Ga0307409_100016843
836 Ga0307409_100075207
837 Ga0307409_100468805
838 Ga0307416_100014685
839 Ga0307416_100020341
840 Ga0307416_100404222
841 Ga0307416_100683726
842 Ga0307411_10608273
843 Ga0307415_100009535
844 Ga0307415_100062968
845 Ga0316583_10015566
846 Ga0373950_0005439
847 Ga0373934_0223708
848 Ga0373940_0009630
849 Ga0373953_0011082
850 Ga0373954_0062890
851 Ga0373956_0006754
852 Ga0373943_0147097
853 Ga0373946_0010767
854 Ga0373955_0024911
855 Ga0373955_0210507
856 Ga0373955_0300068
857 Ga0373942_0000328
858 Ga0373924_0125566
859 Ga0373935_0002124
860 Ga0373935_0022512
861 Ga0373933_0008466
862 Ga0373933_0175706
863 Ga0373947_0000003
864 Ga0373937_0138239
865 Ga0373937_0237763
866 Ga0373937_0542575
867 Ga0373925_0304351
868 Ga0373925_0387683
869 Ga0395900_0286281
870 Ga0395900_0680420
871 Ga0395898_0196859
872 Ga0395905_0618281
873 Ga0436364_1208927
874 Ga0395901_0049393
875 Ga0395901_0248924
876 Ga0395901_0850247
877 Ga0400485_14387
878 Ga0400488_33105
879 Ga0400486_21500
880 Ga0436361_0080172
881 Ga0436361_0181426
882 Ga0436361_0715182
883 Ga0451795_0766239
884 Ga0451849_0593111
885 Ga0439445_0025124
886 Ga0439432_069941
887 Ga0439449_0005087
888 Ga0439455_0019950
889 Ga0450893_0028985
890 Ga0451577_0010831
891 Ga0466969_0009652
892 Ga0466969_0010424
893 Ga0466969_0070638
894 Ga0466969_0086919
895 Ga0466972_0047727
896 Ga0466965_0048033
897 Ga0466966_0001445
898 Ga0466966_0096362
899 Ga0466961_0064476
900 Ga0466961_0122029
901 Ga0466963_0388672
902 Ga0453684_0032889
903 Ga0466971_0023125
904 Ga0466970_0006879
905 Ga0466970_0026432
906 Ga0466970_0031436
907 Ga0466957_0090956
908 Ga0466957_0113013
909 Ga0466957_0450243
910 Ga0466960_0035516
911 Ga0466960_0260535
912 Ga0466959_0062467
913 Ga0466959_0069963
914 Ga0466958_0011513
915 Ga0466958_0077113
916 Ga0466958_0087969
917 Ga0466967_0135634
918 Ga0466967_0144720
919 Ga0466967_0313568
920 Ga0466967_0488696
921 Ga0495627_000007
922 Ga0495592_0024366
923 Ga0495590_0008695
924 Ga0495629_0000012
925 Ga0495629_0067480
926 Ga0495638_0061151
927 Ga0495641_0111554
928 Ga0495651_0003407
929 Ga0495653_0058177
930 Ga0495582_0021655
931 Ga0495639_0026775
932 Ga0495662_0001123
933 Ga0495594_0004998
934 Ga0495607_0004150
935 Ga0495583_0004868
936 Ga0495606_0004181
937 Ga0495608_0002781
938 Ga0495608_0020655
939 Ga0495616_0058898
940 Ga0495628_0090078
941 Ga0495630_0158389
942 Ga0495644_0027912
943 Ga0495663_0031250
944 Ga0495652_0050203
945 Ga0495640_0020229
946 Ga0495640_0197073
947 Ga0495586_0241308
948 Ga0495587_0213049
949 Ga0495609_0002949
950 Ga0495609_0003102
951 Ga0495645_0044434
952 Ga0495667_0010954
953 Ga0495668_0000173
954 Ga0495668_0026989
955 Ga0495634_0016004
956 Ga0495634_0035279
957 Ga0495625_0001016
958 Ga0495625_0001679
959 Ga0495635_0001451
960 Ga0495635_0007651
961 Ga0495659_0004469
962 Ga0495661_0017969
963 Ga0495588_0064304
964 Ga0495657_0010506
965 Ga0495599_0115489
966 Ga0495623_0013784
967 Ga0495623_0033174
968 Ga0495646_0055862
969 Ga0495658_0000057
970 Ga0495669_0006988
971 Ga0495613_0002697
972 Ga0495613_0042904
973 Ga0495670_0180051
974 Ga0495600_0025215
975 Ga0495600_0352495
976 Ga0495660_0003426
977 Ga0495660_0014659
978 Ga0495581_0000007
979 Ga0495604_0000834
980 Ga0495604_0014104
981 Ga0495636_0036491
982 Ga0495674_0029245
983 Ga0495674_0035379
984 Ga0495676_0159505
985 Ga0495676_0167164
986 Ga0495680_0012974
987 Ga0495680_0025226
988 Ga0495675_0016249
989 Ga0495675_0019337
990 Ga0495675_0060814
991 Ga0495685_070498
992 Ga0495685_120163
993 Ga0495681_0004664
994 Ga0495681_0022872
995 Ga0495684_0022700
996 Ga0495684_0064187
997 Ga0495686_0425048
998 Ga0495602_0036059
999 Ga0495614_0048470
1000 Ga0495626_0000267
1001 Ga0496101_0131350
1002 Ga0496101_0213712
1003 Ga0496102_0011650
1004 Ga0496103_0006680
1005 Ga0496104_0054457
1006 Ga0496104_0140678
1007 Ga0496104_0457814
1008 Ga0496105_0025490
1009 Ga0496105_0119845
1010 Ga0496107_0187159
1011 Ga0496107_0385983
1012 Ga0496108_0350621
1013 Ga0496108_0628073
1014 Ga0496109_0224892
1015 Ga0496110_0067955
1016 Ga0496110_0172103
1017 Ga0496110_0319209
1018 Ga0496111_0006048
1019 Ga0496112_0007764
1020 Ga0496112_0667391
1021 Ga0496114_0053585
1022 Ga0496114_0100343
1023 Ga0496114_0108317
1024 Ga0496114_0124774
1025 Ga0496114_0207152
1026 Ga0496114_0682967
1027 Ga0496115_0386796
1028 Ga0496117_0024021
1029 Ga0496118_0014701
1030 Ga0496120_0002693
1031 Ga0501306_001055
1032 Ga0501310_000580
1033 Ga0495678_000004
1034 Ga0495678_140658
1035 Ga0495682_0078456
1036 Ga0501311_001778
1037 Ga0501315_000655
1038 Ga0501315_006228
1039 Ga0501031_0043843
1040 Ga0501032_0228082
1041 Ga0501033_0124002
1042 Ga0501036_0086867
1043 Ga0501038_0081904
1044 Ga0501039_0018878
1045 Ga0501040_0017199
1046 Ga0501042_0257449
1047 Ga0501047_0515297
1048 Ga0501048_0147412
1049 Ga0501067_0081461
1050 Ga0501068_0072495
1051 Ga0501069_0317516
1052 Ga0501070_0029135
1053 Ga0501071_0006292
1054 Ga0501072_0039929
1055 Ga0501075_0031277
1056 Ga0501076_0055369
1057 Ga0501077_0047277
1058 Ga0501216_037931
1059 Ga0501227_002589
1060 Ga0501238_001798
1061 Ga0501079_0125998
1062 Ga0501080_0203794
1063 Ga0501081_0347039
1064 Ga0501083_0051045
1065 Ga0501279_001917
1066 Ga0501279_017062
1067 Ga0501035_0024558
1068 Ga0501044_0345679
1069 Ga0501045_0035555
1070 nmdc:mga00v17_7749_c1
1071 nmdc:mga0yw44_2105_c1
1072 nmdc:mga0yw44_230237_c1
1073 nmdc:mga0yw44_42147_c1
1074 nmdc:mga0yw44_7060_c1
1075 nmdc:mga06z11_106199_c1
1076 nmdc:mga07m45_2591_c1
1077 nmdc:mga09592_270402_c1
1078 nmdc:mga0qj67_306087_c1
1079 nmdc:mga06r32_67353_c1
1080 nmdc:mga08y16_200494_c1
1081 nmdc:mga08y16_715192_c1
1082 nmdc:mga0sz30_110914_c1
1083 Ga0495601_0034528
1084 Ga0495619_0024511
1085 Ga0500644_0000050
1086 Ga0500650_0032643
1087 Ga0500573_0027068
1088 Ga0500577_0009374
1089 Ga0500577_0035092
1090 Ga0500577_0092583
1091 Ga0501084_0215614
1092 Ga0590075_001853
1093 Ga0590077_006260
1094 Ga0501082_0093468
1095 Ga0530510_0016407
1096 Ga0530510_0239506
1097 2501941593
1098 2552113964
1099 2552113984
1100 2643786923
1101 2643889919
1102 2643958975
1103 2644019523
1104 2644033872
1105 2644102618
1106 2644118280
1107 2644180590
1108 2644215988
1109 2644512161
1110 2739232751
1111 2808849892
1112 2808899010
1113 2812319649
1114 2812331707
1115 2819739170
1116 2856742713
1117 2857554480
1118 2862575323
1119 2885271109
1120 2887480904
1121 2891565010
1122 2995468117
1123 3006826896
1124 649816049
1125 8001785422
1126 8003861676
1127 8022894106
1128 8055159749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

229

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

281

0.96

PF08659

KR

KR domain

37

211

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sju-assembly1.cif.gz_A hedamycin polyketide ketoreductase bound to nadph 0.9673 5 248
6t62-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii fabg in complex with nadph at 1.8 a resolution 0.9661 4 248
7pcs-assembly1.cif.gz_D structure of the heterotetrameric sdr family member bbscd 0.9648 1 248
4cqm-assembly2.cif.gz_C crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9645 5 248
4cql-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9641 5 248
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9651 4 179 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9649 5 183 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9605 5 248 3.40.50.720
5jy1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9577 5 248 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9565 5 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B3G9J1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9988 4 184
AF-A0A223SAM0-F1-model_v4 Acyl-CoA dehydrogenase 0.9984 4 250 GO:0005886
GO:0016627
GO:0050660
AF-A0A6I5X221-F1-model_v4 SDR family oxidoreductase 0.998 2 249 GO:0016491
AF-A0A6N7CA84-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase MabA 0.9967 3 251 GO:0016491
AF-K1E4Y3-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9962 69 249 GO:0016491

Map