F464237

General Info

Members Datasets Scaffolds Average Seq Length
565 286 1130 266

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10002997|Ga0070692_100029976
Length 299
Sequence MPGAFRDNERRAREGAAGAKHQGRFARDPVEIGMSYGPHRIVCLTEEPTEVLYALGEQDRIVGISGFTVRPPRARKEKPKVSAFTSAKIERILDLKPDMAIGFSDIQADIARELIKAGVEVWISNHRSVAGILAYIRRLGALVGAAEKVEAYARELEAHVERVRASGAALPRHPRVYFEEWDDPPITGIRWVAELIRIAGGEDVFPERAEQSLAKHRILSDPAEVISRQPDMILASWCGKKFQPASVAARPGWGAIPAVRNGELHEIKSPIILQPGPAALTDGLDALHAVIARWVLGGH

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
230 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
231 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
264 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
265 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
271 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
272 2643221660 Methylibium sp. Root1272 Isolate Unclassified
273 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
274 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
275 2734482264 Dyella sp. AD052 Isolate Unclassified
276 2738543009 Luteibacter sp. OK325 Isolate Unclassified
277 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
278 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
279 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
280 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
281 2919085039 Luteibacter sp. 1214 Isolate Unclassified
282 2919404418 Luteibacter sp. 3190 Isolate Unclassified
283 2928963466 Dyella japonica 1073 Isolate Unclassified
284 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
285 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
286 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 1.42
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.14
Nodule 0
Rhizoplane 1.95
Rhizosphere 80.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10002997 3300005345 Bacteria 6723
2 JGI24736J21556_1003426 3300001904 Bacteria 2751
3 JGI24741J21665_1000681 3300001915 Bacteria 10248
4 JGI24741J21665_1008685 3300001915 Bacteria 1906
5 JGI24740J21852_10002017 3300001979 Bacteria 9284
6 JGI24740J21852_10006374 3300001979 Bacteria 4892
7 Ga0055539_1007878 3300003752 Bacteria 1340
8 Ga0055533_1002033 3300003756 Bacteria 4908
9 Ga0055525_1000178 3300003759 Bacteria 79260
10 Ga0055527_1000090 3300003760 Bacteria 71093
11 Ga0055527_1000100 3300003760 Bacteria 63720
12 Ga0055535_1000201 3300003761 Bacteria 63716
13 Ga0055535_1000742 3300003761 Bacteria 24432
14 Ga0055535_1001175 3300003761 Bacteria 15158
15 Ga0055542_1000187 3300003762 Bacteria 76099
16 Ga0055542_1000191 3300003762 Bacteria 74866
17 Ga0055542_1000212 3300003762 Bacteria 71081
18 Ga0055542_1000236 3300003762 Bacteria 63720
19 Ga0055529_1000256 3300003763 Bacteria 63720
20 Ga0055529_1000259 3300003763 Bacteria 63245
21 Ga0058692_1000015 3300003856 Bacteria 295729
22 Ga0065707_10008645 3300005295 Bacteria 2864
23 Ga0070658_10001497 3300005327 Bacteria 19822
24 Ga0070658_10011621 3300005327 Bacteria 7063
25 Ga0070658_10331290 3300005327 Bacteria 1301
26 Ga0070683_100048770 3300005329 Bacteria 3915
27 Ga0070683_100088218 3300005329 Bacteria 2910
28 Ga0070670_100071853 3300005331 Bacteria 2971
29 Ga0070677_10011734 3300005333 Bacteria 3028
30 Ga0068869_100175413 3300005334 Bacteria 1677
31 Ga0070666_10000013 3300005335 Bacteria 230442
32 Ga0070680_100003199 3300005336 Bacteria 12174
33 Ga0070680_100020813 3300005336 Bacteria 5206
34 Ga0070680_100043710 3300005336 Bacteria 3639
35 Ga0070680_100050715 3300005336 Bacteria 3385
36 Ga0070680_100088523 3300005336 Bacteria 2561
37 Ga0070682_100001531 3300005337 Bacteria 12957
38 Ga0070682_100040815 3300005337 Bacteria 2857
39 Ga0070682_100080903 3300005337 Bacteria 2102
40 Ga0070660_100045685 3300005339 Bacteria 3354
41 Ga0070660_100049161 3300005339 Bacteria 3241
42 Ga0070660_100068709 3300005339 Bacteria 2762
43 Ga0070691_10003728 3300005341 Bacteria 6881
44 Ga0070691_10013583 3300005341 Bacteria 3731
45 Ga0070661_100005231 3300005344 Bacteria 8936
46 Ga0070661_100007885 3300005344 Bacteria 7353
47 Ga0070661_100051308 3300005344 Bacteria 3019
48 Ga0070661_100086661 3300005344 Bacteria 2315
49 Ga0070661_100369011 3300005344 Bacteria 1129
50 Ga0070692_10013814 3300005345 Bacteria 3774
51 Ga0070692_10021053 3300005345 Bacteria 3170
52 Ga0070669_100016333 3300005353 Bacteria 5295
53 Ga0070673_100381814 3300005364 Bacteria 1256
54 Ga0070659_100005909 3300005366 Bacteria 8819
55 Ga0070659_100030751 3300005366 Bacteria 4155
56 Ga0070659_100218530 3300005366 Bacteria 1572
57 Ga0070667_100014067 3300005367 Bacteria 6612
58 Ga0070714_100521861 3300005435 Bacteria 1135
59 Ga0070713_100007977 3300005436 Bacteria 7483
60 Ga0070663_100003461 3300005455 Bacteria 9097
61 Ga0070663_100005923 3300005455 Bacteria 7317
62 Ga0070663_100015446 3300005455 Bacteria 4930
63 Ga0070663_100065322 3300005455 Bacteria 2633
64 Ga0070681_10000721 3300005458 Bacteria 27370
65 Ga0070681_10000934 3300005458 Bacteria 24585
66 Ga0070681_10010860 3300005458 Bacteria 9001
67 Ga0070681_10073268 3300005458 Bacteria 3386
68 Ga0068867_100145442 3300005459 Bacteria 1857
69 Ga0070706_100021362 3300005467 Bacteria 5962
70 Ga0070706_100025560 3300005467 Bacteria 5436
71 Ga0070679_100000417 3300005530 Bacteria 36272
72 Ga0070679_100009935 3300005530 Bacteria 9008
73 Ga0070679_100064877 3300005530 Bacteria 3640
74 Ga0070684_100037216 3300005535 Bacteria 4172
75 Ga0070684_100042703 3300005535 Bacteria 3915
76 Ga0070672_100018953 3300005543 Bacteria 4985
77 Ga0070696_100001686 3300005546 Bacteria 14471
78 Ga0070696_100030549 3300005546 Bacteria 3689
79 Ga0070696_100037647 3300005546 Bacteria 3337
80 Ga0070693_100004068 3300005547 Bacteria 6885
81 Ga0070693_100179185 3300005547 Bacteria 1363
82 Ga0070665_100000333 3300005548 Bacteria 72698
83 Ga0068855_100019050 3300005563 Bacteria 8251
84 Ga0068855_100513013 3300005563 Bacteria 1301
85 Ga0068857_100044998 3300005577 Bacteria 3915
86 Ga0068857_100065959 3300005577 Bacteria 3220
87 Ga0068857_100102397 3300005577 Bacteria 2570
88 Ga0068857_100353015 3300005577 Bacteria 1362
89 Ga0068854_100289958 3300005578 Bacteria 1320
90 Ga0068856_100000797 3300005614 Bacteria 33958
91 Ga0068856_100005119 3300005614 Bacteria 12956
92 Ga0068856_100064205 3300005614 Bacteria 3628
93 Ga0068852_100040728 3300005616 Bacteria 3921
94 Ga0068852_100149769 3300005616 Bacteria 2169
95 Ga0068852_100377819 3300005616 Bacteria 1389
96 Ga0068859_100107681 3300005617 Bacteria 2848
97 Ga0068859_100418112 3300005617 Bacteria 1437
98 Ga0068866_10052177 3300005718 Bacteria 2086
99 Ga0068861_100572039 3300005719 Bacteria 1033
100 Ga0068851_10075389 3300005834 Bacteria 1753
101 Ga0068860_100097736 3300005843 Bacteria 2799
102 Ga0068860_100105639 3300005843 Bacteria 2689
103 Ga0068862_100012901 3300005844 Bacteria 6911
104 Ga0081455_10132185 3300005937 Bacteria 1950
105 Ga0075366_10077823 3300006195 Bacteria 1979
106 Ga0075434_100016515 3300006871 Bacteria 7097
107 Ga0097620_100107684 3300006931 Bacteria 2848
108 Ga0097620_100418080 3300006931 Bacteria 1437
109 Ga0075435_100026633 3300007076 Bacteria 4514
110 Ga0105240_10007819 3300009093 Bacteria 15439
111 Ga0105240_10009451 3300009093 Bacteria 13801
112 Ga0105240_10103339 3300009093 Bacteria 3462
113 Ga0111539_10518133 3300009094 Bacteria 1389
114 Ga0105245_10215208 3300009098 Bacteria 1851
115 Ga0105247_10001072 3300009101 Bacteria 20420
116 Ga0105243_10186949 3300009148 Bacteria 1806
117 Ga0105241_10059458 3300009174 Bacteria 2939
118 Ga0105241_10119003 3300009174 Bacteria 2124
119 Ga0105241_10129926 3300009174 Bacteria 2038
120 Ga0105237_10337884 3300009545 Bacteria 1510
121 Ga0105238_10000131 3300009551 Bacteria 82050
122 Ga0105238_10254080 3300009551 Bacteria 1736
123 Ga0105238_10310634 3300009551 Bacteria 1561
124 Ga0105239_10000023 3300010375 Bacteria 257478
125 Ga0105239_10026540 3300010375 Bacteria 6374
126 Ga0105246_10157009 3300011119 Bacteria 1729
127 Ga0157373_10006081 3300013100 Bacteria 9025
128 Ga0157373_10057143 3300013100 Bacteria 2768
129 Ga0157371_10011947 3300013102 Bacteria 6659
130 Ga0157371_10058745 3300013102 Bacteria 2728
131 Ga0157371_10064205 3300013102 Bacteria 2601
132 Ga0157370_10015411 3300013104 Bacteria 7768
133 Ga0157370_10028755 3300013104 Bacteria 5466
134 Ga0157370_10112207 3300013104 Bacteria 2548
135 Ga0157370_10433451 3300013104 Bacteria 1209
136 Ga0157369_10003442 3300013105 Bacteria 18769
137 Ga0157369_10036017 3300013105 Bacteria 5424
138 Ga0157369_10278688 3300013105 Bacteria 1741
139 Ga0163162_10095092 3300013306 Bacteria 3066
140 Ga0163162_10098108 3300013306 Bacteria 3019
141 Ga0157372_10002979 3300013307 Bacteria 18241
142 Ga0157372_10027202 3300013307 Bacteria 6226
143 Ga0157372_10077002 3300013307 Bacteria 3766
144 Ga0157372_10290878 3300013307 Bacteria 1900
145 Ga0157380_10176236 3300014326 Bacteria 1874
146 Ga0182008_10010199 3300014497 Bacteria 5034
147 Ga0157379_10041041 3300014968 Bacteria 4130
148 Ga0157379_10172101 3300014968 Bacteria 1955
149 Ga0182006_1000030 3300015261 Bacteria 242894
150 Ga0182006_1000062 3300015261 Bacteria 155622
151 Ga0182007_10000803 3300015262 Bacteria 17533
152 Ga0182007_10007098 3300015262 Bacteria 4739
153 Ga0182005_1000021 3300015265 Bacteria 272185
154 Ga0182005_1000035 3300015265 Bacteria 172168
155 Ga0182005_1015987 3300015265 Bacteria 2089
156 Ga0163161_10032533 3300017792 Bacteria 3724
157 Ga0163161_10195764 3300017792 Bacteria 1556
158 Ga0197907_10056721 3300020069 Bacteria 2834
159 Ga0206356_10103483 3300020070 Bacteria 5254
160 Ga0206356_11014676 3300020070 Bacteria 1923
161 Ga0206356_11464199 3300020070 Bacteria 5935
162 Ga0206354_10181591 3300020081 Bacteria 1740
163 Ga0206353_10124593 3300020082 Bacteria 3101
164 Ga0154015_1046164 3300020610 Bacteria 5505
165 Ga0154015_1409760 3300020610 Bacteria 1979
166 Ga0209674_100140 3300025226 Bacteria 109152
167 Ga0209674_100373 3300025226 Bacteria 24523
168 Ga0209674_101464 3300025226 Bacteria 6187
169 Ga0209672_100016 3300025228 Bacteria 522604
170 Ga0209672_101550 3300025228 Bacteria 7904
171 Ga0209437_100270 3300025233 Bacteria 78319
172 Ga0209258_100012 3300025242 Bacteria 825544
173 Ga0209258_100316 3300025242 Bacteria 74911
174 Ga0209258_105374 3300025242 Bacteria 2187
175 Ga0209026_1000117 3300025250 Bacteria 131918
176 Ga0209026_1000139 3300025250 Bacteria 115298
177 Ga0209148_1000005 3300025254 Bacteria 1806504
178 Ga0209148_1000014 3300025254 Bacteria 925277
179 Ga0209148_1000244 3300025254 Bacteria 86833
180 Ga0209129_1001466 3300025258 Bacteria 13159
181 Ga0209233_1025529 3300025261 Bacteria 1460
182 Ga0209455_1000014 3300025272 Bacteria 806601
183 Ga0209455_1003988 3300025272 Bacteria 5004
184 Ga0209758_1016770 3300025297 Bacteria 3699
185 Ga0209050_1050163 3300025298 Bacteria 1063
186 Ga0209256_1028698 3300025299 Bacteria 1565
187 Ga0209257_1005084 3300025304 Bacteria 9552
188 Ga0207682_10045555 3300025893 Bacteria 1800
189 Ga0207710_10041760 3300025900 Bacteria 2035
190 Ga0207680_10000001 3300025903 Bacteria 1091453
191 Ga0207647_10000191 3300025904 Bacteria 49647
192 Ga0207647_10003903 3300025904 Bacteria 11137
193 Ga0207647_10005977 3300025904 Bacteria 8866
194 Ga0207647_10024124 3300025904 Bacteria 4012
195 Ga0207645_10204939 3300025907 Bacteria 1298
196 Ga0207643_10105992 3300025908 Bacteria 1652
197 Ga0207705_10001045 3300025909 Bacteria 22516
198 Ga0207705_10001377 3300025909 Bacteria 19399
199 Ga0207705_10002025 3300025909 Bacteria 15772
200 Ga0207705_10020417 3300025909 Bacteria 4734
201 Ga0207705_10022308 3300025909 Bacteria 4515
202 Ga0207705_10294428 3300025909 Bacteria 1244
203 Ga0207684_10078191 3300025910 Bacteria 2813
204 Ga0207684_10178836 3300025910 Bacteria 1829
205 Ga0207654_10058208 3300025911 Bacteria 2249
206 Ga0207654_10148453 3300025911 Bacteria 1502
207 Ga0207707_10000106 3300025912 Bacteria 83040
208 Ga0207707_10000179 3300025912 Bacteria 66039
209 Ga0207707_10000812 3300025912 Bacteria 30590
210 Ga0207707_10002026 3300025912 Bacteria 18400
211 Ga0207707_10003633 3300025912 Bacteria 13677
212 Ga0207707_10003702 3300025912 Bacteria 13548
213 Ga0207707_10013685 3300025912 Bacteria 7076
214 Ga0207707_10049700 3300025912 Bacteria 3653
215 Ga0207695_10000588 3300025913 Bacteria 73260
216 Ga0207695_10001370 3300025913 Bacteria 41340
217 Ga0207695_10001701 3300025913 Bacteria 35229
218 Ga0207695_10002955 3300025913 Bacteria 24524
219 Ga0207695_10005835 3300025913 Bacteria 16192
220 Ga0207695_10055585 3300025913 Bacteria 4124
221 Ga0207695_10191438 3300025913 Bacteria 1963
222 Ga0207671_10253550 3300025914 Bacteria 1383
223 Ga0207660_10000747 3300025917 Bacteria 21615
224 Ga0207660_10004214 3300025917 Bacteria 9364
225 Ga0207660_10005475 3300025917 Bacteria 8246
226 Ga0207660_10008170 3300025917 Bacteria 6771
227 Ga0207660_10010788 3300025917 Bacteria 5938
228 Ga0207660_10032194 3300025917 Bacteria 3618
229 Ga0207657_10004478 3300025919 Bacteria 14774
230 Ga0207657_10010355 3300025919 Bacteria 9307
231 Ga0207657_10015112 3300025919 Bacteria 7497
232 Ga0207657_10015691 3300025919 Bacteria 7327
233 Ga0207657_10195262 3300025919 Bacteria 1631
234 Ga0207649_10002754 3300025920 Bacteria 9733
235 Ga0207649_10035547 3300025920 Bacteria 2994
236 Ga0207649_10325738 3300025920 Bacteria 1130
237 Ga0207652_10000442 3300025921 Bacteria 42938
238 Ga0207652_10000894 3300025921 Bacteria 28219
239 Ga0207652_10001820 3300025921 Bacteria 18481
240 Ga0207652_10002955 3300025921 Bacteria 14205
241 Ga0207652_10003323 3300025921 Bacteria 13319
242 Ga0207652_10041141 3300025921 Bacteria 3927
243 Ga0207652_10047840 3300025921 Bacteria 3654
244 Ga0207646_10036569 3300025922 Bacteria 4431
245 Ga0207681_10515256 3300025923 Bacteria 981
246 Ga0207694_10000168 3300025924 Bacteria 67647
247 Ga0207694_10083941 3300025924 Bacteria 2505
248 Ga0207694_10091345 3300025924 Bacteria 2403
249 Ga0207650_10071522 3300025925 Bacteria 2610
250 Ga0207650_10123708 3300025925 Bacteria 2017
251 Ga0207659_10047537 3300025926 Bacteria 3036
252 Ga0207687_10122655 3300025927 Bacteria 1946
253 Ga0207687_10422199 3300025927 Bacteria 1101
254 Ga0207700_10211276 3300025928 Bacteria 1641
255 Ga0207644_10394141 3300025931 Bacteria 1131
256 Ga0207690_10000869 3300025932 Bacteria 19295
257 Ga0207690_10282058 3300025932 Bacteria 1294
258 Ga0207706_10004745 3300025933 Bacteria 12726
259 Ga0207665_10204550 3300025939 Bacteria 1440
260 Ga0207691_10014135 3300025940 Bacteria 7616
261 Ga0207661_10012370 3300025944 Bacteria 6199
262 Ga0207661_10012402 3300025944 Bacteria 6192
263 Ga0207661_10034544 3300025944 Bacteria 3933
264 Ga0207667_10001475 3300025949 Bacteria 29510
265 Ga0207667_10002217 3300025949 Bacteria 24401
266 Ga0207667_10006386 3300025949 Bacteria 14293
267 Ga0207667_10008576 3300025949 Bacteria 12133
268 Ga0207667_10020975 3300025949 Bacteria 7246
269 Ga0207640_10000480 3300025981 Bacteria 24361
270 Ga0207640_10000593 3300025981 Bacteria 21569
271 Ga0207640_10000958 3300025981 Bacteria 16038
272 Ga0207658_10005424 3300025986 Bacteria 8744
273 Ga0207677_10349409 3300026023 Bacteria 1238
274 Ga0207703_10080246 3300026035 Bacteria 2717
275 Ga0207703_10127815 3300026035 Bacteria 2190
276 Ga0207703_10597678 3300026035 Bacteria 1043
277 Ga0207639_10001978 3300026041 Bacteria 13788
278 Ga0207639_10005834 3300026041 Bacteria 8343
279 Ga0207639_10483319 3300026041 Bacteria 1129
280 Ga0207678_10002935 3300026067 Bacteria 15447
281 Ga0207678_10003548 3300026067 Bacteria 14030
282 Ga0207678_10012596 3300026067 Bacteria 7429
283 Ga0207678_10013161 3300026067 Bacteria 7258
284 Ga0207678_10016189 3300026067 Bacteria 6545
285 Ga0207678_10039903 3300026067 Bacteria 4072
286 Ga0207702_10001248 3300026078 Bacteria 25656
287 Ga0207702_10001348 3300026078 Bacteria 24485
288 Ga0207702_10001815 3300026078 Bacteria 21008
289 Ga0207648_10214032 3300026089 Bacteria 1711
290 Ga0207674_10005152 3300026116 Bacteria 15581
291 Ga0207674_10019922 3300026116 Bacteria 7259
292 Ga0207674_10037630 3300026116 Bacteria 5030
293 Ga0207674_10214714 3300026116 Bacteria 1872
294 Ga0207674_10458873 3300026116 Bacteria 1231
295 Ga0207675_100188811 3300026118 Bacteria 1976
296 Ga0207683_10320868 3300026121 Bacteria 1419
297 Ga0207698_10001252 3300026142 Bacteria 14849
298 Ga0207698_10016340 3300026142 Bacteria 4999
299 Ga0207698_10040295 3300026142 Bacteria 3469
300 Ga0209371_1000011 3300027312 Bacteria 848456
301 Ga0268266_10000001 3300028379 Bacteria 4040580
302 Ga0268266_10000075 3300028379 Bacteria 218045
303 Ga0268264_10079476 3300028381 Bacteria 2798
304 Ga0268264_10413772 3300028381 Bacteria 1299
305 Ga0268256_1000011 3300030500 Bacteria 848625
306 Ga0307513_10055696 3300031456 Bacteria 4229
307 Ga0307414_10020692 3300032004 Bacteria 4107
308 Ga0307415_100512429 3300032126 Bacteria 1051
309 Ga0307510_10002367 3300033180 Bacteria 21348
310 Ga0307510_10043003 3300033180 Bacteria 4915
311 Ga0373959_0038111 3300034820 Bacteria 998
312 Ga0373927_0171026 3300035695 Bacteria 1424
313 Ga0373933_0333883 3300035724 Bacteria 983
314 Ga0373925_0004492 3300037068 Bacteria 10541
315 Ga0395899_0000089 3300037312 Bacteria 156851
316 Ga0395899_0004035 3300037312 Bacteria 11579
317 Ga0395899_0012531 3300037312 Bacteria 6498
318 Ga0395899_0073664 3300037312 Bacteria 2496
319 Ga0395899_0156525 3300037312 Bacteria 1612
320 Ga0395900_0000029 3300037418 Bacteria 281061
321 Ga0395900_0060933 3300037418 Bacteria 3881
322 Ga0395900_0076239 3300037418 Bacteria 3446
323 Ga0395900_0318405 3300037418 Bacteria 1536
324 Ga0395898_0000018 3300037466 Bacteria 418600
325 Ga0395898_0000241 3300037466 Bacteria 138133
326 Ga0395898_0029429 3300037466 Bacteria 5502
327 Ga0395898_0042982 3300037466 Bacteria 4454
328 Ga0395898_0318993 3300037466 Bacteria 1482
329 Ga0395905_0050410 3300037471 Bacteria 3900
330 Ga0395901_0003835 3300038443 Bacteria 15156
331 Ga0395901_0021565 3300038443 Bacteria 6600
332 Ga0395901_0062534 3300038443 Bacteria 3873
333 Ga0395901_0105859 3300038443 Bacteria 2952
334 Ga0395901_0172895 3300038443 Bacteria 2266
335 Ga0395901_0271045 3300038443 Bacteria 1765
336 Ga0395901_0307808 3300038443 Bacteria 1641
337 Ga0439436_0016966 3300041404 Bacteria 2181
338 Ga0439465_0000557 3300041413 Bacteria 11216
339 Ga0439449_0000004 3300042007 Bacteria 82454
340 Ga0451577_0112809 3300042876 Bacteria 2433
341 Ga0466969_0006829 3300044656 Bacteria 6071
342 Ga0466969_0031842 3300044656 Bacteria 2683
343 Ga0466972_0018206 3300044658 Bacteria 3514
344 Ga0466982_0000018 3300044672 Bacteria 113912
345 Ga0466966_0010735 3300044684 Bacteria 6090
346 Ga0466966_0021050 3300044684 Bacteria 4283
347 Ga0466961_0000345 3300044693 Bacteria 30306
348 Ga0466961_0004106 3300044693 Bacteria 9090
349 Ga0466961_0005564 3300044693 Bacteria 7952
350 Ga0466961_0012072 3300044693 Bacteria 5520
351 Ga0466963_0183809 3300044694 Bacteria 1460
352 Ga0466964_0014408 3300044706 Bacteria 3006
353 Ga0466971_0045353 3300044719 Bacteria 1974
354 Ga0466970_0014316 3300044765 Bacteria 4070
355 Ga0466970_0025429 3300044765 Bacteria 3099
356 Ga0466970_0058137 3300044765 Bacteria 2069
357 Ga0466957_0017384 3300044842 Bacteria 4210
358 Ga0466957_0049457 3300044842 Bacteria 2556
359 Ga0466959_0000148 3300045049 Bacteria 45981
360 Ga0466959_0002116 3300045049 Bacteria 12562
361 Ga0466959_0042263 3300045049 Bacteria 3361
362 Ga0451576_0012042 3300045051 Bacteria 9764
363 Ga0466958_0006082 3300045836 Bacteria 6543
364 Ga0466958_0008710 3300045836 Bacteria 5632
365 Ga0466958_0051309 3300045836 Bacteria 2497
366 Ga0466958_0079594 3300045836 Bacteria 2015
367 Ga0466967_0588574 3300045976 Bacteria 1097
368 Ga0495617_000035 3300046452 Bacteria 145195
369 Ga0495638_0000059 3300046460 Bacteria 191461
370 Ga0495638_0000100 3300046460 Bacteria 139296
371 Ga0495638_0073912 3300046460 Bacteria 2079
372 Ga0495650_0000350 3300046471 Bacteria 81541
373 Ga0495650_0000496 3300046471 Bacteria 59706
374 Ga0495650_0011152 3300046471 Bacteria 4951
375 Ga0495605_0059099 3300046474 Bacteria 1842
376 Ga0495639_0007327 3300046475 Bacteria 4734
377 Ga0495662_0008401 3300046476 Bacteria 5078
378 Ga0495584_0011251 3300046491 Bacteria 4583
379 Ga0495585_0003949 3300046492 Bacteria 9802
380 Ga0495607_0000012 3300046501 Bacteria 195369
381 Ga0495607_0000121 3300046501 Bacteria 82194
382 Ga0495607_0017066 3300046501 Bacteria 4671
383 Ga0495583_0005586 3300046506 Bacteria 8482
384 Ga0495606_0000490 3300046507 Bacteria 64820
385 Ga0495606_0000928 3300046507 Bacteria 43190
386 Ga0495606_0008792 3300046507 Bacteria 8672
387 Ga0495606_0009149 3300046507 Bacteria 8430
388 Ga0495606_0019290 3300046507 Bacteria 5079
389 Ga0495606_0084407 3300046507 Bacteria 1967
390 Ga0495606_0098211 3300046507 Bacteria 1787
391 Ga0495610_0017809 3300046512 Bacteria 4038
392 Ga0495616_0000027 3300046513 Bacteria 136712
393 Ga0495620_0001953 3300046515 Bacteria 12076
394 Ga0495620_0002406 3300046515 Bacteria 10839
395 Ga0495630_0000001 3300046517 Bacteria 1687293
396 Ga0495631_0000249 3300046518 Bacteria 37329
397 Ga0495631_0000916 3300046518 Bacteria 18359
398 Ga0495632_0000019 3300046519 Bacteria 215713
399 Ga0495632_0030754 3300046519 Bacteria 2783
400 Ga0495637_0005961 3300046520 Bacteria 6164
401 Ga0495648_0005506 3300046524 Bacteria 10504
402 Ga0495648_0006579 3300046524 Bacteria 9449
403 Ga0495586_0203576 3300046535 Bacteria 1122
404 Ga0495609_0006069 3300046538 Bacteria 6220
405 Ga0495621_0010415 3300046539 Bacteria 2843
406 Ga0495668_0024046 3300046616 Bacteria 3467
407 Ga0495611_0000001 3300046648 Bacteria 2628469
408 Ga0495611_0000027 3300046648 Bacteria 116663
409 Ga0495625_0000037 3300046660 Bacteria 219383
410 Ga0495625_0072075 3300046660 Bacteria 2423
411 Ga0495625_0126762 3300046660 Bacteria 1732
412 Ga0495661_0001009 3300046665 Bacteria 25232
413 Ga0495588_0204212 3300046674 Bacteria 1044
414 Ga0495670_0001266 3300046691 Bacteria 12354
415 Ga0495670_0017154 3300046691 Bacteria 3562
416 Ga0495589_0001848 3300046794 Bacteria 12006
417 Ga0495660_0000869 3300046810 Bacteria 22335
418 Ga0495660_0000936 3300046810 Bacteria 21389
419 Ga0495683_0001081 3300047323 Bacteria 18850
420 Ga0495679_000001 3300047446 Bacteria 1607568
421 Ga0495673_0000010 3300047469 Bacteria 709599
422 Ga0495673_0000072 3300047469 Bacteria 213166
423 Ga0495673_0000497 3300047469 Bacteria 42003
424 Ga0495681_0035180 3300047470 Bacteria 2489
425 Ga0495686_0000410 3300047472 Bacteria 67863
426 Ga0495686_0015787 3300047472 Bacteria 5140
427 Ga0495686_0164192 3300047472 Bacteria 1295
428 Ga0496100_0008035 3300048903 Bacteria 5863
429 Ga0496100_0069002 3300048903 Bacteria 2353
430 Ga0496101_0013541 3300048904 Bacteria 5468
431 Ga0496102_0504999 3300048905 Bacteria 1131
432 Ga0496104_0091669 3300048907 Bacteria 2905
433 Ga0496105_0049796 3300048908 Bacteria 3460
434 Ga0496106_0005129 3300048909 Bacteria 9707
435 Ga0496106_0185210 3300048909 Bacteria 1654
436 Ga0496109_0592727 3300048912 Bacteria 1044
437 Ga0496111_0012685 3300048914 Bacteria 5712
438 Ga0496116_0041704 3300048919 Bacteria 3146
439 Ga0496116_0049201 3300048919 Bacteria 2822
440 Ga0496117_0000056 3300048920 Bacteria 271417
441 Ga0496117_0008972 3300048920 Bacteria 9411
442 Ga0496117_0038404 3300048920 Bacteria 3550
443 Ga0496118_0000047 3300048921 Bacteria 271417
444 Ga0496118_0008700 3300048921 Bacteria 10430
445 Ga0496118_0014826 3300048921 Bacteria 7268
446 Ga0496118_0097839 3300048921 Bacteria 1995
447 Ga0496119_0000182 3300048922 Bacteria 87907
448 Ga0496120_0000661 3300048923 Bacteria 50628
449 Ga0496121_0000419 3300048924 Bacteria 84137
450 Ga0496121_0001210 3300048924 Bacteria 45020
451 Ga0496121_0002943 3300048924 Bacteria 24885
452 Ga0496121_0005984 3300048924 Bacteria 15367
453 Ga0496121_0023487 3300048924 Bacteria 5936
454 Ga0496121_0039863 3300048924 Bacteria 4131
455 Ga0496121_0045798 3300048924 Bacteria 3753
456 Ga0496122_0005330 3300048925 Bacteria 15377
457 Ga0496122_0013398 3300048925 Bacteria 8029
458 Ga0496122_0024832 3300048925 Bacteria 5233
459 Ga0496122_0030266 3300048925 Bacteria 4541
460 Ga0496123_0001547 3300048926 Bacteria 31705
461 Ga0496123_0014233 3300048926 Bacteria 6612
462 Ga0496123_0020466 3300048926 Bacteria 5174
463 Ga0496124_0000006 3300048927 Bacteria 904259
464 Ga0496124_0001002 3300048927 Bacteria 44773
465 Ga0496124_0002574 3300048927 Bacteria 23511
466 Ga0496125_0017071 3300048928 Bacteria 6935
467 Ga0496126_0004479 3300048929 Bacteria 16675
468 Ga0496126_0005938 3300048929 Bacteria 13757
469 Ga0496126_0202223 3300048929 Bacteria 1677
470 Ga0496126_0211577 3300048929 Bacteria 1632
471 Ga0496126_0254915 3300048929 Bacteria 1461
472 Ga0495678_000028 3300049459 Bacteria 220080
473 Ga0495682_0001690 3300049460 Bacteria 11247
474 Ga0495682_0001819 3300049460 Bacteria 10718
475 Ga0501290_001765 3300049513 Bacteria 2885
476 Ga0501032_0033291 3300049569 Bacteria 3531
477 Ga0501032_0051863 3300049569 Bacteria 2765
478 Ga0501033_0000430 3300049570 Bacteria 40189
479 Ga0501033_0011789 3300049570 Bacteria 6681
480 Ga0501033_0090119 3300049570 Bacteria 2243
481 Ga0501034_0000305 3300049571 Bacteria 87329
482 Ga0501034_0023429 3300049571 Bacteria 6291
483 Ga0501034_0046470 3300049571 Bacteria 4386
484 Ga0501034_0550362 3300049571 Bacteria 1063
485 Ga0501036_0093793 3300049572 Bacteria 2536
486 Ga0501038_0244153 3300049574 Bacteria 1425
487 Ga0501043_0045728 3300049579 Bacteria 3442
488 Ga0501043_0058971 3300049579 Bacteria 3012
489 Ga0501043_0158767 3300049579 Bacteria 1767
490 Ga0501046_0111214 3300049580 Bacteria 2092
491 Ga0501046_0136361 3300049580 Bacteria 1859
492 Ga0501047_0041830 3300049581 Bacteria 4427
493 Ga0501047_0110824 3300049581 Bacteria 2627
494 Ga0501047_0195408 3300049581 Bacteria 1885
495 Ga0501047_0231459 3300049581 Bacteria 1701
496 Ga0501048_0045725 3300049582 Bacteria 3126
497 Ga0501069_0000311 3300049585 Bacteria 22175
498 Ga0501069_0033228 3300049585 Bacteria 2841
499 Ga0501070_0000265 3300049586 Bacteria 49246
500 Ga0501070_0008054 3300049586 Bacteria 8919
501 Ga0501070_0013742 3300049586 Bacteria 6819
502 Ga0501070_0028719 3300049586 Bacteria 4663
503 Ga0501070_0052824 3300049586 Bacteria 3372
504 Ga0501070_0202134 3300049586 Bacteria 1631
505 Ga0501070_0223592 3300049586 Bacteria 1543
506 Ga0501071_0279886 3300049587 Bacteria 1262
507 Ga0501073_0028016 3300049589 Bacteria 4024
508 Ga0501073_0041674 3300049589 Bacteria 3244
509 Ga0501073_0142861 3300049589 Bacteria 1658
510 Ga0501074_0026881 3300049590 Bacteria 4170
511 Ga0501074_0029623 3300049590 Bacteria 3965
512 Ga0501074_0138312 3300049590 Bacteria 1742
513 Ga0501077_0003192 3300049593 Bacteria 9878
514 Ga0501225_0004969 3300049705 Bacteria 3928
515 Ga0501079_0208299 3300049741 Bacteria 1527
516 Ga0501080_0042006 3300049742 Bacteria 4259
517 Ga0501080_0129633 3300049742 Bacteria 2334
518 Ga0501080_0220634 3300049742 Bacteria 1735
519 Ga0501080_0236532 3300049742 Bacteria 1668
520 Ga0501081_0044032 3300049743 Bacteria 3063
521 Ga0501275_000109 3300049772 Bacteria 8688
522 Ga0501035_0001879 3300049822 Bacteria 21138
523 Ga0501035_0025434 3300049822 Bacteria 5427
524 Ga0501035_0047260 3300049822 Bacteria 3864
525 Ga0501035_0052939 3300049822 Bacteria 3631
526 Ga0501035_0167333 3300049822 Bacteria 1900
527 Ga0501044_0030494 3300049823 Bacteria 5683
528 Ga0501044_0038254 3300049823 Bacteria 5010
529 Ga0501044_0137743 3300049823 Bacteria 2431
530 Ga0501044_0221312 3300049823 Bacteria 1843
531 Ga0501044_0226598 3300049823 Bacteria 1818
532 Ga0501045_0387828 3300049824 Bacteria 1040
533 nmdc:mga0k408_19504_c1 3300050493 Bacteria 3791
534 nmdc:mga05p37_222849_c1 3300050507 Bacteria 2275
535 nmdc:mga0n895_168574_c1 3300050512 Bacteria 2222
536 nmdc:mga0rr50_94228_c1 3300050513 Bacteria 2338
537 nmdc:mga0a205_7961_c1 3300050515 Bacteria 9626
538 nmdc:mga0sz30_80021_c1 3300050516 Bacteria 1413
539 Ga0500643_000053 3300053087 Bacteria 142202
540 Ga0500651_0093638 3300053093 Bacteria 1847
541 Ga0500555_000155 3300053103 Bacteria 32599
542 Ga0500607_034153 3300053121 Bacteria 2786
543 Ga0500633_0001639 3300053160 Bacteria 4325
544 Ga0500636_0000139 3300053177 Bacteria 37961
545 Ga0500625_027477 3300053729 Bacteria 2699
546 Ga0500625_151705 3300053729 Bacteria 870
547 Ga0500645_001021 3300053730 Bacteria 15687
548 Ga0501084_0547379 3300054114 Bacteria 978
549 2595451484 2593339239 Bacteria 4124669
550 2601672119 2600255292 Bacteria 6300551
551 2644340497 2643221660 Bacteria 4208257
552 2687581997 2687453130 Bacteria 4227172
553 2721028460 2718218334 Bacteria 4765486
554 2735835949 2734482264 Unclassified 5014763
555 2739229146 2738543009 Bacteria 4944499
556 2842782168 2842780639 Bacteria 4337790
557 2842915135 2842914999 Bacteria 4419378
558 2857552475 2857547612 Bacteria 6179999
559 2885085884 2885080285 Bacteria 6355622
560 2919088846 2919085039 Bacteria 4532964
561 2919404565 2919404418 Bacteria 4232372
562 2928965832 2928963466 Bacteria 5165703
563 2932415299 2932410948 Bacteria 6312192
564 2932421053 2932416698 Bacteria 6315112
565 2987608367 2987605356 Bacteria 4187822
566 Ga0070692_10002997
567 JGI24736J21556_1003426
568 JGI24741J21665_1000681
569 JGI24741J21665_1008685
570 JGI24740J21852_10002017
571 JGI24740J21852_10006374
572 Ga0055539_1007878
573 Ga0055533_1002033
574 Ga0055525_1000178
575 Ga0055527_1000090
576 Ga0055527_1000100
577 Ga0055535_1000201
578 Ga0055535_1000742
579 Ga0055535_1001175
580 Ga0055542_1000187
581 Ga0055542_1000191
582 Ga0055542_1000212
583 Ga0055542_1000236
584 Ga0055529_1000256
585 Ga0055529_1000259
586 Ga0058692_1000015
587 Ga0065707_10008645
588 Ga0070658_10001497
589 Ga0070658_10011621
590 Ga0070658_10331290
591 Ga0070683_100048770
592 Ga0070683_100088218
593 Ga0070670_100071853
594 Ga0070677_10011734
595 Ga0068869_100175413
596 Ga0070666_10000013
597 Ga0070680_100003199
598 Ga0070680_100020813
599 Ga0070680_100043710
600 Ga0070680_100050715
601 Ga0070680_100088523
602 Ga0070682_100001531
603 Ga0070682_100040815
604 Ga0070682_100080903
605 Ga0070660_100045685
606 Ga0070660_100049161
607 Ga0070660_100068709
608 Ga0070691_10003728
609 Ga0070691_10013583
610 Ga0070661_100005231
611 Ga0070661_100007885
612 Ga0070661_100051308
613 Ga0070661_100086661
614 Ga0070661_100369011
615 Ga0070692_10013814
616 Ga0070692_10021053
617 Ga0070669_100016333
618 Ga0070673_100381814
619 Ga0070659_100005909
620 Ga0070659_100030751
621 Ga0070659_100218530
622 Ga0070667_100014067
623 Ga0070714_100521861
624 Ga0070713_100007977
625 Ga0070663_100003461
626 Ga0070663_100005923
627 Ga0070663_100015446
628 Ga0070663_100065322
629 Ga0070681_10000721
630 Ga0070681_10000934
631 Ga0070681_10010860
632 Ga0070681_10073268
633 Ga0068867_100145442
634 Ga0070706_100021362
635 Ga0070706_100025560
636 Ga0070679_100000417
637 Ga0070679_100009935
638 Ga0070679_100064877
639 Ga0070684_100037216
640 Ga0070684_100042703
641 Ga0070672_100018953
642 Ga0070696_100001686
643 Ga0070696_100030549
644 Ga0070696_100037647
645 Ga0070693_100004068
646 Ga0070693_100179185
647 Ga0070665_100000333
648 Ga0068855_100019050
649 Ga0068855_100513013
650 Ga0068857_100044998
651 Ga0068857_100065959
652 Ga0068857_100102397
653 Ga0068857_100353015
654 Ga0068854_100289958
655 Ga0068856_100000797
656 Ga0068856_100005119
657 Ga0068856_100064205
658 Ga0068852_100040728
659 Ga0068852_100149769
660 Ga0068852_100377819
661 Ga0068859_100107681
662 Ga0068859_100418112
663 Ga0068866_10052177
664 Ga0068861_100572039
665 Ga0068851_10075389
666 Ga0068860_100097736
667 Ga0068860_100105639
668 Ga0068862_100012901
669 Ga0081455_10132185
670 Ga0075366_10077823
671 Ga0075434_100016515
672 Ga0097620_100107684
673 Ga0097620_100418080
674 Ga0075435_100026633
675 Ga0105240_10007819
676 Ga0105240_10009451
677 Ga0105240_10103339
678 Ga0111539_10518133
679 Ga0105245_10215208
680 Ga0105247_10001072
681 Ga0105243_10186949
682 Ga0105241_10059458
683 Ga0105241_10119003
684 Ga0105241_10129926
685 Ga0105237_10337884
686 Ga0105238_10000131
687 Ga0105238_10254080
688 Ga0105238_10310634
689 Ga0105239_10000023
690 Ga0105239_10026540
691 Ga0105246_10157009
692 Ga0157373_10006081
693 Ga0157373_10057143
694 Ga0157371_10011947
695 Ga0157371_10058745
696 Ga0157371_10064205
697 Ga0157370_10015411
698 Ga0157370_10028755
699 Ga0157370_10112207
700 Ga0157370_10433451
701 Ga0157369_10003442
702 Ga0157369_10036017
703 Ga0157369_10278688
704 Ga0163162_10095092
705 Ga0163162_10098108
706 Ga0157372_10002979
707 Ga0157372_10027202
708 Ga0157372_10077002
709 Ga0157372_10290878
710 Ga0157380_10176236
711 Ga0182008_10010199
712 Ga0157379_10041041
713 Ga0157379_10172101
714 Ga0182006_1000030
715 Ga0182006_1000062
716 Ga0182007_10000803
717 Ga0182007_10007098
718 Ga0182005_1000021
719 Ga0182005_1000035
720 Ga0182005_1015987
721 Ga0163161_10032533
722 Ga0163161_10195764
723 Ga0197907_10056721
724 Ga0206356_10103483
725 Ga0206356_11014676
726 Ga0206356_11464199
727 Ga0206354_10181591
728 Ga0206353_10124593
729 Ga0154015_1046164
730 Ga0154015_1409760
731 Ga0209674_100140
732 Ga0209674_100373
733 Ga0209674_101464
734 Ga0209672_100016
735 Ga0209672_101550
736 Ga0209437_100270
737 Ga0209258_100012
738 Ga0209258_100316
739 Ga0209258_105374
740 Ga0209026_1000117
741 Ga0209026_1000139
742 Ga0209148_1000005
743 Ga0209148_1000014
744 Ga0209148_1000244
745 Ga0209129_1001466
746 Ga0209233_1025529
747 Ga0209455_1000014
748 Ga0209455_1003988
749 Ga0209758_1016770
750 Ga0209050_1050163
751 Ga0209256_1028698
752 Ga0209257_1005084
753 Ga0207682_10045555
754 Ga0207710_10041760
755 Ga0207680_10000001
756 Ga0207647_10000191
757 Ga0207647_10003903
758 Ga0207647_10005977
759 Ga0207647_10024124
760 Ga0207645_10204939
761 Ga0207643_10105992
762 Ga0207705_10001045
763 Ga0207705_10001377
764 Ga0207705_10002025
765 Ga0207705_10020417
766 Ga0207705_10022308
767 Ga0207705_10294428
768 Ga0207684_10078191
769 Ga0207684_10178836
770 Ga0207654_10058208
771 Ga0207654_10148453
772 Ga0207707_10000106
773 Ga0207707_10000179
774 Ga0207707_10000812
775 Ga0207707_10002026
776 Ga0207707_10003633
777 Ga0207707_10003702
778 Ga0207707_10013685
779 Ga0207707_10049700
780 Ga0207695_10000588
781 Ga0207695_10001370
782 Ga0207695_10001701
783 Ga0207695_10002955
784 Ga0207695_10005835
785 Ga0207695_10055585
786 Ga0207695_10191438
787 Ga0207671_10253550
788 Ga0207660_10000747
789 Ga0207660_10004214
790 Ga0207660_10005475
791 Ga0207660_10008170
792 Ga0207660_10010788
793 Ga0207660_10032194
794 Ga0207657_10004478
795 Ga0207657_10010355
796 Ga0207657_10015112
797 Ga0207657_10015691
798 Ga0207657_10195262
799 Ga0207649_10002754
800 Ga0207649_10035547
801 Ga0207649_10325738
802 Ga0207652_10000442
803 Ga0207652_10000894
804 Ga0207652_10001820
805 Ga0207652_10002955
806 Ga0207652_10003323
807 Ga0207652_10041141
808 Ga0207652_10047840
809 Ga0207646_10036569
810 Ga0207681_10515256
811 Ga0207694_10000168
812 Ga0207694_10083941
813 Ga0207694_10091345
814 Ga0207650_10071522
815 Ga0207650_10123708
816 Ga0207659_10047537
817 Ga0207687_10122655
818 Ga0207687_10422199
819 Ga0207700_10211276
820 Ga0207644_10394141
821 Ga0207690_10000869
822 Ga0207690_10282058
823 Ga0207706_10004745
824 Ga0207665_10204550
825 Ga0207691_10014135
826 Ga0207661_10012370
827 Ga0207661_10012402
828 Ga0207661_10034544
829 Ga0207667_10001475
830 Ga0207667_10002217
831 Ga0207667_10006386
832 Ga0207667_10008576
833 Ga0207667_10020975
834 Ga0207640_10000480
835 Ga0207640_10000593
836 Ga0207640_10000958
837 Ga0207658_10005424
838 Ga0207677_10349409
839 Ga0207703_10080246
840 Ga0207703_10127815
841 Ga0207703_10597678
842 Ga0207639_10001978
843 Ga0207639_10005834
844 Ga0207639_10483319
845 Ga0207678_10002935
846 Ga0207678_10003548
847 Ga0207678_10012596
848 Ga0207678_10013161
849 Ga0207678_10016189
850 Ga0207678_10039903
851 Ga0207702_10001248
852 Ga0207702_10001348
853 Ga0207702_10001815
854 Ga0207648_10214032
855 Ga0207674_10005152
856 Ga0207674_10019922
857 Ga0207674_10037630
858 Ga0207674_10214714
859 Ga0207674_10458873
860 Ga0207675_100188811
861 Ga0207683_10320868
862 Ga0207698_10001252
863 Ga0207698_10016340
864 Ga0207698_10040295
865 Ga0209371_1000011
866 Ga0268266_10000001
867 Ga0268266_10000075
868 Ga0268264_10079476
869 Ga0268264_10413772
870 Ga0268256_1000011
871 Ga0307513_10055696
872 Ga0307414_10020692
873 Ga0307415_100512429
874 Ga0307510_10002367
875 Ga0307510_10043003
876 Ga0373959_0038111
877 Ga0373927_0171026
878 Ga0373933_0333883
879 Ga0373925_0004492
880 Ga0395899_0000089
881 Ga0395899_0004035
882 Ga0395899_0012531
883 Ga0395899_0073664
884 Ga0395899_0156525
885 Ga0395900_0000029
886 Ga0395900_0060933
887 Ga0395900_0076239
888 Ga0395900_0318405
889 Ga0395898_0000018
890 Ga0395898_0000241
891 Ga0395898_0029429
892 Ga0395898_0042982
893 Ga0395898_0318993
894 Ga0395905_0050410
895 Ga0395901_0003835
896 Ga0395901_0021565
897 Ga0395901_0062534
898 Ga0395901_0105859
899 Ga0395901_0172895
900 Ga0395901_0271045
901 Ga0395901_0307808
902 Ga0439436_0016966
903 Ga0439465_0000557
904 Ga0439449_0000004
905 Ga0451577_0112809
906 Ga0466969_0006829
907 Ga0466969_0031842
908 Ga0466972_0018206
909 Ga0466982_0000018
910 Ga0466966_0010735
911 Ga0466966_0021050
912 Ga0466961_0000345
913 Ga0466961_0004106
914 Ga0466961_0005564
915 Ga0466961_0012072
916 Ga0466963_0183809
917 Ga0466964_0014408
918 Ga0466971_0045353
919 Ga0466970_0014316
920 Ga0466970_0025429
921 Ga0466970_0058137
922 Ga0466957_0017384
923 Ga0466957_0049457
924 Ga0466959_0000148
925 Ga0466959_0002116
926 Ga0466959_0042263
927 Ga0451576_0012042
928 Ga0466958_0006082
929 Ga0466958_0008710
930 Ga0466958_0051309
931 Ga0466958_0079594
932 Ga0466967_0588574
933 Ga0495617_000035
934 Ga0495638_0000059
935 Ga0495638_0000100
936 Ga0495638_0073912
937 Ga0495650_0000350
938 Ga0495650_0000496
939 Ga0495650_0011152
940 Ga0495605_0059099
941 Ga0495639_0007327
942 Ga0495662_0008401
943 Ga0495584_0011251
944 Ga0495585_0003949
945 Ga0495607_0000012
946 Ga0495607_0000121
947 Ga0495607_0017066
948 Ga0495583_0005586
949 Ga0495606_0000490
950 Ga0495606_0000928
951 Ga0495606_0008792
952 Ga0495606_0009149
953 Ga0495606_0019290
954 Ga0495606_0084407
955 Ga0495606_0098211
956 Ga0495610_0017809
957 Ga0495616_0000027
958 Ga0495620_0001953
959 Ga0495620_0002406
960 Ga0495630_0000001
961 Ga0495631_0000249
962 Ga0495631_0000916
963 Ga0495632_0000019
964 Ga0495632_0030754
965 Ga0495637_0005961
966 Ga0495648_0005506
967 Ga0495648_0006579
968 Ga0495586_0203576
969 Ga0495609_0006069
970 Ga0495621_0010415
971 Ga0495668_0024046
972 Ga0495611_0000001
973 Ga0495611_0000027
974 Ga0495625_0000037
975 Ga0495625_0072075
976 Ga0495625_0126762
977 Ga0495661_0001009
978 Ga0495588_0204212
979 Ga0495670_0001266
980 Ga0495670_0017154
981 Ga0495589_0001848
982 Ga0495660_0000869
983 Ga0495660_0000936
984 Ga0495683_0001081
985 Ga0495679_000001
986 Ga0495673_0000010
987 Ga0495673_0000072
988 Ga0495673_0000497
989 Ga0495681_0035180
990 Ga0495686_0000410
991 Ga0495686_0015787
992 Ga0495686_0164192
993 Ga0496100_0008035
994 Ga0496100_0069002
995 Ga0496101_0013541
996 Ga0496102_0504999
997 Ga0496104_0091669
998 Ga0496105_0049796
999 Ga0496106_0005129
1000 Ga0496106_0185210
1001 Ga0496109_0592727
1002 Ga0496111_0012685
1003 Ga0496116_0041704
1004 Ga0496116_0049201
1005 Ga0496117_0000056
1006 Ga0496117_0008972
1007 Ga0496117_0038404
1008 Ga0496118_0000047
1009 Ga0496118_0008700
1010 Ga0496118_0014826
1011 Ga0496118_0097839
1012 Ga0496119_0000182
1013 Ga0496120_0000661
1014 Ga0496121_0000419
1015 Ga0496121_0001210
1016 Ga0496121_0002943
1017 Ga0496121_0005984
1018 Ga0496121_0023487
1019 Ga0496121_0039863
1020 Ga0496121_0045798
1021 Ga0496122_0005330
1022 Ga0496122_0013398
1023 Ga0496122_0024832
1024 Ga0496122_0030266
1025 Ga0496123_0001547
1026 Ga0496123_0014233
1027 Ga0496123_0020466
1028 Ga0496124_0000006
1029 Ga0496124_0001002
1030 Ga0496124_0002574
1031 Ga0496125_0017071
1032 Ga0496126_0004479
1033 Ga0496126_0005938
1034 Ga0496126_0202223
1035 Ga0496126_0211577
1036 Ga0496126_0254915
1037 Ga0495678_000028
1038 Ga0495682_0001690
1039 Ga0495682_0001819
1040 Ga0501290_001765
1041 Ga0501032_0033291
1042 Ga0501032_0051863
1043 Ga0501033_0000430
1044 Ga0501033_0011789
1045 Ga0501033_0090119
1046 Ga0501034_0000305
1047 Ga0501034_0023429
1048 Ga0501034_0046470
1049 Ga0501034_0550362
1050 Ga0501036_0093793
1051 Ga0501038_0244153
1052 Ga0501043_0045728
1053 Ga0501043_0058971
1054 Ga0501043_0158767
1055 Ga0501046_0111214
1056 Ga0501046_0136361
1057 Ga0501047_0041830
1058 Ga0501047_0110824
1059 Ga0501047_0195408
1060 Ga0501047_0231459
1061 Ga0501048_0045725
1062 Ga0501069_0000311
1063 Ga0501069_0033228
1064 Ga0501070_0000265
1065 Ga0501070_0008054
1066 Ga0501070_0013742
1067 Ga0501070_0028719
1068 Ga0501070_0052824
1069 Ga0501070_0202134
1070 Ga0501070_0223592
1071 Ga0501071_0279886
1072 Ga0501073_0028016
1073 Ga0501073_0041674
1074 Ga0501073_0142861
1075 Ga0501074_0026881
1076 Ga0501074_0029623
1077 Ga0501074_0138312
1078 Ga0501077_0003192
1079 Ga0501225_0004969
1080 Ga0501079_0208299
1081 Ga0501080_0042006
1082 Ga0501080_0129633
1083 Ga0501080_0220634
1084 Ga0501080_0236532
1085 Ga0501081_0044032
1086 Ga0501275_000109
1087 Ga0501035_0001879
1088 Ga0501035_0025434
1089 Ga0501035_0047260
1090 Ga0501035_0052939
1091 Ga0501035_0167333
1092 Ga0501044_0030494
1093 Ga0501044_0038254
1094 Ga0501044_0137743
1095 Ga0501044_0221312
1096 Ga0501044_0226598
1097 Ga0501045_0387828
1098 nmdc:mga0k408_19504_c1
1099 nmdc:mga05p37_222849_c1
1100 nmdc:mga0n895_168574_c1
1101 nmdc:mga0rr50_94228_c1
1102 nmdc:mga0a205_7961_c1
1103 nmdc:mga0sz30_80021_c1
1104 Ga0500643_000053
1105 Ga0500651_0093638
1106 Ga0500555_000155
1107 Ga0500607_034153
1108 Ga0500633_0001639
1109 Ga0500636_0000139
1110 Ga0500625_027477
1111 Ga0500625_151705
1112 Ga0500645_001021
1113 Ga0501084_0547379
1114 2595451484
1115 2601672119
1116 2644340497
1117 2687581997
1118 2721028460
1119 2735835949
1120 2739229146
1121 2842782168
1122 2842915135
1123 2857552475
1124 2885085884
1125 2919088846
1126 2919404565
1127 2928965832
1128 2932415299
1129 2932421053
1130 2987608367

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

41

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m7o-assembly1.cif.gz_A the crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from staphylococcus epidermidis atcc 12228. 0.851 3 252
5ad1-assembly1.cif.gz_A a complex of the synthetic siderophore analogue fe(iii)-8-licam with the ceue periplasmic protein from campylobacter jejuni 0.8385 4 252
5khl-assembly1.cif.gz_B crystal structure of periplasmic heme binding protein hutb of vibrio cholerae 0.8284 5 251
8bnw-assembly1.cif.gz_A x-ray structure of the ceue homologue from parageobacillus thermoglucosidasius - apo form 0.8276 3 252
5lwh-assembly1.cif.gz_A ceue (y288f variant) a periplasmic protein from campylobacter jejuni. 0.8273 4 252
ID Description Score Start End Superfamily
af_Q2G0F6_19_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9025 5 121 3.40.50.1980
2r79A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8831 4 121 3.40.50.1980
2rg7D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8826 5 121 3.40.50.1980
5y8bA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8731 3 121 3.40.50.1980
5khlB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8689 5 121 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A850T0U8-F1-model_v4 ABC transporter substrate-binding protein 0.987 135 252
AF-A0A2M8E364-F1-model_v4 Cobalamin-binding protein 0.9864 135 255
AF-A0A4Q6GJA2-F1-model_v4 Cobalamin-binding protein 0.9859 135 259
AF-A0A257CXH8-F1-model_v4 Cobalamin-binding protein 0.9814 150 255
AF-A0A1G0HXH0-F1-model_v4 Cobalamin-binding protein 0.979 3 259 GO:0071281

Map