F464219

General Info

Members Datasets Scaffolds Average Seq Length
564 331 505 224

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2600255067|2600814238
Length 245
Sequence HGRLSSVVDREALAAMLVEGADRLRIDLTDAQRAALLDYVALLAKWNAVYNLTAIRDPRQMLIQHVLDSLAIVPHLAPELPRDSAVSVLDVGSGGGLPGIVLAIALPQWSITLNDIVHKKTAFQSQAKAELGLTNLSVVTGRVELLRPGIEVPGKFDVIVSRAFAELADFVTLARNLVSDRGAIWAMKGVRPDAEIDRLPAGSRAMQVVRLEVPFLDAERHLVEVRVDADGVAPTSASGKAEDGG

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
6 2519103095 Burkholderia sp. KJ006 Isolate Nodule
7 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
8 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
9 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
10 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
11 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
12 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
13 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
14 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
15 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
16 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
17 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
18 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
19 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
20 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
21 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
22 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
23 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
24 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
25 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
26 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
27 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
28 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
29 2818991452 Burkholderia cepacia 561 Isolate Unclassified
30 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
31 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
32 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
33 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
34 2904564687 Burkholderia sp. 571 Isolate Unclassified
35 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
36 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
37 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
38 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
39 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
40 2928163908 Burkholderia sp. 567 Isolate Unclassified
41 2928170801 Burkholderia sp. 572 Isolate Unclassified
42 2928536128 Burkholderia sola 565 Isolate Unclassified
43 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
44 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
45 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
51 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
54 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
57 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
58 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
59 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
60 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
61 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
62 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
63 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
209 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
210 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
279 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
305 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
310 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
319 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
320 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
321 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
322 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
323 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
324 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
325 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
326 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
327 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
328 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
329 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
330 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
331 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.36
Metatranscriptomes 0.18
Isolates 10.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 1.6
Rhizoplane 7.09
Rhizosphere 71.1
Stem 0
Stem Tuber 0
Unclassified 11.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008299 3300001979 Bacteria 4147
2 JGI24739J22299_10010415 3300001989 Bacteria 3453
3 JGI24739J22299_10013604 3300001989 Bacteria 2968
4 JGI24739J22299_10017961 3300001989 Bacteria 2546
5 JGI24739J22299_10064324 3300001989 Bacteria 1153
6 JGI24739J22299_10073159 3300001989 Bacteria 1064
7 JGI24737J22298_10002504 3300001990 Bacteria 6532
8 JGI24737J22298_10010270 3300001990 Bacteria 3094
9 JGI24737J22298_10015939 3300001990 Bacteria 2427
10 JGI24735J21928_10000162 3300002067 Bacteria 23762
11 JGI24735J21928_10001613 3300002067 Bacteria 7983
12 JGI24735J21928_10010258 3300002067 Bacteria 2991
13 JGI24735J21928_10088092 3300002067 Bacteria 889
14 JGI24738J21930_10009732 3300002075 Bacteria 2155
15 JGI25156J39149_1000485 3300002705 Bacteria 23858
16 JGI25156J39149_1000815 3300002705 Bacteria 15924
17 JGI25165J46597_1001397 3300003214 Bacteria 13227
18 rootH1_10173721 3300003316 Bacteria 1426
19 rootH2_10009585 3300003320 Bacteria 3008
20 rootH2_10059072 3300003320 Bacteria 1330
21 rootL2_10109129 3300003322 Bacteria 1990
22 rootL2_10109130 3300003322 Bacteria 1346
23 JGI25160J50197_1000016 3300003354 Bacteria 247819
24 Ga0055533_1000331 3300003756 Bacteria 20806
25 Ga0055533_1003159 3300003756 Bacteria 3433
26 Ga0055532_1000022 3300003758 Bacteria 248737
27 Ga0055532_1000999 3300003758 Bacteria 8886
28 Ga0055532_1001455 3300003758 Bacteria 6581
29 Ga0055532_1001471 3300003758 Bacteria 6535
30 Ga0055527_1000016 3300003760 Bacteria 248736
31 Ga0055527_1000645 3300003760 Bacteria 10581
32 Ga0055527_1011892 3300003760 Bacteria 990
33 Ga0055535_1000017 3300003761 Bacteria 248735
34 Ga0055535_1001611 3300003761 Bacteria 10581
35 Ga0055535_1001620 3300003761 Bacteria 10545
36 Ga0055542_1000030 3300003762 Bacteria 248717
37 Ga0055542_1001587 3300003762 Bacteria 10545
38 Ga0055529_1000033 3300003763 Bacteria 248734
39 Ga0055529_1001023 3300003763 Bacteria 13397
40 Ga0058692_1001396 3300003856 Bacteria 8923
41 Ga0065165_1000875 3300005262 Bacteria 38986
42 Ga0070658_10000918 3300005327 Bacteria 25164
43 Ga0070683_100840846 3300005329 Bacteria 880
44 Ga0070690_100597942 3300005330 Bacteria 837
45 Ga0070670_100394947 3300005331 Bacteria 1220
46 Ga0070670_100406326 3300005331 Bacteria 1203
47 Ga0070682_100046562 3300005337 Bacteria 2692
48 Ga0070660_100000108 3300005339 Bacteria 51014
49 Ga0070689_100016265 3300005340 Bacteria 5441
50 Ga0070691_10022656 3300005341 Bacteria 2915
51 Ga0070661_100411394 3300005344 Bacteria 1071
52 Ga0070661_100554793 3300005344 Bacteria 925
53 Ga0070669_100245360 3300005353 Bacteria 1424
54 Ga0070675_100267401 3300005354 Bacteria 1500
55 Ga0070674_100475595 3300005356 Bacteria 1036
56 Ga0070659_100000170 3300005366 Bacteria 50095
57 Ga0070659_100538324 3300005366 Bacteria 999
58 Ga0070667_100008525 3300005367 Bacteria 8498
59 Ga0070667_100035878 3300005367 Bacteria 4156
60 Ga0070663_100001358 3300005455 Bacteria 13375
61 Ga0070663_100006865 3300005455 Bacteria 6890
62 Ga0070663_100052102 3300005455 Bacteria 2918
63 Ga0070663_100302797 3300005455 Bacteria 1280
64 Ga0070678_100180627 3300005456 Bacteria 1727
65 Ga0070662_100126031 3300005457 Bacteria 1968
66 Ga0068867_100051628 3300005459 Bacteria 3033
67 Ga0068853_100083623 3300005539 Bacteria 2797
68 Ga0070686_100142304 3300005544 Bacteria 1671
69 Ga0070695_100206410 3300005545 Bacteria 1407
70 Ga0070696_100020051 3300005546 Bacteria 4533
71 Ga0070693_100019485 3300005547 Bacteria 3557
72 Ga0070665_100111184 3300005548 Bacteria 2742
73 Ga0070665_100269666 3300005548 Bacteria 1704
74 Ga0068855_100027466 3300005563 Bacteria 6807
75 Ga0068855_100073701 3300005563 Bacteria 3966
76 Ga0068855_100216453 3300005563 Bacteria 2150
77 Ga0070664_100111910 3300005564 Bacteria 2383
78 Ga0070664_100237496 3300005564 Bacteria 1635
79 Ga0068854_100010510 3300005578 Bacteria 6005
80 Ga0068854_100579937 3300005578 Bacteria 955
81 Ga0068856_100011026 3300005614 Bacteria 8778
82 Ga0068856_100150902 3300005614 Bacteria 2333
83 Ga0068856_100241297 3300005614 Bacteria 1822
84 Ga0070702_100024955 3300005615 Bacteria 3197
85 Ga0070702_100254180 3300005615 Bacteria 1193
86 Ga0068852_100016544 3300005616 Bacteria 5757
87 Ga0068852_100368792 3300005616 Bacteria 1406
88 Ga0068852_100593927 3300005616 Bacteria 1111
89 Ga0068852_100898661 3300005616 Bacteria 903
90 Ga0068866_10003735 3300005718 Bacteria 6244
91 Ga0068851_10210879 3300005834 Bacteria 1088
92 Ga0068858_100097799 3300005842 Bacteria 2736
93 Ga0068858_100592563 3300005842 Bacteria 1075
94 Ga0068862_100858193 3300005844 Bacteria 890
95 Ga0097621_100572963 3300006237 Bacteria 1029
96 Ga0068871_100032007 3300006358 Bacteria 4150
97 Ga0075434_100072709 3300006871 Bacteria 3431
98 Ga0075434_100164365 3300006871 Bacteria 2239
99 Ga0075434_100215920 3300006871 Bacteria 1938
100 Ga0075436_100385255 3300006914 Bacteria 1014
101 Ga0075435_100073050 3300007076 Bacteria 2803
102 Ga0075435_100448204 3300007076 Bacteria 1113
103 Ga0099794_10009069 3300007265 Bacteria 4158
104 Ga0105251_10040804 3300009011 Bacteria 2262
105 Ga0105251_10117643 3300009011 Bacteria 1208
106 Ga0105244_10030008 3300009036 Bacteria 2897
107 Ga0105244_10201128 3300009036 Bacteria 939
108 Ga0105250_10001203 3300009092 Bacteria 14430
109 Ga0105250_10007917 3300009092 Bacteria 4542
110 Ga0105240_10024211 3300009093 Bacteria 8011
111 Ga0105240_10037252 3300009093 Bacteria 6252
112 Ga0105240_10196566 3300009093 Bacteria 2367
113 Ga0105245_10021830 3300009098 Bacteria 5619
114 Ga0105245_10279196 3300009098 Bacteria 1632
115 Ga0105245_10514925 3300009098 Bacteria 1214
116 Ga0105247_10024939 3300009101 Bacteria 3606
117 Ga0114129_10224888 3300009147 Bacteria 2530
118 Ga0105243_10191585 3300009148 Bacteria 1786
119 Ga0105241_10086316 3300009174 Bacteria 2468
120 Ga0105241_10163500 3300009174 Bacteria 1832
121 Ga0105242_10030014 3300009176 Bacteria 4340
122 Ga0105248_10003137 3300009177 Bacteria 18293
123 Ga0105248_10025295 3300009177 Bacteria 6600
124 Ga0105248_10165770 3300009177 Bacteria 2491
125 Ga0105237_10057000 3300009545 Bacteria 3911
126 Ga0105237_10105760 3300009545 Bacteria 2805
127 Ga0105237_10342861 3300009545 Bacteria 1498
128 Ga0105238_10013204 3300009551 Bacteria 8336
129 Ga0105238_10037160 3300009551 Bacteria 4952
130 Ga0105238_10071212 3300009551 Bacteria 3474
131 Ga0105238_10101465 3300009551 Bacteria 2860
132 Ga0105238_10160402 3300009551 Bacteria 2224
133 Ga0105238_10406566 3300009551 Bacteria 1355
134 Ga0105249_10177069 3300009553 Bacteria 2072
135 Ga0105239_10342597 3300010375 Bacteria 1687
136 Ga0105239_10779243 3300010375 Bacteria 1095
137 Ga0105246_10065071 3300011119 Bacteria 2549
138 Ga0105246_10075192 3300011119 Bacteria 2390
139 Ga0157373_10044313 3300013100 Bacteria 3176
140 Ga0157373_10081277 3300013100 Bacteria 2284
141 Ga0157370_10003903 3300013104 Bacteria 17377
142 Ga0157370_10016492 3300013104 Bacteria 7476
143 Ga0157370_10149851 3300013104 Bacteria 2171
144 Ga0157369_10000304 3300013105 Bacteria 65926
145 Ga0157369_10006755 3300013105 Bacteria 13242
146 Ga0157369_10249569 3300013105 Bacteria 1852
147 Ga0157374_10043146 3300013296 Bacteria 4164
148 Ga0157374_10547127 3300013296 Bacteria 1165
149 Ga0157378_10034654 3300013297 Bacteria 4464
150 Ga0157378_10173094 3300013297 Bacteria 2026
151 Ga0163162_10004087 3300013306 Bacteria 14005
152 Ga0163162_10061423 3300013306 Bacteria 3796
153 Ga0163162_10391066 3300013306 Bacteria 1523
154 Ga0163162_10424534 3300013306 Bacteria 1462
155 Ga0157372_10204161 3300013307 Bacteria 2290
156 Ga0157372_10421301 3300013307 Bacteria 1556
157 Ga0157372_10588090 3300013307 Bacteria 1297
158 Ga0157375_10025697 3300013308 Bacteria 5478
159 Ga0182006_1074354 3300015261 Bacteria 1252
160 Ga0182007_10005679 3300015262 Bacteria 5444
161 Ga0182005_1051205 3300015265 Bacteria 1123
162 Ga0183361_10001 3300016635 Bacteria 908583
163 Ga0163161_10009486 3300017792 Bacteria 6736
164 Ga0163161_10083711 3300017792 Bacteria 2351
165 Ga0224712_10000828 3300022467 Bacteria 6562
166 Ga0209566_100264 3300025225 Bacteria 49372
167 Ga0209674_100017 3300025226 Bacteria 689087
168 Ga0209674_100291 3300025226 Bacteria 35684
169 Ga0209674_104103 3300025226 Bacteria 2457
170 Ga0209672_100001 3300025228 Bacteria 2828210
171 Ga0209672_100115 3300025228 Bacteria 89213
172 Ga0209672_100136 3300025228 Bacteria 72753
173 Ga0209147_100022 3300025229 Bacteria 443906
174 Ga0209147_100164 3300025229 Bacteria 90422
175 Ga0209147_100215 3300025229 Bacteria 60346
176 Ga0209147_100360 3300025229 Bacteria 32565
177 Ga0209563_107328 3300025230 Bacteria 1819
178 Ga0207427_100535 3300025231 Bacteria 19800
179 Ga0209258_100033 3300025242 Bacteria 443845
180 Ga0209258_100261 3300025242 Bacteria 90726
181 Ga0209258_100271 3300025242 Bacteria 89095
182 Ga0209148_1000046 3300025254 Bacteria 443881
183 Ga0209148_1000104 3300025254 Bacteria 214254
184 Ga0209148_1000609 3300025254 Bacteria 32035
185 Ga0209759_1000231 3300025256 Bacteria 83320
186 Ga0209759_1000568 3300025256 Bacteria 37118
187 Ga0209759_1003271 3300025256 Bacteria 6549
188 Ga0209233_1000050 3300025261 Bacteria 450736
189 Ga0209455_1000038 3300025272 Bacteria 443899
190 Ga0209455_1000097 3300025272 Bacteria 214136
191 Ga0209673_1000124 3300025273 Bacteria 169015
192 Ga0209130_1006233 3300025284 Bacteria 3920
193 Ga0209564_1002969 3300025295 Bacteria 12201
194 Ga0209564_1005509 3300025295 Bacteria 7181
195 Ga0207426_1000007 3300025302 Bacteria 971011
196 Ga0207426_1001933 3300025302 Bacteria 14885
197 Ga0207696_1013061 3300025711 Bacteria 2911
198 Ga0207696_1041956 3300025711 Bacteria 1334
199 Ga0207655_1045261 3300025728 Bacteria 1839
200 Ga0207713_1013154 3300025735 Bacteria 4379
201 Ga0207713_1037975 3300025735 Bacteria 2048
202 Ga0207642_10003284 3300025899 Bacteria 5083
203 Ga0207688_10035584 3300025901 Bacteria 2759
204 Ga0207680_10041765 3300025903 Bacteria 2678
205 Ga0207647_10018758 3300025904 Bacteria 4669
206 Ga0207647_10031703 3300025904 Bacteria 3399
207 Ga0207647_10245813 3300025904 Bacteria 1027
208 Ga0207645_10066468 3300025907 Bacteria 2305
209 Ga0207705_10002099 3300025909 Bacteria 15494
210 Ga0207684_10542657 3300025910 Bacteria 995
211 Ga0207695_10019692 3300025913 Bacteria 7760
212 Ga0207695_10142456 3300025913 Bacteria 2344
213 Ga0207695_10449574 3300025913 Bacteria 1172
214 Ga0207671_10032399 3300025914 Bacteria 3891
215 Ga0207671_10184615 3300025914 Bacteria 1624
216 Ga0207693_10022544 3300025915 Bacteria 5003
217 Ga0207657_10001682 3300025919 Bacteria 23847
218 Ga0207681_10232208 3300025923 Bacteria 1432
219 Ga0207694_10011178 3300025924 Bacteria 6776
220 Ga0207694_10014967 3300025924 Bacteria 5850
221 Ga0207694_10680967 3300025924 Bacteria 867
222 Ga0207687_10023608 3300025927 Bacteria 4102
223 Ga0207687_10186865 3300025927 Bacteria 1609
224 Ga0207700_10885663 3300025928 Unclassified 799
225 Ga0207644_10061049 3300025931 Bacteria 2729
226 Ga0207690_10000012 3300025932 Bacteria 269610
227 Ga0207690_10112002 3300025932 Bacteria 1967
228 Ga0207690_10617377 3300025932 Bacteria 886
229 Ga0207706_10143720 3300025933 Bacteria 2099
230 Ga0207669_10025613 3300025937 Bacteria 3192
231 Ga0207711_10028161 3300025941 Bacteria 4726
232 Ga0207711_10220613 3300025941 Bacteria 1734
233 Ga0207689_10171064 3300025942 Bacteria 1791
234 Ga0207661_10667285 3300025944 Bacteria 956
235 Ga0207679_10268726 3300025945 Bacteria 1458
236 Ga0207679_10996291 3300025945 Bacteria 768
237 Ga0207667_10004701 3300025949 Bacteria 16704
238 Ga0207667_10037447 3300025949 Bacteria 5184
239 Ga0207712_10123516 3300025961 Bacteria 1962
240 Ga0207640_10058856 3300025981 Bacteria 2533
241 Ga0207658_10021654 3300025986 Bacteria 4465
242 Ga0207658_10591837 3300025986 Bacteria 996
243 Ga0207677_10400561 3300026023 Bacteria 1164
244 Ga0207703_10077256 3300026035 Bacteria 2764
245 Ga0207678_10000076 3300026067 Bacteria 78938
246 Ga0207678_10014544 3300026067 Bacteria 6923
247 Ga0207678_10050329 3300026067 Bacteria 3600
248 Ga0207678_10301727 3300026067 Bacteria 1376
249 Ga0207702_10030946 3300026078 Bacteria 4460
250 Ga0207702_10040850 3300026078 Bacteria 3888
251 Ga0207702_10261554 3300026078 Bacteria 1629
252 Ga0207648_10086407 3300026089 Bacteria 2736
253 Ga0207683_10000243 3300026121 Bacteria 48324
254 Ga0207698_10033021 3300026142 Bacteria 3756
255 Ga0207698_10343405 3300026142 Bacteria 1407
256 Ga0207698_10553592 3300026142 Bacteria 1128
257 Ga0209371_1000185 3300027312 Bacteria 90613
258 Ga0209371_1006051 3300027312 Bacteria 4602
259 Ga0265338_10000590 3300028800 Bacteria 64098
260 Ga0268256_1000847 3300030500 Bacteria 21660
261 Ga0307405_10182246 3300031731 Bacteria 1509
262 Ga0307412_10000011 3300031911 Bacteria 405842
263 Ga0307412_10249652 3300031911 Bacteria 1377
264 Ga0373936_0024041 3300035113 Bacteria 2377
265 Ga0373936_0201657 3300035113 Bacteria 878
266 Ga0373943_0120401 3300035170 Bacteria 1394
267 Ga0373942_0030269 3300035207 Bacteria 1425
268 Ga0373933_0101332 3300035724 Bacteria 1787
269 Ga0373937_0004534 3300036401 Bacteria 11799
270 Ga0373925_0355836 3300037068 Bacteria 1189
271 Ga0395899_0000149 3300037312 Bacteria 105958
272 Ga0395899_0020448 3300037312 Bacteria 5018
273 Ga0395899_0116777 3300037312 Bacteria 1914
274 Ga0395900_0001006 3300037418 Bacteria 36517
275 Ga0395900_0013273 3300037418 Bacteria 8422
276 Ga0395900_0021791 3300037418 Bacteria 6551
277 Ga0395900_0047585 3300037418 Bacteria 4416
278 Ga0395900_0086440 3300037418 Bacteria 3223
279 Ga0395900_0133544 3300037418 Bacteria 2543
280 Ga0395898_0001927 3300037466 Bacteria 26381
281 Ga0395898_0017398 3300037466 Bacteria 7344
282 Ga0395905_0000079 3300037471 Bacteria 160663
283 Ga0395901_0000017 3300038443 Bacteria 345003
284 Ga0395901_0000560 3300038443 Bacteria 43097
285 Ga0395901_0001431 3300038443 Bacteria 24880
286 Ga0395901_0068750 3300038443 Bacteria 3689
287 Ga0436360_1119489 3300039438 Bacteria 912
288 Ga0436361_0710261 3300039447 Bacteria 2418
289 Ga0451839_1319518 3300041496 Bacteria 943
290 Ga0466969_0022111 3300044656 Bacteria 3285
291 Ga0466972_0030610 3300044658 Bacteria 2649
292 Ga0466972_0168151 3300044658 Bacteria 1029
293 Ga0466973_0003647 3300044659 Bacteria 12557
294 Ga0466974_0072964 3300044660 Bacteria 2292
295 Ga0466982_0267918 3300044672 Bacteria 990
296 Ga0466965_0000641 3300044683 Bacteria 12822
297 Ga0466965_0146277 3300044683 Bacteria 1233
298 Ga0466966_0000753 3300044684 Bacteria 20547
299 Ga0466966_0008454 3300044684 Bacteria 6814
300 Ga0466966_0049476 3300044684 Bacteria 2677
301 Ga0466966_0091821 3300044684 Bacteria 1884
302 Ga0466961_0001307 3300044693 Bacteria 15368
303 Ga0466961_0008416 3300044693 Bacteria 6567
304 Ga0466961_0011964 3300044693 Bacteria 5545
305 Ga0466961_0075478 3300044693 Bacteria 2137
306 Ga0466963_0007936 3300044694 Bacteria 6355
307 Ga0466963_0022467 3300044694 Bacteria 3995
308 Ga0466963_0092715 3300044694 Bacteria 2058
309 Ga0466963_0211859 3300044694 Bacteria 1356
310 Ga0466964_0005966 3300044706 Bacteria 4539
311 Ga0466964_0027519 3300044706 Bacteria 2233
312 Ga0453684_0955893 3300044712 Unclassified 914
313 Ga0466971_0002927 3300044719 Bacteria 7245
314 Ga0466971_0015476 3300044719 Bacteria 3357
315 Ga0466971_0088636 3300044719 Bacteria 1415
316 Ga0466971_0155401 3300044719 Bacteria 1069
317 Ga0466968_0017301 3300044735 Bacteria 2880
318 Ga0466968_0335245 3300044735 Bacteria 733
319 Ga0466970_0063832 3300044765 Bacteria 1974
320 Ga0466957_0016390 3300044842 Bacteria 4335
321 Ga0466957_0026909 3300044842 Bacteria 3414
322 Ga0466957_0037153 3300044842 Bacteria 2932
323 Ga0466957_0080762 3300044842 Bacteria 2024
324 Ga0466957_0084923 3300044842 Bacteria 1976
325 Ga0466960_0147431 3300044901 Bacteria 1254
326 Ga0466959_0023662 3300045049 Bacteria 4546
327 Ga0466959_0103802 3300045049 Bacteria 2033
328 Ga0466959_0391823 3300045049 Bacteria 945
329 Ga0466958_0002823 3300045836 Bacteria 8840
330 Ga0466958_0030993 3300045836 Bacteria 3178
331 Ga0466958_0151390 3300045836 Bacteria 1463
332 Ga0495592_0049359 3300046454 Bacteria 3128
333 Ga0495603_0045773 3300046455 Bacteria 2608
334 Ga0495590_0001307 3300046457 Bacteria 10826
335 Ga0495590_0006325 3300046457 Bacteria 4634
336 Ga0495629_0046954 3300046459 Bacteria 3028
337 Ga0495629_0230428 3300046459 Bacteria 1277
338 Ga0495638_0003608 3300046460 Bacteria 12099
339 Ga0495651_0221713 3300046462 Bacteria 1308
340 Ga0495653_0035440 3300046463 Bacteria 3937
341 Ga0495653_0049688 3300046463 Bacteria 3229
342 Ga0495650_0011531 3300046471 Bacteria 4833
343 Ga0495650_0045027 3300046471 Bacteria 1860
344 Ga0495650_0162188 3300046471 Bacteria 796
345 Ga0495580_0009192 3300046472 Bacteria 7789
346 Ga0495580_0019564 3300046472 Bacteria 5030
347 Ga0495605_0010235 3300046474 Bacteria 5252
348 Ga0495605_0044590 3300046474 Bacteria 2192
349 Ga0495605_0287892 3300046474 Bacteria 697
350 Ga0495639_0091698 3300046475 Bacteria 1426
351 Ga0495664_0023768 3300046477 Bacteria 3557
352 Ga0495664_0279785 3300046477 Bacteria 1008
353 Ga0495585_0011407 3300046492 Bacteria 5258
354 Ga0495596_0037491 3300046500 Bacteria 1916
355 Ga0495606_0012434 3300046507 Bacteria 6824
356 Ga0495606_0012702 3300046507 Bacteria 6720
357 Ga0495606_0013933 3300046507 Bacteria 6309
358 Ga0495608_0041099 3300046511 Bacteria 3096
359 Ga0495610_0002064 3300046512 Bacteria 17146
360 Ga0495620_0053869 3300046515 Bacteria 1702
361 Ga0495628_0037208 3300046516 Bacteria 3902
362 Ga0495628_0057173 3300046516 Bacteria 3069
363 Ga0495628_0160510 3300046516 Bacteria 1708
364 Ga0495628_0264639 3300046516 Bacteria 1280
365 Ga0495630_0008445 3300046517 Bacteria 7391
366 Ga0495631_0080811 3300046518 Bacteria 1402
367 Ga0495643_0130923 3300046522 Bacteria 1259
368 Ga0495666_0005713 3300046526 Bacteria 6270
369 Ga0495642_0045310 3300046528 Bacteria 1797
370 Ga0495642_0066975 3300046528 Bacteria 1497
371 Ga0495652_0012402 3300046529 Bacteria 7689
372 Ga0495652_0097119 3300046529 Bacteria 2397
373 Ga0495665_0035137 3300046531 Bacteria 2678
374 Ga0495665_0097399 3300046531 Bacteria 1544
375 Ga0495640_0054639 3300046533 Bacteria 2734
376 Ga0495586_0046564 3300046535 Bacteria 2338
377 Ga0495621_0001060 3300046539 Bacteria 7042
378 Ga0495621_0092959 3300046539 Bacteria 1139
379 Ga0495597_0107347 3300046542 Bacteria 1173
380 Ga0495622_0039090 3300046557 Bacteria 2209
381 Ga0495667_0120201 3300046559 Bacteria 1696
382 Ga0495668_0135325 3300046616 Bacteria 1349
383 Ga0495634_0016007 3300046642 Bacteria 5372
384 Ga0495635_0014181 3300046663 Bacteria 5577
385 Ga0495635_0067155 3300046663 Bacteria 2460
386 Ga0495635_0499510 3300046663 Bacteria 801
387 Ga0495588_0152624 3300046674 Bacteria 1221
388 Ga0495657_0042521 3300046675 Bacteria 3102
389 Ga0495623_0010886 3300046679 Bacteria 5889
390 Ga0495646_0008207 3300046680 Bacteria 6638
391 Ga0495646_0070875 3300046680 Bacteria 2052
392 Ga0495669_0031092 3300046684 Bacteria 2344
393 Ga0495613_0122706 3300046689 Bacteria 1865
394 Ga0495624_0026337 3300046690 Bacteria 3812
395 Ga0495671_0055001 3300046692 Bacteria 1972
396 Ga0495649_0049480 3300046694 Bacteria 2283
397 Ga0495649_0054377 3300046694 Bacteria 2165
398 Ga0495649_0095142 3300046694 Bacteria 1586
399 Ga0495649_0289597 3300046694 Bacteria 835
400 Ga0495589_0006136 3300046794 Bacteria 6347
401 Ga0495589_0148657 3300046794 Bacteria 1119
402 Ga0495600_0071757 3300046809 Bacteria 2262
403 Ga0495600_0238219 3300046809 Bacteria 1160
404 Ga0495581_0003276 3300047315 Bacteria 9290
405 Ga0495604_0821000 3300047317 Bacteria 585
406 Ga0495674_0045193 3300047319 Bacteria 3911
407 Ga0495674_0077394 3300047319 Bacteria 2860
408 Ga0495674_0159070 3300047319 Bacteria 1890
409 Ga0495672_0018782 3300047320 Bacteria 4578
410 Ga0495672_0025657 3300047320 Bacteria 3767
411 Ga0495672_0250731 3300047320 Bacteria 859
412 Ga0495680_0002302 3300047322 Bacteria 19622
413 Ga0495680_0018900 3300047322 Bacteria 5835
414 Ga0495683_0008442 3300047323 Bacteria 5509
415 Ga0495683_0020350 3300047323 Bacteria 3423
416 Ga0495683_0040197 3300047323 Bacteria 2362
417 Ga0495687_000053 3300047443 Bacteria 195897
418 Ga0495687_013231 3300047443 Bacteria 4318
419 Ga0495687_014777 3300047443 Bacteria 3998
420 Ga0495687_082974 3300047443 Bacteria 1249
421 Ga0495675_0118910 3300047444 Bacteria 1646
422 Ga0495675_0200222 3300047444 Bacteria 1216
423 Ga0495679_019418 3300047446 Bacteria 2389
424 Ga0495685_114577 3300047447 Bacteria 886
425 Ga0495673_0004942 3300047469 Bacteria 8205
426 Ga0495686_0000519 3300047472 Bacteria 55675
427 Ga0495593_0001073 3300047673 Bacteria 15971
428 Ga0495593_0058962 3300047673 Bacteria 2012
429 Ga0495614_0000394 3300048089 Bacteria 17743
430 Ga0495626_0027833 3300048091 Bacteria 2745
431 Ga0496100_0051349 3300048903 Bacteria 2676
432 Ga0496100_0073174 3300048903 Bacteria 2293
433 Ga0496100_0475555 3300048903 Bacteria 960
434 Ga0496101_0041404 3300048904 Bacteria 3284
435 Ga0496101_0121926 3300048904 Bacteria 1971
436 Ga0496102_0019578 3300048905 Bacteria 5962
437 Ga0496102_0021631 3300048905 Bacteria 5690
438 Ga0496102_0022182 3300048905 Bacteria 5623
439 Ga0496102_0184399 3300048905 Bacteria 1966
440 Ga0496103_0044831 3300048906 Bacteria 2726
441 Ga0496103_0080956 3300048906 Bacteria 2042
442 Ga0496103_0308921 3300048906 Bacteria 1017
443 Ga0496104_0006859 3300048907 Bacteria 10038
444 Ga0496104_0071060 3300048907 Bacteria 3309
445 Ga0496104_0147271 3300048907 Bacteria 2261
446 Ga0496104_0164683 3300048907 Bacteria 2126
447 Ga0496105_0021948 3300048908 Bacteria 5168
448 Ga0496105_0100945 3300048908 Bacteria 2383
449 Ga0496105_0113599 3300048908 Bacteria 2234
450 Ga0496105_0162607 3300048908 Bacteria 1832
451 Ga0496106_0005601 3300048909 Bacteria 9298
452 Ga0496106_0010079 3300048909 Bacteria 6979
453 Ga0496106_0096360 3300048909 Bacteria 2289
454 Ga0496106_0723584 3300048909 Bacteria 792
455 Ga0496107_0018086 3300048910 Bacteria 4958
456 Ga0496107_0037776 3300048910 Bacteria 3466
457 Ga0496108_0023455 3300048911 Bacteria 5078
458 Ga0496110_0159185 3300048913 Bacteria 2046
459 Ga0496110_0861552 3300048913 Bacteria 811
460 Ga0496111_0622369 3300048914 Bacteria 789
461 Ga0496112_0021662 3300048915 Bacteria 6114
462 Ga0496112_0686200 3300048915 Bacteria 952
463 Ga0496114_0109376 3300048917 Bacteria 2367
464 Ga0496115_0061709 3300048918 Bacteria 3023
465 Ga0496115_0440748 3300048918 Bacteria 1053
466 Ga0496116_0188134 3300048919 Bacteria 1096
467 Ga0496116_0190855 3300048919 Bacteria 1085
468 Ga0496117_0005096 3300048920 Bacteria 14050
469 Ga0496117_0033695 3300048920 Bacteria 3869
470 Ga0496117_0049094 3300048920 Bacteria 3006
471 Ga0496117_0102980 3300048920 Bacteria 1800
472 Ga0496118_0002738 3300048921 Bacteria 23192
473 Ga0496118_0009248 3300048921 Bacteria 10001
474 Ga0496118_0028658 3300048921 Bacteria 4684
475 Ga0496118_0102162 3300048921 Bacteria 1933
476 Ga0496118_0235976 3300048921 Bacteria 1051
477 Ga0496119_0054052 3300048922 Bacteria 2448
478 Ga0496119_0080480 3300048922 Bacteria 1879
479 Ga0496119_0219065 3300048922 Bacteria 975
480 Ga0496121_0003102 3300048924 Bacteria 24024
481 Ga0496121_0028785 3300048924 Bacteria 5161
482 Ga0496121_0036653 3300048924 Bacteria 4367
483 Ga0496121_0071196 3300048924 Bacteria 2797
484 Ga0496122_0095549 3300048925 Bacteria 2008
485 Ga0496123_0010042 3300048926 Bacteria 8430
486 Ga0496123_0036711 3300048926 Bacteria 3470
487 Ga0496123_0056115 3300048926 Bacteria 2578
488 Ga0496124_0061443 3300048927 Bacteria 3149
489 Ga0496125_0026123 3300048928 Bacteria 5332
490 Ga0496125_0439180 3300048928 Bacteria 751
491 Ga0496126_0000118 3300048929 Bacteria 184719
492 Ga0496126_0195437 3300048929 Bacteria 1711
493 Ga0495678_047755 3300049459 Bacteria 1674
494 Ga0495682_0013009 3300049460 Bacteria 3175
495 Ga0501039_1258505 3300049575 Bacteria 571
496 Ga0501079_0778626 3300049741 Bacteria 753
497 Ga0501280_001070 3300049776 Bacteria 5549
498 nmdc:mga0n895_529811_c1 3300050512 Bacteria 1185
499 nmdc:mga0rr50_464926_c1 3300050513 Bacteria 1073
500 nmdc:mga0rr50_672165_c1 3300050513 Bacteria 884
501 nmdc:mga08x19_361868_c1 3300050514 Bacteria 1014
502 Ga0466962_0000108 3300061719 Bacteria 33805
503 Ga0466962_0006095 3300061719 Bacteria 5796
504 Ga0466962_0024285 3300061719 Bacteria 2912
505 Ga0466962_0074750 3300061719 Bacteria 1619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_1258505 Ga0501039_1258505_20_550 175
2 3300047317 Ga0495604_0821000 Ga0495604_0821000_10_561 183
3 3300044735 Ga0466968_0017301 Ga0466968_0017301_2285_2869 186
4 3300046462 Ga0495651_0221713 Ga0495651_0221713_10_576 188
5 3300046533 Ga0495640_0054639 Ga0495640_0054639_20_613 197
6 3300002075 JGI24738J21930_10009732 JGI24738J21930_100097323 199
7 3300005844 Ga0068862_100858193 Ga0068862_1008581931 199
8 3300031731 Ga0307405_10182246 Ga0307405_101822462 199
9 3300031911 Ga0307412_10249652 Ga0307412_102496522 199
10 3300049741 Ga0501079_0778626 Ga0501079_0778626_133_741 199
11 3300005544 Ga0070686_100142304 Ga0070686_1001423041 201
12 3300005615 Ga0070702_100254180 Ga0070702_1002541802 201
13 3300041496 Ga0451839_1319518 Ga0451839_1319518_161_781 203
14 3300046674 Ga0495588_0152624 Ga0495588_0152624_15_653 206
15 3300007265 Ga0099794_10009069 Ga0099794_100090693 207
16 3300044712 Ga0453684_0955893 Ga0453684_0955893_57_689 207
17 3300005341 Ga0070691_10022656 Ga0070691_100226562 208
18 3300005356 Ga0070674_100475595 Ga0070674_1004755952 208
19 3300005367 Ga0070667_100008525 Ga0070667_1000085255 208
20 3300005457 Ga0070662_100126031 Ga0070662_1001260312 208
21 3300005459 Ga0068867_100051628 Ga0068867_1000516282 208
22 3300005545 Ga0070695_100206410 Ga0070695_1002064102 208
23 3300005546 Ga0070696_100020051 Ga0070696_1000200512 208
24 3300005547 Ga0070693_100019485 Ga0070693_1000194855 208
25 3300005578 Ga0068854_100010510 Ga0068854_1000105105 208
26 3300005614 Ga0068856_100241297 Ga0068856_1002412972 208
27 3300005615 Ga0070702_100024955 Ga0070702_1000249553 208
28 3300005616 Ga0068852_100593927 Ga0068852_1005939272 208
29 3300005718 Ga0068866_10003735 Ga0068866_100037358 208
30 3300006237 Ga0097621_100572963 Ga0097621_1005729631 208
31 3300006358 Ga0068871_100032007 Ga0068871_1000320072 208
32 3300006871 Ga0075434_100072709 Ga0075434_1000727094 208
33 3300006871 Ga0075434_100164365 Ga0075434_1001643653 208
34 3300006914 Ga0075436_100385255 Ga0075436_1003852552 208
35 3300007076 Ga0075435_100073050 Ga0075435_1000730502 208
36 3300007076 Ga0075435_100448204 Ga0075435_1004482042 208
37 3300009098 Ga0105245_10021830 Ga0105245_100218303 208
38 3300009148 Ga0105243_10191585 Ga0105243_101915852 208
39 3300009174 Ga0105241_10086316 Ga0105241_100863162 208
40 3300009176 Ga0105242_10030014 Ga0105242_100300142 208
41 3300009177 Ga0105248_10165770 Ga0105248_101657703 208
42 3300009551 Ga0105238_10037160 Ga0105238_100371602 208
43 3300013105 Ga0157369_10249569 Ga0157369_102495693 208
44 3300013297 Ga0157378_10034654 Ga0157378_100346545 208
45 3300013306 Ga0163162_10061423 Ga0163162_100614232 208
46 3300017792 Ga0163161_10009486 Ga0163161_100094863 208
47 3300025899 Ga0207642_10003284 Ga0207642_100032845 208
48 3300025907 Ga0207645_10066468 Ga0207645_100664682 208
49 3300025910 Ga0207684_10542657 Ga0207684_105426572 208
50 3300025915 Ga0207693_10022544 Ga0207693_100225447 208
51 3300025927 Ga0207687_10023608 Ga0207687_100236083 208
52 3300025928 Ga0207700_10885663 Ga0207700_108856631 208
53 3300025931 Ga0207644_10061049 Ga0207644_100610492 208
54 3300025932 Ga0207690_10112002 Ga0207690_101120022 208
55 3300025933 Ga0207706_10143720 Ga0207706_101437202 208
56 3300025937 Ga0207669_10025613 Ga0207669_100256133 208
57 3300025941 Ga0207711_10220613 Ga0207711_102206132 208
58 3300025942 Ga0207689_10171064 Ga0207689_101710642 208
59 3300025981 Ga0207640_10058856 Ga0207640_100588563 208
60 3300026023 Ga0207677_10400561 Ga0207677_104005612 208
61 3300026089 Ga0207648_10086407 Ga0207648_100864072 208
62 3300026121 Ga0207683_10000243 Ga0207683_1000024339 208
63 3300026142 Ga0207698_10553592 Ga0207698_105535922 208
64 3300035113 Ga0373936_0201657 Ga0373936_0201657_17_652 208
65 3300035170 Ga0373943_0120401 Ga0373943_0120401_692_1333 208
66 3300035207 Ga0373942_0030269 Ga0373942_0030269_237_872 208
67 3300035724 Ga0373933_0101332 Ga0373933_0101332_535_1176 208
68 3300036401 Ga0373937_0004534 Ga0373937_0004534_7818_8459 208
69 3300037068 Ga0373925_0355836 Ga0373925_0355836_184_825 208
70 3300046539 Ga0495621_0001060 Ga0495621_0001060_6196_6837 208
71 3300046663 Ga0495635_0499510 Ga0495635_0499510_101_742 208
72 3300048909 Ga0496106_0096360 Ga0496106_0096360_729_1370 208
73 3300050513 nmdc:mga0rr50_464926_c1 nmdc:mga0rr50_464926_c1_257_892 208
74 3300050514 nmdc:mga08x19_361868_c1 nmdc:mga08x19_361868_c1_229_864 208
75 iso_pu_bacteria 2519103095 2519457306 208
76 iso_pu_bacteria 2863421361 2863425395 208
77 iso_pu_bacteria 2904564687 2904570141 208
78 iso_pu_bacteria 2904571731 2904577327 208
79 iso_pu_bacteria 2928536128 2928541484 208
80 3300005330 Ga0070690_100597942 Ga0070690_1005979422 209
81 3300005340 Ga0070689_100016265 Ga0070689_1000162651 209
82 3300009147 Ga0114129_10224888 Ga0114129_102248882 209
83 3300035113 Ga0373936_0024041 Ga0373936_0024041_1451_2089 209
84 3300046475 Ga0495639_0091698 Ga0495639_0091698_700_1338 209
85 3300049776 Ga0501280_001070 Ga0501280_001070_3603_4244 209
86 3300046528 Ga0495642_0066975 Ga0495642_0066975_155_823 211
87 3300046539 Ga0495621_0092959 Ga0495621_0092959_275_940 211
88 3300047443 Ga0495687_014777 Ga0495687_014777_447_1115 211
89 3300048903 Ga0496100_0073174 Ga0496100_0073174_750_1415 211
90 3300048905 Ga0496102_0021631 Ga0496102_0021631_3229_3894 211
91 3300048906 Ga0496103_0080956 Ga0496103_0080956_493_1158 211
92 3300048908 Ga0496105_0021948 Ga0496105_0021948_1143_1808 211
93 3300048911 Ga0496108_0023455 Ga0496108_0023455_29_694 211
94 3300048917 Ga0496114_0109376 Ga0496114_0109376_862_1527 211
95 3300005331 Ga0070670_100406326 Ga0070670_1004063261 212
96 3300005337 Ga0070682_100046562 Ga0070682_1000465622 212
97 3300005344 Ga0070661_100411394 Ga0070661_1004113942 212
98 3300005354 Ga0070675_100267401 Ga0070675_1002674012 212
99 3300005366 Ga0070659_100538324 Ga0070659_1005383242 212
100 3300005564 Ga0070664_100111910 Ga0070664_1001119102 212
101 3300005578 Ga0068854_100579937 Ga0068854_1005799372 212
102 3300005616 Ga0068852_100898661 Ga0068852_1008986612 212
103 3300005834 Ga0068851_10210879 Ga0068851_102108792 212
104 3300025932 Ga0207690_10617377 Ga0207690_106173771 212
105 3300025986 Ga0207658_10591837 Ga0207658_105918372 212
106 3300037418 Ga0395900_0133544 Ga0395900_0133544_1525_2199 212
107 3300044735 Ga0466968_0335245 Ga0466968_0335245_34_672 212
108 3300050512 nmdc:mga0n895_529811_c1 nmdc:mga0n895_529811_c1_85_747 212
109 3300005564 Ga0070664_100237496 Ga0070664_1002374961 213
110 3300005614 Ga0068856_100011026 Ga0068856_10001102611 213
111 3300005614 Ga0068856_100150902 Ga0068856_1001509023 213
112 3300006871 Ga0075434_100215920 Ga0075434_1002159202 213
113 3300013100 Ga0157373_10044313 Ga0157373_100443133 213
114 3300013307 Ga0157372_10204161 Ga0157372_102041613 213
115 3300025945 Ga0207679_10268726 Ga0207679_102687262 213
116 3300026078 Ga0207702_10040850 Ga0207702_100408502 213
117 3300026078 Ga0207702_10261554 Ga0207702_102615542 213
118 3300048909 Ga0496106_0723584 Ga0496106_0723584_92_775 213
119 3300048913 Ga0496110_0861552 Ga0496110_0861552_38_703 213
120 3300050513 nmdc:mga0rr50_672165_c1 nmdc:mga0rr50_672165_c1_121_792 213
121 3300044658 Ga0466972_0030610 Ga0466972_0030610_1232_1921 214
122 3300044659 Ga0466973_0003647 Ga0466973_0003647_9299_9988 214
123 3300044683 Ga0466965_0000641 Ga0466965_0000641_5048_5737 214
124 3300044684 Ga0466966_0091821 Ga0466966_0091821_403_1092 214
125 3300044693 Ga0466961_0001307 Ga0466961_0001307_4875_5564 214
126 3300044694 Ga0466963_0007936 Ga0466963_0007936_874_1563 214
127 3300044706 Ga0466964_0005966 Ga0466964_0005966_2025_2714 214
128 3300044719 Ga0466971_0015476 Ga0466971_0015476_771_1460 214
129 3300044842 Ga0466957_0080762 Ga0466957_0080762_81_770 214
130 3300045049 Ga0466959_0103802 Ga0466959_0103802_885_1574 214
131 3300045836 Ga0466958_0002823 Ga0466958_0002823_3134_3823 214
132 3300048903 Ga0496100_0475555 Ga0496100_0475555_303_947 214
133 3300061719 Ga0466962_0000108 Ga0466962_0000108_28099_28788 214
134 3300046474 Ga0495605_0287892 Ga0495605_0287892_23_670 215
135 3300046694 Ga0495649_0095142 Ga0495649_0095142_743_1393 215
136 3300047443 Ga0495687_000053 Ga0495687_000053_117272_117922 215
137 3300048905 Ga0496102_0022182 Ga0496102_0022182_4176_4850 217
138 3300048920 Ga0496117_0005096 Ga0496117_0005096_2764_3438 217
139 3300048921 Ga0496118_0002738 Ga0496118_0002738_9340_10014 217
140 3300048929 Ga0496126_0000118 Ga0496126_0000118_5026_5700 217
141 3300001990 JGI24737J22298_10015939 JGI24737J22298_100159392 219
142 3300002067 JGI24735J21928_10010258 JGI24735J21928_100102583 219
143 3300005331 Ga0070670_100394947 Ga0070670_1003949471 219
144 3300005353 Ga0070669_100245360 Ga0070669_1002453602 219
145 3300005367 Ga0070667_100035878 Ga0070667_1000358783 219
146 3300005455 Ga0070663_100006865 Ga0070663_1000068654 219
147 3300005456 Ga0070678_100180627 Ga0070678_1001806272 219
148 3300005548 Ga0070665_100111184 Ga0070665_1001111842 219
149 3300005548 Ga0070665_100269666 Ga0070665_1002696662 219
150 3300005616 Ga0068852_100368792 Ga0068852_1003687921 219
151 3300005842 Ga0068858_100592563 Ga0068858_1005925632 219
152 3300009036 Ga0105244_10030008 Ga0105244_100300082 219
153 3300009036 Ga0105244_10201128 Ga0105244_102011281 219
154 3300009092 Ga0105250_10007917 Ga0105250_100079174 219
155 3300009098 Ga0105245_10279196 Ga0105245_102791962 219
156 3300009098 Ga0105245_10514925 Ga0105245_105149251 219
157 3300009101 Ga0105247_10024939 Ga0105247_100249392 219
158 3300009174 Ga0105241_10163500 Ga0105241_101635002 219
159 3300009177 Ga0105248_10003137 Ga0105248_1000313712 219
160 3300009545 Ga0105237_10342861 Ga0105237_103428612 219
161 3300009551 Ga0105238_10101465 Ga0105238_101014652 219
162 3300009551 Ga0105238_10160402 Ga0105238_101604022 219
163 3300009553 Ga0105249_10177069 Ga0105249_101770692 219
164 3300011119 Ga0105246_10065071 Ga0105246_100650713 219
165 3300011119 Ga0105246_10075192 Ga0105246_100751921 219
166 3300013296 Ga0157374_10043146 Ga0157374_100431465 219
167 3300013297 Ga0157378_10173094 Ga0157378_101730941 219
168 3300013306 Ga0163162_10004087 Ga0163162_100040873 219
169 3300013308 Ga0157375_10025697 Ga0157375_100256973 219
170 3300017792 Ga0163161_10083711 Ga0163161_100837112 219
171 3300025302 Ga0207426_1001933 Ga0207426_10019339 219
172 3300025711 Ga0207696_1041956 Ga0207696_10419562 219
173 3300025728 Ga0207655_1045261 Ga0207655_10452612 219
174 3300025735 Ga0207713_1013154 Ga0207713_10131543 219
175 3300025901 Ga0207688_10035584 Ga0207688_100355842 219
176 3300025903 Ga0207680_10041765 Ga0207680_100417652 219
177 3300025914 Ga0207671_10184615 Ga0207671_101846152 219
178 3300025923 Ga0207681_10232208 Ga0207681_102322082 219
179 3300025927 Ga0207687_10186865 Ga0207687_101868652 219
180 3300025941 Ga0207711_10028161 Ga0207711_100281613 219
181 3300025961 Ga0207712_10123516 Ga0207712_101235162 219
182 3300025986 Ga0207658_10021654 Ga0207658_100216543 219
183 3300026067 Ga0207678_10014544 Ga0207678_100145444 219
184 3300026142 Ga0207698_10343405 Ga0207698_103434051 219
185 3300046457 Ga0495590_0001307 Ga0495590_0001307_9297_9962 219
186 3300046459 Ga0495629_0230428 Ga0495629_0230428_514_1206 219
187 3300046460 Ga0495638_0003608 Ga0495638_0003608_10213_10905 219
188 3300046463 Ga0495653_0049688 Ga0495653_0049688_1741_2406 219
189 3300046471 Ga0495650_0162188 Ga0495650_0162188_53_745 219
190 3300046474 Ga0495605_0044590 Ga0495605_0044590_653_1345 219
191 3300046492 Ga0495585_0011407 Ga0495585_0011407_4015_4707 219
192 3300046507 Ga0495606_0012702 Ga0495606_0012702_103_768 219
193 3300046516 Ga0495628_0037208 Ga0495628_0037208_2818_3483 219
194 3300046518 Ga0495631_0080811 Ga0495631_0080811_27_719 219
195 3300046529 Ga0495652_0097119 Ga0495652_0097119_759_1424 219
196 3300046531 Ga0495665_0097399 Ga0495665_0097399_49_714 219
197 3300046542 Ga0495597_0107347 Ga0495597_0107347_46_711 219
198 3300046616 Ga0495668_0135325 Ga0495668_0135325_200_892 219
199 3300046663 Ga0495635_0067155 Ga0495635_0067155_1256_1921 219
200 3300046680 Ga0495646_0070875 Ga0495646_0070875_1103_1768 219
201 3300046684 Ga0495669_0031092 Ga0495669_0031092_935_1600 219
202 3300046690 Ga0495624_0026337 Ga0495624_0026337_2503_3168 219
203 3300046692 Ga0495671_0055001 Ga0495671_0055001_161_853 219
204 3300046794 Ga0495589_0006136 Ga0495589_0006136_830_1522 219
205 3300047322 Ga0495680_0018900 Ga0495680_0018900_132_797 219
206 3300047444 Ga0495675_0118910 Ga0495675_0118910_962_1627 219
207 3300047444 Ga0495675_0200222 Ga0495675_0200222_260_925 219
208 3300047446 Ga0495679_019418 Ga0495679_019418_652_1344 219
209 3300047447 Ga0495685_114577 Ga0495685_114577_196_867 219
210 3300047673 Ga0495593_0058962 Ga0495593_0058962_926_1591 219
211 3300048903 Ga0496100_0051349 Ga0496100_0051349_470_1135 219
212 3300048905 Ga0496102_0019578 Ga0496102_0019578_4453_5145 219
213 3300048905 Ga0496102_0184399 Ga0496102_0184399_778_1443 219
214 3300048906 Ga0496103_0044831 Ga0496103_0044831_777_1442 219
215 3300048907 Ga0496104_0006859 Ga0496104_0006859_2648_3313 219
216 3300048907 Ga0496104_0147271 Ga0496104_0147271_724_1416 219
217 3300048908 Ga0496105_0100945 Ga0496105_0100945_469_1161 219
218 3300048908 Ga0496105_0162607 Ga0496105_0162607_558_1223 219
219 3300048909 Ga0496106_0010079 Ga0496106_0010079_1462_2127 219
220 3300048910 Ga0496107_0018086 Ga0496107_0018086_287_979 219
221 3300048910 Ga0496107_0037776 Ga0496107_0037776_373_1038 219
222 3300048913 Ga0496110_0159185 Ga0496110_0159185_262_927 219
223 3300048914 Ga0496111_0622369 Ga0496111_0622369_10_675 219
224 3300048915 Ga0496112_0686200 Ga0496112_0686200_160_825 219
225 3300048918 Ga0496115_0061709 Ga0496115_0061709_1443_2135 219
226 3300048920 Ga0496117_0049094 Ga0496117_0049094_777_1442 219
227 3300048921 Ga0496118_0235976 Ga0496118_0235976_156_848 219
228 3300048922 Ga0496119_0080480 Ga0496119_0080480_590_1255 219
229 3300048924 Ga0496121_0036653 Ga0496121_0036653_1840_2505 219
230 3300048926 Ga0496123_0010042 Ga0496123_0010042_706_1371 219
231 3300048927 Ga0496124_0061443 Ga0496124_0061443_373_1038 219
232 3300048928 Ga0496125_0026123 Ga0496125_0026123_4406_5071 219
233 3300049459 Ga0495678_047755 Ga0495678_047755_547_1212 219
234 3300013306 Ga0163162_10391066 Ga0163162_103910662 220
235 3300013306 Ga0163162_10424534 Ga0163162_104245342 220
236 3300046794 Ga0495589_0148657 Ga0495589_0148657_128_808 220
237 3300046809 Ga0495600_0238219 Ga0495600_0238219_197_877 220
238 3300047319 Ga0495674_0077394 Ga0495674_0077394_855_1535 220
239 3300047320 Ga0495672_0018782 Ga0495672_0018782_360_1040 220
240 3300047472 Ga0495686_0000519 Ga0495686_0000519_23134_23814 220
241 iso_pu_bacteria 2562617112 2563055493 220
242 iso_pu_bacteria 2711768613 2713478862 220
243 iso_pu_bacteria 2791355137 2792839285 220
244 iso_pu_bacteria 2904615490 2904617508 220
245 iso_pu_bacteria 2921643360 2921647154 220
246 iso_pu_bacteria 642555112 642594842 220
247 iso_pu_bacteria 2513237166 2514046884 221
248 3300025945 Ga0207679_10996291 Ga0207679_109962911 222
249 iso_pu_bacteria 2508501125 2509128046 222
250 iso_pu_bacteria 2513237151 2513959548 222
251 iso_pu_bacteria 2526164713 2527078487 222
252 iso_pu_bacteria 2738541296 2738823078 222
253 iso_pu_bacteria 2738541298 2738835285 222
254 iso_pu_bacteria 2738541306 2738876764 222
255 iso_pu_bacteria 2738543002 2739188773 222
256 iso_pu_bacteria 2738543008 2739223425 222
257 iso_pu_bacteria 2904483920 2904488138 222
258 iso_pu_bacteria 2919527303 2919531101 222
259 iso_pu_bacteria 2945934425 2945934833 222
260 iso_pu_bacteria 2990703756 2990704590 222
261 iso_pu_bacteria 641736151 642425149 222
262 iso_pu_bacteria 8055266321 8055270781 222
263 iso_pu_bacteria 8055301274 8055305583 222
264 iso_pu_bacteria 2808606384 2808971335 223
265 iso_pu_bacteria 2808606390 2809006281 223
266 iso_pu_bacteria 2808606391 2809013302 223
267 3300003320 rootH2_10059072 rootH2_100590722 224
268 3300003322 rootL2_10109129 rootL2_101091292 224
269 3300003354 JGI25160J50197_1000016 JGI25160J50197_1000016151 224
270 3300005262 Ga0065165_1000875 Ga0065165_100087538 224
271 3300005455 Ga0070663_100302797 Ga0070663_1003027971 224
272 3300009011 Ga0105251_10117643 Ga0105251_101176432 224
273 3300009093 Ga0105240_10037252 Ga0105240_100372526 224
274 3300009551 Ga0105238_10406566 Ga0105238_104065662 224
275 3300013105 Ga0157369_10006755 Ga0157369_100067557 224
276 3300016635 Ga0183361_10001 Ga0183361_10001633 224
277 3300025284 Ga0209130_1006233 Ga0209130_10062334 224
278 3300025295 Ga0209564_1005509 Ga0209564_10055094 224
279 3300025302 Ga0207426_1000007 Ga0207426_1000007673 224
280 3300025913 Ga0207695_10142456 Ga0207695_101424562 224
281 3300025924 Ga0207694_10680967 Ga0207694_106809671 224
282 3300026067 Ga0207678_10301727 Ga0207678_103017272 224
283 3300037312 Ga0395899_0116777 Ga0395899_0116777_948_1634 224
284 3300037418 Ga0395900_0001006 Ga0395900_0001006_29327_30013 224
285 3300037418 Ga0395900_0013273 Ga0395900_0013273_14_700 224
286 3300037418 Ga0395900_0047585 Ga0395900_0047585_1988_2674 224
287 3300037418 Ga0395900_0086440 Ga0395900_0086440_1257_1943 224
288 3300037466 Ga0395898_0001927 Ga0395898_0001927_17669_18355 224
289 3300037466 Ga0395898_0017398 Ga0395898_0017398_3265_3951 224
290 3300037471 Ga0395905_0000079 Ga0395905_0000079_154922_155599 224
291 3300038443 Ga0395901_0001431 Ga0395901_0001431_19610_20296 224
292 3300038443 Ga0395901_0068750 Ga0395901_0068750_1569_2255 224
293 3300044658 Ga0466972_0168151 Ga0466972_0168151_170_856 224
294 3300044684 Ga0466966_0008454 Ga0466966_0008454_1108_1794 224
295 3300044693 Ga0466961_0075478 Ga0466961_0075478_858_1544 224
296 3300044694 Ga0466963_0022467 Ga0466963_0022467_806_1492 224
297 3300044719 Ga0466971_0002927 Ga0466971_0002927_4873_5559 224
298 3300044842 Ga0466957_0084923 Ga0466957_0084923_527_1213 224
299 3300045836 Ga0466958_0030993 Ga0466958_0030993_286_972 224
300 3300045836 Ga0466958_0151390 Ga0466958_0151390_129_815 224
301 3300046455 Ga0495603_0045773 Ga0495603_0045773_427_1104 224
302 3300046472 Ga0495580_0019564 Ga0495580_0019564_2798_3475 224
303 3300046557 Ga0495622_0039090 Ga0495622_0039090_1042_1719 224
304 3300047319 Ga0495674_0045193 Ga0495674_0045193_876_1553 224
305 3300047320 Ga0495672_0025657 Ga0495672_0025657_2105_2782 224
306 3300047323 Ga0495683_0040197 Ga0495683_0040197_1623_2300 224
307 3300047443 Ga0495687_082974 Ga0495687_082974_19_696 224
308 3300047469 Ga0495673_0004942 Ga0495673_0004942_1150_1827 224
309 3300048904 Ga0496101_0041404 Ga0496101_0041404_906_1583 224
310 3300048904 Ga0496101_0121926 Ga0496101_0121926_834_1511 224
311 3300048906 Ga0496103_0308921 Ga0496103_0308921_245_922 224
312 3300048907 Ga0496104_0071060 Ga0496104_0071060_82_759 224
313 3300048907 Ga0496104_0164683 Ga0496104_0164683_1362_2039 224
314 3300048908 Ga0496105_0113599 Ga0496105_0113599_223_900 224
315 3300048915 Ga0496112_0021662 Ga0496112_0021662_3881_4558 224
316 3300048918 Ga0496115_0440748 Ga0496115_0440748_305_982 224
317 3300048919 Ga0496116_0190855 Ga0496116_0190855_43_720 224
318 3300048920 Ga0496117_0033695 Ga0496117_0033695_2017_2694 224
319 3300048921 Ga0496118_0009248 Ga0496118_0009248_1902_2579 224
320 3300048922 Ga0496119_0054052 Ga0496119_0054052_912_1589 224
321 3300048922 Ga0496119_0219065 Ga0496119_0219065_278_955 224
322 3300048924 Ga0496121_0028785 Ga0496121_0028785_3603_4280 224
323 3300048924 Ga0496121_0071196 Ga0496121_0071196_104_781 224
324 3300048926 Ga0496123_0056115 Ga0496123_0056115_1149_1826 224
325 3300048928 Ga0496125_0439180 Ga0496125_0439180_19_696 224
326 3300048929 Ga0496126_0195437 Ga0496126_0195437_901_1578 224
327 3300049460 Ga0495682_0013009 Ga0495682_0013009_1724_2401 224
328 3300061719 Ga0466962_0006095 Ga0466962_0006095_4000_4686 224
329 iso_pu_bacteria 2582581311 2585292152 224
330 iso_pu_bacteria 2599185239 2599738753 224
331 iso_pu_bacteria 2599185240 2599747635 224
332 iso_pu_bacteria 2599185355 2600209519 224
333 iso_pu_bacteria 2675903129 2676745578 224
334 iso_pu_bacteria 2816332253 2817259507 224
335 iso_pu_bacteria 2816332256 2817277176 224
336 iso_pu_bacteria 2816332286 2817454090 224
337 iso_pu_bacteria 2818991452 2819634707 224
338 iso_pu_bacteria 2870068957 2870069634 224
339 iso_pu_bacteria 2928157003 2928163726 224
340 iso_pu_bacteria 2928163908 2928170523 224
341 iso_pu_bacteria 2928170801 2928175844 224
342 iso_pu_bacteria 2981990288 2981995765 224
343 iso_pu_bacteria 641736154 642416465 224
344 iso_pu_bacteria 8018845410 8018848097 224
345 iso_pu_bacteria 8020807995 8020810297 224
346 iso_pu_bacteria 8020938398 8020939181 224
347 iso_pu_bacteria 8020945358 8020948529 224
348 iso_pu_bacteria 8020953355 8020956239 224
349 iso_pu_bacteria 8021120328 8021127040 224
350 iso_pu_bacteria 8039098773 8039101479 224
351 iso_pu_bacteria 8040167225 8040169603 224
352 iso_pu_bacteria 8040173305 8040174636 224
353 3300044660 Ga0466974_0072964 Ga0466974_0072964_925_1632 225
354 iso_pu_bacteria 2501025504 2501410117 225
355 iso_pu_bacteria 2515154189 2516018483 225
356 iso_pu_bacteria 2600255067 2600814238 225
357 iso_pu_bacteria 2883087390 2883096109 225
358 3300001989 JGI24739J22299_10013604 JGI24739J22299_100136045 226
359 3300001989 JGI24739J22299_10017961 JGI24739J22299_100179612 226
360 3300001990 JGI24737J22298_10002504 JGI24737J22298_100025043 226
361 3300002067 JGI24735J21928_10000162 JGI24735J21928_1000016221 226
362 3300002067 JGI24735J21928_10088092 JGI24735J21928_100880921 226
363 3300002705 JGI25156J39149_1000485 JGI25156J39149_100048519 226
364 3300002705 JGI25156J39149_1000815 JGI25156J39149_10008153 226
365 3300003214 JGI25165J46597_1001397 JGI25165J46597_10013976 226
366 3300003756 Ga0055533_1000331 Ga0055533_10003315 226
367 3300003756 Ga0055533_1003159 Ga0055533_10031592 226
368 3300003758 Ga0055532_1000022 Ga0055532_10000228 226
369 3300003760 Ga0055527_1000016 Ga0055527_10000168 226
370 3300003761 Ga0055535_1000017 Ga0055535_10000178 226
371 3300003762 Ga0055542_1000030 Ga0055542_1000030231 226
372 3300003763 Ga0055529_1000033 Ga0055529_1000033231 226
373 3300005563 Ga0068855_100216453 Ga0068855_1002164533 226
374 3300009011 Ga0105251_10040804 Ga0105251_100408042 226
375 3300009551 Ga0105238_10071212 Ga0105238_100712123 226
376 3300010375 Ga0105239_10342597 Ga0105239_103425972 226
377 3300025226 Ga0209674_100017 Ga0209674_100017379 226
378 3300025226 Ga0209674_100291 Ga0209674_10029127 226
379 3300025228 Ga0209672_100001 Ga0209672_1000012323 226
380 3300025229 Ga0209147_100022 Ga0209147_100022185 226
381 3300025230 Ga0209563_107328 Ga0209563_1073282 226
382 3300025231 Ga0207427_100535 Ga0207427_1005352 226
383 3300025242 Ga0209258_100033 Ga0209258_100033228 226
384 3300025254 Ga0209148_1000046 Ga0209148_1000046186 226
385 3300025256 Ga0209759_1000231 Ga0209759_100023170 226
386 3300025256 Ga0209759_1000568 Ga0209759_10005685 226
387 3300025261 Ga0209233_1000050 Ga0209233_1000050186 226
388 3300025272 Ga0209455_1000038 Ga0209455_1000038186 226
389 3300025735 Ga0207713_1037975 Ga0207713_10379752 226
390 3300025904 Ga0207647_10031703 Ga0207647_100317032 226
391 3300025904 Ga0207647_10245813 Ga0207647_102458132 226
392 3300025924 Ga0207694_10011178 Ga0207694_100111789 226
393 3300027312 Ga0209371_1006051 Ga0209371_10060512 226
394 3300031911 Ga0307412_10000011 Ga0307412_10000011180 226
395 3300039447 Ga0436361_0710261 Ga0436361_0710261_1664_2353 226
396 3300046454 Ga0495592_0049359 Ga0495592_0049359_1720_2403 226
397 3300046457 Ga0495590_0006325 Ga0495590_0006325_981_1664 226
398 3300046459 Ga0495629_0046954 Ga0495629_0046954_461_1144 226
399 3300046463 Ga0495653_0035440 Ga0495653_0035440_1651_2334 226
400 3300046471 Ga0495650_0011531 Ga0495650_0011531_565_1248 226
401 3300046472 Ga0495580_0009192 Ga0495580_0009192_4082_4765 226
402 3300046474 Ga0495605_0010235 Ga0495605_0010235_4125_4820 226
403 3300046477 Ga0495664_0023768 Ga0495664_0023768_2337_3020 226
404 3300046477 Ga0495664_0279785 Ga0495664_0279785_43_726 226
405 3300046500 Ga0495596_0037491 Ga0495596_0037491_710_1405 226
406 3300046507 Ga0495606_0012434 Ga0495606_0012434_213_896 226
407 3300046507 Ga0495606_0013933 Ga0495606_0013933_1856_2554 226
408 3300046511 Ga0495608_0041099 Ga0495608_0041099_2042_2725 226
409 3300046512 Ga0495610_0002064 Ga0495610_0002064_10301_10996 226
410 3300046515 Ga0495620_0053869 Ga0495620_0053869_127_810 226
411 3300046516 Ga0495628_0057173 Ga0495628_0057173_1110_1793 226
412 3300046516 Ga0495628_0160510 Ga0495628_0160510_915_1598 226
413 3300046516 Ga0495628_0264639 Ga0495628_0264639_275_958 226
414 3300046517 Ga0495630_0008445 Ga0495630_0008445_5058_5741 226
415 3300046522 Ga0495643_0130923 Ga0495643_0130923_139_834 226
416 3300046526 Ga0495666_0005713 Ga0495666_0005713_3975_4658 226
417 3300046528 Ga0495642_0045310 Ga0495642_0045310_708_1406 226
418 3300046529 Ga0495652_0012402 Ga0495652_0012402_5286_5969 226
419 3300046531 Ga0495665_0035137 Ga0495665_0035137_1523_2206 226
420 3300046535 Ga0495586_0046564 Ga0495586_0046564_409_1092 226
421 3300046559 Ga0495667_0120201 Ga0495667_0120201_741_1424 226
422 3300046642 Ga0495634_0016007 Ga0495634_0016007_2067_2750 226
423 3300046663 Ga0495635_0014181 Ga0495635_0014181_2545_3228 226
424 3300046675 Ga0495657_0042521 Ga0495657_0042521_2132_2815 226
425 3300046679 Ga0495623_0010886 Ga0495623_0010886_1523_2206 226
426 3300046680 Ga0495646_0008207 Ga0495646_0008207_2273_2956 226
427 3300046689 Ga0495613_0122706 Ga0495613_0122706_178_861 226
428 3300046694 Ga0495649_0049480 Ga0495649_0049480_56_754 226
429 3300046694 Ga0495649_0054377 Ga0495649_0054377_731_1414 226
430 3300046694 Ga0495649_0289597 Ga0495649_0289597_11_694 226
431 3300046809 Ga0495600_0071757 Ga0495600_0071757_238_921 226
432 3300047315 Ga0495581_0003276 Ga0495581_0003276_4474_5157 226
433 3300047319 Ga0495674_0159070 Ga0495674_0159070_566_1249 226
434 3300047320 Ga0495672_0250731 Ga0495672_0250731_37_720 226
435 3300047322 Ga0495680_0002302 Ga0495680_0002302_4070_4753 226
436 3300047323 Ga0495683_0008442 Ga0495683_0008442_3678_4361 226
437 3300047323 Ga0495683_0020350 Ga0495683_0020350_1698_2381 226
438 3300047443 Ga0495687_013231 Ga0495687_013231_2671_3354 226
439 3300047673 Ga0495593_0001073 Ga0495593_0001073_2390_3073 226
440 3300048089 Ga0495614_0000394 Ga0495614_0000394_13052_13735 226
441 3300048091 Ga0495626_0027833 Ga0495626_0027833_1175_1858 226
442 3300048920 Ga0496117_0102980 Ga0496117_0102980_225_920 226
443 3300048921 Ga0496118_0102162 Ga0496118_0102162_1012_1707 226
444 3300048925 Ga0496122_0095549 Ga0496122_0095549_986_1681 226
445 3300048926 Ga0496123_0036711 Ga0496123_0036711_690_1388 226
446 3300001989 JGI24739J22299_10073159 JGI24739J22299_100731592 227
447 3300003316 rootH1_10173721 rootH1_101737211 227
448 3300005327 Ga0070658_10000918 Ga0070658_1000091811 227
449 3300005455 Ga0070663_100052102 Ga0070663_1000521023 227
450 3300005563 Ga0068855_100073701 Ga0068855_1000737014 227
451 3300009545 Ga0105237_10105760 Ga0105237_101057602 227
452 3300013104 Ga0157370_10003903 Ga0157370_1000390313 227
453 3300013104 Ga0157370_10016492 Ga0157370_100164924 227
454 3300013105 Ga0157369_10000304 Ga0157369_1000030459 227
455 3300013307 Ga0157372_10421301 Ga0157372_104213012 227
456 3300013307 Ga0157372_10588090 Ga0157372_105880902 227
457 3300022467 Ga0224712_10000828 Ga0224712_100008285 227
458 3300025909 Ga0207705_10002099 Ga0207705_1000209913 227
459 3300025949 Ga0207667_10037447 Ga0207667_100374473 227
460 3300026067 Ga0207678_10050329 Ga0207678_100503293 227
461 3300028800 Ga0265338_10000590 Ga0265338_1000059018 227
462 3300037312 Ga0395899_0020448 Ga0395899_0020448_1799_2497 227
463 3300037418 Ga0395900_0021791 Ga0395900_0021791_2093_2791 227
464 3300038443 Ga0395901_0000017 Ga0395901_0000017_62887_63588 227
465 3300038443 Ga0395901_0000560 Ga0395901_0000560_69_767 227
466 3300039438 Ga0436360_1119489 Ga0436360_1119489_148_846 227
467 3300044656 Ga0466969_0022111 Ga0466969_0022111_838_1557 227
468 3300044684 Ga0466966_0000753 Ga0466966_0000753_5114_5836 227
469 3300044684 Ga0466966_0049476 Ga0466966_0049476_272_991 227
470 3300044693 Ga0466961_0008416 Ga0466961_0008416_2157_2879 227
471 3300044693 Ga0466961_0011964 Ga0466961_0011964_4245_4964 227
472 3300044694 Ga0466963_0092715 Ga0466963_0092715_182_904 227
473 3300044694 Ga0466963_0211859 Ga0466963_0211859_444_1163 227
474 3300044706 Ga0466964_0027519 Ga0466964_0027519_631_1350 227
475 3300044719 Ga0466971_0088636 Ga0466971_0088636_292_1014 227
476 3300044719 Ga0466971_0155401 Ga0466971_0155401_40_759 227
477 3300044765 Ga0466970_0063832 Ga0466970_0063832_721_1440 227
478 3300044842 Ga0466957_0016390 Ga0466957_0016390_938_1660 227
479 3300044842 Ga0466957_0026909 Ga0466957_0026909_593_1312 227
480 3300045049 Ga0466959_0023662 Ga0466959_0023662_1889_2608 227
481 3300046471 Ga0495650_0045027 Ga0495650_0045027_716_1402 227
482 3300048919 Ga0496116_0188134 Ga0496116_0188134_109_792 227
483 3300061719 Ga0466962_0024285 Ga0466962_0024285_1833_2552 227
484 3300061719 Ga0466962_0074750 Ga0466962_0074750_779_1501 227
485 iso_pu_bacteria 2734482258 2735816432 227
486 3300001979 JGI24740J21852_10008299 JGI24740J21852_100082994 228
487 3300001989 JGI24739J22299_10010415 JGI24739J22299_100104153 228
488 3300001989 JGI24739J22299_10064324 JGI24739J22299_100643241 228
489 3300001990 JGI24737J22298_10010270 JGI24737J22298_100102702 228
490 3300002067 JGI24735J21928_10001613 JGI24735J21928_100016132 228
491 3300003320 rootH2_10009585 rootH2_100095852 228
492 3300003322 rootL2_10109130 rootL2_101091302 228
493 3300003758 Ga0055532_1000999 Ga0055532_10009998 228
494 3300003758 Ga0055532_1001455 Ga0055532_10014556 228
495 3300003758 Ga0055532_1001471 Ga0055532_10014715 228
496 3300003760 Ga0055527_1000645 Ga0055527_10006451 228
497 3300003760 Ga0055527_1011892 Ga0055527_10118922 228
498 3300003761 Ga0055535_1001611 Ga0055535_10016111 228
499 3300003761 Ga0055535_1001620 Ga0055535_10016201 228
500 3300003762 Ga0055542_1001587 Ga0055542_10015871 228
501 3300003763 Ga0055529_1001023 Ga0055529_100102311 228
502 3300003856 Ga0058692_1001396 Ga0058692_100139610 228
503 3300005329 Ga0070683_100840846 Ga0070683_1008408462 228
504 3300005339 Ga0070660_100000108 Ga0070660_10000010810 228
505 3300005344 Ga0070661_100554793 Ga0070661_1005547931 228
506 3300005366 Ga0070659_100000170 Ga0070659_10000017039 228
507 3300005455 Ga0070663_100001358 Ga0070663_1000013585 228
508 3300005539 Ga0068853_100083623 Ga0068853_1000836233 228
509 3300005563 Ga0068855_100027466 Ga0068855_1000274664 228
510 3300005616 Ga0068852_100016544 Ga0068852_1000165442 228
511 3300005842 Ga0068858_100097799 Ga0068858_1000977992 228
512 3300009092 Ga0105250_10001203 Ga0105250_1000120311 228
513 3300009093 Ga0105240_10024211 Ga0105240_100242112 228
514 3300009093 Ga0105240_10196566 Ga0105240_101965662 228
515 3300009177 Ga0105248_10025295 Ga0105248_100252955 228
516 3300009545 Ga0105237_10057000 Ga0105237_100570002 228
517 3300009551 Ga0105238_10013204 Ga0105238_100132042 228
518 3300010375 Ga0105239_10779243 Ga0105239_107792432 228
519 3300013100 Ga0157373_10081277 Ga0157373_100812772 228
520 3300013104 Ga0157370_10149851 Ga0157370_101498512 228
521 3300013296 Ga0157374_10547127 Ga0157374_105471272 228
522 3300015261 Ga0182006_1074354 Ga0182006_10743541 228
523 3300015262 Ga0182007_10005679 Ga0182007_100056792 228
524 3300015265 Ga0182005_1051205 Ga0182005_10512051 228
525 3300025225 Ga0209566_100264 Ga0209566_1002649 228
526 3300025226 Ga0209674_104103 Ga0209674_1041032 228
527 3300025228 Ga0209672_100115 Ga0209672_1001157 228
528 3300025228 Ga0209672_100136 Ga0209672_1001369 228
529 3300025229 Ga0209147_100164 Ga0209147_1001648 228
530 3300025229 Ga0209147_100215 Ga0209147_1002157 228
531 3300025229 Ga0209147_100360 Ga0209147_1003606 228
532 3300025242 Ga0209258_100261 Ga0209258_1002619 228
533 3300025242 Ga0209258_100271 Ga0209258_1002717 228
534 3300025254 Ga0209148_1000104 Ga0209148_100010487 228
535 3300025254 Ga0209148_1000609 Ga0209148_100060932 228
536 3300025256 Ga0209759_1003271 Ga0209759_10032713 228
537 3300025272 Ga0209455_1000097 Ga0209455_1000097112 228
538 3300025273 Ga0209673_1000124 Ga0209673_100012487 228
539 3300025295 Ga0209564_1002969 Ga0209564_100296912 228
540 3300025711 Ga0207696_1013061 Ga0207696_10130613 228
541 3300025904 Ga0207647_10018758 Ga0207647_100187582 228
542 3300025913 Ga0207695_10019692 Ga0207695_100196922 228
543 3300025913 Ga0207695_10449574 Ga0207695_104495742 228
544 3300025914 Ga0207671_10032399 Ga0207671_100323992 228
545 3300025919 Ga0207657_10001682 Ga0207657_1000168212 228
546 3300025924 Ga0207694_10014967 Ga0207694_100149673 228
547 3300025932 Ga0207690_10000012 Ga0207690_10000012169 228
548 3300025944 Ga0207661_10667285 Ga0207661_106672852 228
549 3300025949 Ga0207667_10004701 Ga0207667_100047017 228
550 3300026035 Ga0207703_10077256 Ga0207703_100772562 228
551 3300026067 Ga0207678_10000076 Ga0207678_1000007669 228
552 3300026078 Ga0207702_10030946 Ga0207702_100309464 228
553 3300026142 Ga0207698_10033021 Ga0207698_100330214 228
554 3300027312 Ga0209371_1000185 Ga0209371_100018588 228
555 3300030500 Ga0268256_1000847 Ga0268256_100084710 228
556 3300037312 Ga0395899_0000149 Ga0395899_0000149_57566_58300 228
557 3300044672 Ga0466982_0267918 Ga0466982_0267918_143_829 228
558 3300044683 Ga0466965_0146277 Ga0466965_0146277_434_1159 228
559 3300044842 Ga0466957_0037153 Ga0466957_0037153_534_1259 228
560 3300044901 Ga0466960_0147431 Ga0466960_0147431_442_1128 228
561 3300045049 Ga0466959_0391823 Ga0466959_0391823_82_807 228
562 3300048909 Ga0496106_0005601 Ga0496106_0005601_7453_8172 228
563 3300048921 Ga0496118_0028658 Ga0496118_0028658_107_793 228
564 3300048924 Ga0496121_0003102 Ga0496121_0003102_5012_5731 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

32

223

0.94

PF13847

Methyltransf_31

Methyltransferase domain

82

198

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.8961 12 226
3g89-assembly2.cif.gz_B t. thermophilus 16s rrna g527 methyltransferase in complex with adomet and amp in space group p61 0.8859 12 226
1jsx-assembly1.cif.gz_A crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) 0.8846 13 226
3g8a-assembly6.cif.gz_F t. thermophilus 16s rrna g527 methyltransferase in complex with adohcy in space group p61 0.8818 12 226
3g8a-assembly3.cif.gz_C t. thermophilus 16s rrna g527 methyltransferase in complex with adohcy in space group p61 0.8787 12 225
ID Description Score Start End Superfamily
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9247 29 226 3.40.50.150
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9149 52 145 3.40.50.150
3g8bB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8968 12 226 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8846 13 226 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8719 13 226 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2W4LXI0-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.976 14 224 GO:0005829
GO:0070043
AF-A0A536SIX0-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9754 14 226 GO:0005829
GO:0070043
AF-A0A7Y3CXY2-F1-model_v4 deleted 0.9703 12 224
AF-A0A2E0EW97-F1-model_v4 deleted 0.9685 11 225
AF-A0A0R2WEQ7-F1-model_v4 deleted 0.968 23 224

Feature Viewer

pLDDT pTM Quality
91.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map