F464256
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 565 | 369 | 1130 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10106747|Ga0105241_101067472 |
| Length | 392 |
| Sequence | MAALEIPAGNEGLQAGAGNDDRASQWLFGRKRPAKRRDLRRNGPVGVQFLFRTLECARGRRMSAVAPRHVSVLGREAVEMLSPHAGGIYVDATFGAGGYSRMILDTKGTRVIGIDRDRSAITSGFDLVDRADGRLTLVEDRFSNLAEVCAAQDIDAVDGVVMDVGVSSMQLDSAERGFSFRFGGPLDMRMGHDGPTAADVIAKASETDLANIIYIFGEERHSRGVARAIVAARKEAPITTTQALADIVGRVVRSKPNEIHPATRTFQALRIFVNAELDELHLALSAAERVLKPGGRLVVVSFHSLEDRIVKNFLNQRGKAGGGSRHLPEVAQAEPSFQILTRRPVTPGDAEISANPRARSAKLRAAERTAAPAHAADKLPAWPTIDAVMRGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 39 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 42 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 48 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 133 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 142 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 143 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 144 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 145 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 146 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 147 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 148 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 157 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 278 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 289 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 290 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 292 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 293 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 294 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 295 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 296 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 297 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 299 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 303 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 304 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 305 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 306 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 310 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 313 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 315 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 319 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 320 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 321 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 322 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 323 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 324 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 325 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 326 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 327 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 328 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 329 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 330 | 2791355199 | |||
| 331 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 332 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 333 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 334 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 335 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 336 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 337 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 338 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 339 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 340 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 341 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 342 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 343 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 344 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 345 | 2904699407 | |||
| 346 | 2906610324 | |||
| 347 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 348 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 349 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 350 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 351 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 352 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 353 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 354 | 2922425934 | |||
| 355 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 356 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 357 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 358 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 359 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 360 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 361 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 362 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 363 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 364 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 365 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 366 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 367 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 368 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 369 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.91 |
| Metatranscriptomes | 0.53 |
| Isolates | 8.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.04 |
| Nodule | 6.55 |
| Rhizoplane | 6.9 |
| Rhizosphere | 61.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105241_10106747 | 3300009174 | Bacteria | 2235 |
| 2 | JGI25404J52841_10003909 | 3300003659 | Bacteria | 2985 |
| 3 | JGI25404J52841_10008965 | 3300003659 | Bacteria | 2137 |
| 4 | JGI25404J52841_10018149 | 3300003659 | Bacteria | 1524 |
| 5 | Ga0065165_1044756 | 3300005262 | Bacteria | 1293 |
| 6 | Ga0068869_100265783 | 3300005334 | Bacteria | 1375 |
| 7 | Ga0070680_100048472 | 3300005336 | Bacteria | 3462 |
| 8 | Ga0070680_100078039 | 3300005336 | Bacteria | 2728 |
| 9 | Ga0070660_100006941 | 3300005339 | Bacteria | 7854 |
| 10 | Ga0070674_100051862 | 3300005356 | Bacteria | 2828 |
| 11 | Ga0070659_100025076 | 3300005366 | Bacteria | 4578 |
| 12 | Ga0070667_100113013 | 3300005367 | Bacteria | 2356 |
| 13 | Ga0070714_100252782 | 3300005435 | Bacteria | 1630 |
| 14 | Ga0070713_100000737 | 3300005436 | Bacteria | 20973 |
| 15 | Ga0070663_100071388 | 3300005455 | Bacteria | 2526 |
| 16 | Ga0070663_100139075 | 3300005455 | Bacteria | 1852 |
| 17 | Ga0070663_100181878 | 3300005455 | Bacteria | 1631 |
| 18 | Ga0070663_100228324 | 3300005455 | Bacteria | 1465 |
| 19 | Ga0070663_100324018 | 3300005455 | Bacteria | 1240 |
| 20 | Ga0070678_100033005 | 3300005456 | Bacteria | 3589 |
| 21 | Ga0070678_100041257 | 3300005456 | Bacteria | 3270 |
| 22 | Ga0070678_100165609 | 3300005456 | Bacteria | 1795 |
| 23 | Ga0070681_10277291 | 3300005458 | Bacteria | 1587 |
| 24 | Ga0068867_100046272 | 3300005459 | Bacteria | 3195 |
| 25 | Ga0070707_100083285 | 3300005468 | Bacteria | 3090 |
| 26 | Ga0070684_100078477 | 3300005535 | Bacteria | 2917 |
| 27 | Ga0070684_100175605 | 3300005535 | Bacteria | 1947 |
| 28 | Ga0070697_100012461 | 3300005536 | Bacteria | 6662 |
| 29 | Ga0068853_100025677 | 3300005539 | Bacteria | 4944 |
| 30 | Ga0068853_100035442 | 3300005539 | Bacteria | 4238 |
| 31 | Ga0068853_100097075 | 3300005539 | Bacteria | 2600 |
| 32 | Ga0068853_100135051 | 3300005539 | Bacteria | 2211 |
| 33 | Ga0070665_100035286 | 3300005548 | Bacteria | 5028 |
| 34 | Ga0068855_100110586 | 3300005563 | Bacteria | 3154 |
| 35 | Ga0068855_100152079 | 3300005563 | Bacteria | 2631 |
| 36 | Ga0070664_100122015 | 3300005564 | Bacteria | 2283 |
| 37 | Ga0068857_100018285 | 3300005577 | Bacteria | 6148 |
| 38 | Ga0068856_100018359 | 3300005614 | Bacteria | 6779 |
| 39 | Ga0068852_100005171 | 3300005616 | Bacteria | 9302 |
| 40 | Ga0068852_100251929 | 3300005616 | Bacteria | 1692 |
| 41 | Ga0068864_100067374 | 3300005618 | Bacteria | 3108 |
| 42 | Ga0068866_10029928 | 3300005718 | Bacteria | 2608 |
| 43 | Ga0068861_100128785 | 3300005719 | Bacteria | 2052 |
| 44 | Ga0068861_100190649 | 3300005719 | Bacteria | 1713 |
| 45 | Ga0068851_10007403 | 3300005834 | Bacteria | 5038 |
| 46 | Ga0068858_100079376 | 3300005842 | Bacteria | 3049 |
| 47 | Ga0068860_100138436 | 3300005843 | Bacteria | 2338 |
| 48 | Ga0068862_100348981 | 3300005844 | Bacteria | 1372 |
| 49 | Ga0068862_100434549 | 3300005844 | Bacteria | 1234 |
| 50 | Ga0081455_10004734 | 3300005937 | Bacteria | 15128 |
| 51 | Ga0081455_10007808 | 3300005937 | Bacteria | 11208 |
| 52 | Ga0081455_10016954 | 3300005937 | Bacteria | 7002 |
| 53 | Ga0081540_1002304 | 3300005983 | Bacteria | 15663 |
| 54 | Ga0081540_1006170 | 3300005983 | Bacteria | 8787 |
| 55 | Ga0081540_1006942 | 3300005983 | Bacteria | 8161 |
| 56 | Ga0081540_1009315 | 3300005983 | Bacteria | 6773 |
| 57 | Ga0081540_1010096 | 3300005983 | Bacteria | 6425 |
| 58 | Ga0081540_1016124 | 3300005983 | Bacteria | 4693 |
| 59 | Ga0081540_1054617 | 3300005983 | Bacteria | 1951 |
| 60 | Ga0081540_1084573 | 3300005983 | Bacteria | 1416 |
| 61 | Ga0081539_10017928 | 3300005985 | Bacteria | 4941 |
| 62 | Ga0070717_10005839 | 3300006028 | Bacteria | 9020 |
| 63 | Ga0070717_10009960 | 3300006028 | Bacteria | 7151 |
| 64 | Ga0070717_10328014 | 3300006028 | Bacteria | 1365 |
| 65 | Ga0075365_10045342 | 3300006038 | Bacteria | 2884 |
| 66 | Ga0075365_10060689 | 3300006038 | Bacteria | 2523 |
| 67 | Ga0075368_10005882 | 3300006042 | Bacteria | 4246 |
| 68 | Ga0075363_100008428 | 3300006048 | Bacteria | 4798 |
| 69 | Ga0075363_100016844 | 3300006048 | Bacteria | 3614 |
| 70 | Ga0075363_100136544 | 3300006048 | Bacteria | 1378 |
| 71 | Ga0070712_100037139 | 3300006175 | Bacteria | 3319 |
| 72 | Ga0075367_10010997 | 3300006178 | Bacteria | 4772 |
| 73 | Ga0075367_10027799 | 3300006178 | Bacteria | 3221 |
| 74 | Ga0075367_10030229 | 3300006178 | Bacteria | 3104 |
| 75 | Ga0075369_10011679 | 3300006186 | Bacteria | 3458 |
| 76 | Ga0075369_10129618 | 3300006186 | Bacteria | 1145 |
| 77 | Ga0075366_10023699 | 3300006195 | Bacteria | 3576 |
| 78 | Ga0075434_100335438 | 3300006871 | Bacteria | 1532 |
| 79 | Ga0068865_100023996 | 3300006881 | Bacteria | 3998 |
| 80 | Ga0097620_100442187 | 3300006931 | Bacteria | 1396 |
| 81 | Ga0099824_1010925 | 3300006942 | Bacteria | 10470 |
| 82 | Ga0099795_10017149 | 3300007788 | Bacteria | 2305 |
| 83 | Ga0105240_10083712 | 3300009093 | Bacteria | 3913 |
| 84 | Ga0105240_10212051 | 3300009093 | Bacteria | 2262 |
| 85 | Ga0105240_10235415 | 3300009093 | Bacteria | 2125 |
| 86 | Ga0111539_10050924 | 3300009094 | Bacteria | 4933 |
| 87 | Ga0111539_10290469 | 3300009094 | Bacteria | 1903 |
| 88 | Ga0105245_10025333 | 3300009098 | Bacteria | 5217 |
| 89 | Ga0114129_10030205 | 3300009147 | Bacteria | 7674 |
| 90 | Ga0105243_10155291 | 3300009148 | Bacteria | 1967 |
| 91 | Ga0105242_10135058 | 3300009176 | Bacteria | 2134 |
| 92 | Ga0105248_10343959 | 3300009177 | Bacteria | 1679 |
| 93 | Ga0105237_10008841 | 3300009545 | Bacteria | 10858 |
| 94 | Ga0105238_10038174 | 3300009551 | Bacteria | 4878 |
| 95 | Ga0105249_10245706 | 3300009553 | Bacteria | 1772 |
| 96 | Ga0099796_10006685 | 3300010159 | Bacteria | 2969 |
| 97 | Ga0105239_10044859 | 3300010375 | Bacteria | 4846 |
| 98 | Ga0105239_10108687 | 3300010375 | Bacteria | 3073 |
| 99 | Ga0105246_10187385 | 3300011119 | Bacteria | 1598 |
| 100 | Ga0157370_10108080 | 3300013104 | Bacteria | 2601 |
| 101 | Ga0157369_10037312 | 3300013105 | Bacteria | 5320 |
| 102 | Ga0157378_10005423 | 3300013297 | Bacteria | 11182 |
| 103 | Ga0163162_10039430 | 3300013306 | Bacteria | 4720 |
| 104 | Ga0157372_10372253 | 3300013307 | Bacteria | 1664 |
| 105 | Ga0157375_10018137 | 3300013308 | Bacteria | 6377 |
| 106 | Ga0157375_10196693 | 3300013308 | Bacteria | 2171 |
| 107 | Ga0163163_10054256 | 3300014325 | Bacteria | 3959 |
| 108 | Ga0163163_10179875 | 3300014325 | Bacteria | 2162 |
| 109 | Ga0157380_10118180 | 3300014326 | Bacteria | 2241 |
| 110 | Ga0157380_10344369 | 3300014326 | Bacteria | 1392 |
| 111 | Ga0157377_10102099 | 3300014745 | Bacteria | 1711 |
| 112 | Ga0157379_10228269 | 3300014968 | Bacteria | 1687 |
| 113 | Ga0157376_10110706 | 3300014969 | Bacteria | 2416 |
| 114 | Ga0157376_10157934 | 3300014969 | Bacteria | 2053 |
| 115 | Ga0206356_10999127 | 3300020070 | Bacteria | 1261 |
| 116 | Ga0206353_10526543 | 3300020082 | Bacteria | 2458 |
| 117 | Ga0213875_10004231 | 3300021388 | Bacteria | 7922 |
| 118 | Ga0209233_1017502 | 3300025261 | Bacteria | 1950 |
| 119 | Ga0209564_1000485 | 3300025295 | Bacteria | 66032 |
| 120 | Ga0209758_1029463 | 3300025297 | Bacteria | 2294 |
| 121 | Ga0207647_10116240 | 3300025904 | Bacteria | 1579 |
| 122 | Ga0207645_10065282 | 3300025907 | Bacteria | 2326 |
| 123 | Ga0207643_10037952 | 3300025908 | Bacteria | 2705 |
| 124 | Ga0207705_10057717 | 3300025909 | Bacteria | 2800 |
| 125 | Ga0207705_10199235 | 3300025909 | Bacteria | 1517 |
| 126 | Ga0207654_10231413 | 3300025911 | Bacteria | 1231 |
| 127 | Ga0207707_10009744 | 3300025912 | Bacteria | 8335 |
| 128 | Ga0207695_10045639 | 3300025913 | Bacteria | 4650 |
| 129 | Ga0207695_10103117 | 3300025913 | Bacteria | 2845 |
| 130 | Ga0207695_10153360 | 3300025913 | Bacteria | 2241 |
| 131 | Ga0207671_10165007 | 3300025914 | Bacteria | 1717 |
| 132 | Ga0207693_10100202 | 3300025915 | Bacteria | 2271 |
| 133 | Ga0207693_10152779 | 3300025915 | Bacteria | 1816 |
| 134 | Ga0207663_10003103 | 3300025916 | Bacteria | 8061 |
| 135 | Ga0207660_10017276 | 3300025917 | Bacteria | 4790 |
| 136 | Ga0207660_10082761 | 3300025917 | Bacteria | 2362 |
| 137 | Ga0207657_10002789 | 3300025919 | Bacteria | 18797 |
| 138 | Ga0207657_10009166 | 3300025919 | Bacteria | 9982 |
| 139 | Ga0207657_10223669 | 3300025919 | Bacteria | 1507 |
| 140 | Ga0207649_10129436 | 3300025920 | Bacteria | 1712 |
| 141 | Ga0207652_10026914 | 3300025921 | Bacteria | 4792 |
| 142 | Ga0207652_10128177 | 3300025921 | Bacteria | 2261 |
| 143 | Ga0207646_10044477 | 3300025922 | Bacteria | 3986 |
| 144 | Ga0207700_10001341 | 3300025928 | Bacteria | 13962 |
| 145 | Ga0207700_10052318 | 3300025928 | Bacteria | 3053 |
| 146 | Ga0207664_10135871 | 3300025929 | Bacteria | 2075 |
| 147 | Ga0207664_10213631 | 3300025929 | Bacteria | 1670 |
| 148 | Ga0207644_10025924 | 3300025931 | Bacteria | 4035 |
| 149 | Ga0207644_10271459 | 3300025931 | Bacteria | 1359 |
| 150 | Ga0207690_10211414 | 3300025932 | Bacteria | 1479 |
| 151 | Ga0207706_10030770 | 3300025933 | Bacteria | 4787 |
| 152 | Ga0207706_10059207 | 3300025933 | Bacteria | 3373 |
| 153 | Ga0207669_10049859 | 3300025937 | Bacteria | 2499 |
| 154 | Ga0207704_10068997 | 3300025938 | Bacteria | 2231 |
| 155 | Ga0207665_10060864 | 3300025939 | Bacteria | 2558 |
| 156 | Ga0207665_10123310 | 3300025939 | Bacteria | 1832 |
| 157 | Ga0207665_10361916 | 3300025939 | Bacteria | 1097 |
| 158 | Ga0207691_10024095 | 3300025940 | Bacteria | 5724 |
| 159 | Ga0207691_10107175 | 3300025940 | Bacteria | 2488 |
| 160 | Ga0207711_10092636 | 3300025941 | Bacteria | 2660 |
| 161 | Ga0207711_10131926 | 3300025941 | Bacteria | 2241 |
| 162 | Ga0207689_10036612 | 3300025942 | Bacteria | 4073 |
| 163 | Ga0207689_10112445 | 3300025942 | Bacteria | 2238 |
| 164 | Ga0207689_10157449 | 3300025942 | Bacteria | 1872 |
| 165 | Ga0207679_10014830 | 3300025945 | Bacteria | 5135 |
| 166 | Ga0207667_10040971 | 3300025949 | Bacteria | 4929 |
| 167 | Ga0207667_10205716 | 3300025949 | Bacteria | 2018 |
| 168 | Ga0207667_10443534 | 3300025949 | Bacteria | 1319 |
| 169 | Ga0207712_10281521 | 3300025961 | Bacteria | 1357 |
| 170 | Ga0207668_10090473 | 3300025972 | Bacteria | 2246 |
| 171 | Ga0207668_10254754 | 3300025972 | Bacteria | 1427 |
| 172 | Ga0207668_10280298 | 3300025972 | Bacteria | 1366 |
| 173 | Ga0207640_10072645 | 3300025981 | Bacteria | 2322 |
| 174 | Ga0207658_10364229 | 3300025986 | Bacteria | 1262 |
| 175 | Ga0207677_10071187 | 3300026023 | Bacteria | 2453 |
| 176 | Ga0207703_10027603 | 3300026035 | Bacteria | 4470 |
| 177 | Ga0207639_10042338 | 3300026041 | Bacteria | 3412 |
| 178 | Ga0207639_10145880 | 3300026041 | Bacteria | 1977 |
| 179 | Ga0207639_10223410 | 3300026041 | Bacteria | 1628 |
| 180 | Ga0207678_10008446 | 3300026067 | Bacteria | 9083 |
| 181 | Ga0207678_10040941 | 3300026067 | Bacteria | 4017 |
| 182 | Ga0207678_10079088 | 3300026067 | Bacteria | 2816 |
| 183 | Ga0207702_10015921 | 3300026078 | Bacteria | 6227 |
| 184 | Ga0207641_10402499 | 3300026088 | Bacteria | 1314 |
| 185 | Ga0207648_10132038 | 3300026089 | Bacteria | 2198 |
| 186 | Ga0207674_10027243 | 3300026116 | Bacteria | 6050 |
| 187 | Ga0207675_100374653 | 3300026118 | Bacteria | 1399 |
| 188 | Ga0207675_100411464 | 3300026118 | Bacteria | 1334 |
| 189 | Ga0207683_10037487 | 3300026121 | Bacteria | 4221 |
| 190 | Ga0207683_10059426 | 3300026121 | Bacteria | 3358 |
| 191 | Ga0207683_10082205 | 3300026121 | Bacteria | 2861 |
| 192 | Ga0207683_10236526 | 3300026121 | Bacteria | 1666 |
| 193 | Ga0207698_10066624 | 3300026142 | Bacteria | 2835 |
| 194 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 195 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 196 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 197 | Ga0268266_10264387 | 3300028379 | Bacteria | 1595 |
| 198 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 199 | Ga0268264_10213648 | 3300028381 | Bacteria | 1772 |
| 200 | Ga0265334_10011851 | 3300028573 | Bacteria | 3663 |
| 201 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 202 | Ga0307517_10150514 | 3300028786 | Bacteria | 1598 |
| 203 | Ga0307515_10078972 | 3300028794 | Bacteria | 4318 |
| 204 | Ga0307515_10242706 | 3300028794 | Bacteria | 1569 |
| 205 | Ga0265330_10057589 | 3300031235 | Bacteria | 1695 |
| 206 | Ga0265325_10049180 | 3300031241 | Bacteria | 2177 |
| 207 | Ga0265340_10034255 | 3300031247 | Bacteria | 2526 |
| 208 | Ga0265339_10042644 | 3300031249 | Bacteria | 2512 |
| 209 | Ga0265331_10021773 | 3300031250 | Bacteria | 3276 |
| 210 | Ga0307508_10049820 | 3300031616 | Bacteria | 3730 |
| 211 | Ga0307508_10178732 | 3300031616 | Bacteria | 1725 |
| 212 | Ga0265314_10148520 | 3300031711 | Bacteria | 1440 |
| 213 | Ga0307516_10008463 | 3300031730 | Bacteria | 11640 |
| 214 | Ga0307516_10195070 | 3300031730 | Bacteria | 1748 |
| 215 | Ga0307516_10202264 | 3300031730 | Bacteria | 1705 |
| 216 | Ga0307516_10309168 | 3300031730 | Bacteria | 1254 |
| 217 | Ga0307410_10204207 | 3300031852 | Bacteria | 1511 |
| 218 | Ga0307416_100217458 | 3300032002 | Bacteria | 1829 |
| 219 | Ga0307415_100170540 | 3300032126 | Bacteria | 1696 |
| 220 | Ga0307507_10147401 | 3300033179 | Bacteria | 1783 |
| 221 | Ga0307510_10203875 | 3300033180 | Bacteria | 1509 |
| 222 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 223 | Ga0316215_1000538 | 3300033544 | Bacteria | 4160 |
| 224 | Ga0373950_0014045 | 3300034818 | Bacteria | 1344 |
| 225 | Ga0373928_0006063 | 3300035084 | Bacteria | 2318 |
| 226 | Ga0373929_0016120 | 3300035085 | Bacteria | 1461 |
| 227 | Ga0373934_0004243 | 3300035086 | Bacteria | 5288 |
| 228 | Ga0373951_0045853 | 3300035091 | Bacteria | 1065 |
| 229 | Ga0373923_0018561 | 3300035111 | Bacteria | 2679 |
| 230 | Ga0373932_0004494 | 3300035112 | Bacteria | 3295 |
| 231 | Ga0373936_0023057 | 3300035113 | Bacteria | 2424 |
| 232 | Ga0373945_0108722 | 3300035116 | Bacteria | 1092 |
| 233 | Ga0373953_0003844 | 3300035117 | Bacteria | 4728 |
| 234 | Ga0373954_0003555 | 3300035118 | Bacteria | 6623 |
| 235 | Ga0373957_0001601 | 3300035120 | Bacteria | 6192 |
| 236 | Ga0373943_0002133 | 3300035170 | Bacteria | 8990 |
| 237 | Ga0373946_0016813 | 3300035171 | Bacteria | 2792 |
| 238 | Ga0373931_0011398 | 3300035691 | Bacteria | 4295 |
| 239 | Ga0373935_0000259 | 3300035692 | Bacteria | 26229 |
| 240 | Ga0373935_0031447 | 3300035692 | Bacteria | 3294 |
| 241 | Ga0373927_0002522 | 3300035695 | Bacteria | 13350 |
| 242 | Ga0373927_0007423 | 3300035695 | Bacteria | 7422 |
| 243 | Ga0373927_0038511 | 3300035695 | Bacteria | 3104 |
| 244 | Ga0373927_0089561 | 3300035695 | Bacteria | 1998 |
| 245 | Ga0373927_0182849 | 3300035695 | Bacteria | 1375 |
| 246 | Ga0373933_0008746 | 3300035724 | Bacteria | 5520 |
| 247 | Ga0373947_0000217 | 3300035725 | Bacteria | 32254 |
| 248 | Ga0373947_0013560 | 3300035725 | Bacteria | 4670 |
| 249 | Ga0373937_0014756 | 3300036401 | Bacteria | 6898 |
| 250 | Ga0373937_0027287 | 3300036401 | Bacteria | 5164 |
| 251 | Ga0372808_000294 | 3300036459 | Bacteria | 3496 |
| 252 | Ga0373925_0003792 | 3300037068 | Bacteria | 11621 |
| 253 | Ga0373925_0012744 | 3300037068 | Bacteria | 6092 |
| 254 | Ga0373925_0226616 | 3300037068 | Bacteria | 1493 |
| 255 | Ga0395900_0067826 | 3300037418 | Bacteria | 3665 |
| 256 | Ga0395898_0137402 | 3300037466 | Bacteria | 2340 |
| 257 | Ga0395901_0248873 | 3300038443 | Bacteria | 1852 |
| 258 | Ga0436365_1200085 | 3300039437 | Bacteria | 5790 |
| 259 | Ga0466972_0000520 | 3300044658 | Bacteria | 19029 |
| 260 | Ga0466965_0140965 | 3300044683 | Bacteria | 1255 |
| 261 | Ga0466966_0005474 | 3300044684 | Bacteria | 8351 |
| 262 | Ga0466961_0000081 | 3300044693 | Bacteria | 59450 |
| 263 | Ga0466963_0006536 | 3300044694 | Bacteria | 6904 |
| 264 | Ga0466963_0104587 | 3300044694 | Bacteria | 1940 |
| 265 | Ga0466959_0007840 | 3300045049 | Bacteria | 7516 |
| 266 | Ga0466959_0088585 | 3300045049 | Bacteria | 2225 |
| 267 | Ga0495592_0004003 | 3300046454 | Bacteria | 10691 |
| 268 | Ga0495592_0010878 | 3300046454 | Bacteria | 6865 |
| 269 | Ga0495603_0000352 | 3300046455 | Bacteria | 24722 |
| 270 | Ga0495603_0009224 | 3300046455 | Bacteria | 5963 |
| 271 | Ga0495629_0000341 | 3300046459 | Bacteria | 39851 |
| 272 | Ga0495629_0090105 | 3300046459 | Bacteria | 2140 |
| 273 | Ga0495638_0148152 | 3300046460 | Bacteria | 1363 |
| 274 | Ga0495653_0003343 | 3300046463 | Bacteria | 12890 |
| 275 | Ga0495580_0003184 | 3300046472 | Bacteria | 14061 |
| 276 | Ga0495582_0000245 | 3300046473 | Bacteria | 30263 |
| 277 | Ga0495639_0000275 | 3300046475 | Bacteria | 25388 |
| 278 | Ga0495639_0038018 | 3300046475 | Bacteria | 2160 |
| 279 | Ga0495662_0001790 | 3300046476 | Bacteria | 10755 |
| 280 | Ga0495664_0017791 | 3300046477 | Bacteria | 4064 |
| 281 | Ga0495584_0099900 | 3300046491 | Bacteria | 1466 |
| 282 | Ga0495594_0001300 | 3300046499 | Bacteria | 13017 |
| 283 | Ga0495607_0039517 | 3300046501 | Bacteria | 2817 |
| 284 | Ga0495610_0044994 | 3300046512 | Bacteria | 2187 |
| 285 | Ga0495610_0096503 | 3300046512 | Bacteria | 1331 |
| 286 | Ga0495620_0037158 | 3300046515 | Bacteria | 2172 |
| 287 | Ga0495628_0012504 | 3300046516 | Bacteria | 7154 |
| 288 | Ga0495628_0039880 | 3300046516 | Bacteria | 3755 |
| 289 | Ga0495630_0003021 | 3300046517 | Bacteria | 11666 |
| 290 | Ga0495631_0015793 | 3300046518 | Bacteria | 3611 |
| 291 | Ga0495648_0001680 | 3300046524 | Bacteria | 21407 |
| 292 | Ga0495648_0003398 | 3300046524 | Bacteria | 13990 |
| 293 | Ga0495648_0104146 | 3300046524 | Bacteria | 1559 |
| 294 | Ga0495652_0077136 | 3300046529 | Bacteria | 2763 |
| 295 | Ga0495665_0000042 | 3300046531 | Bacteria | 49467 |
| 296 | Ga0495640_0011597 | 3300046533 | Bacteria | 6773 |
| 297 | Ga0495598_0004661 | 3300046537 | Bacteria | 2984 |
| 298 | Ga0495609_0024409 | 3300046538 | Bacteria | 2774 |
| 299 | Ga0495621_0030236 | 3300046539 | Bacteria | 1850 |
| 300 | Ga0495645_0001286 | 3300046543 | Bacteria | 17104 |
| 301 | Ga0495622_0001455 | 3300046557 | Bacteria | 11926 |
| 302 | Ga0495622_0002944 | 3300046557 | Bacteria | 8113 |
| 303 | Ga0495622_0041288 | 3300046557 | Bacteria | 2145 |
| 304 | Ga0495667_0003108 | 3300046559 | Bacteria | 11138 |
| 305 | Ga0495656_0028293 | 3300046615 | Bacteria | 2247 |
| 306 | Ga0495656_0039458 | 3300046615 | Bacteria | 1961 |
| 307 | Ga0495668_0072209 | 3300046616 | Bacteria | 1896 |
| 308 | Ga0495668_0115168 | 3300046616 | Bacteria | 1470 |
| 309 | Ga0495668_0147802 | 3300046616 | Bacteria | 1287 |
| 310 | Ga0495634_0000249 | 3300046642 | Bacteria | 50835 |
| 311 | Ga0495634_0009610 | 3300046642 | Bacteria | 7125 |
| 312 | Ga0495625_0024104 | 3300046660 | Bacteria | 4637 |
| 313 | Ga0495635_0000239 | 3300046663 | Bacteria | 34889 |
| 314 | Ga0495661_0024354 | 3300046665 | Bacteria | 3918 |
| 315 | Ga0495588_0003608 | 3300046674 | Bacteria | 6764 |
| 316 | Ga0495588_0044419 | 3300046674 | Bacteria | 2276 |
| 317 | Ga0495599_0001118 | 3300046678 | Bacteria | 15101 |
| 318 | Ga0495646_0008784 | 3300046680 | Bacteria | 6417 |
| 319 | Ga0495646_0015009 | 3300046680 | Bacteria | 4919 |
| 320 | Ga0495647_0000418 | 3300046681 | Bacteria | 12174 |
| 321 | Ga0495658_0001216 | 3300046683 | Bacteria | 13515 |
| 322 | Ga0495669_0043583 | 3300046684 | Bacteria | 1998 |
| 323 | Ga0495669_0148817 | 3300046684 | Bacteria | 1108 |
| 324 | Ga0495613_0000929 | 3300046689 | Bacteria | 22466 |
| 325 | Ga0495613_0039302 | 3300046689 | Bacteria | 3508 |
| 326 | Ga0495624_0000538 | 3300046690 | Bacteria | 29656 |
| 327 | Ga0495671_0094728 | 3300046692 | Bacteria | 1461 |
| 328 | Ga0495589_0112921 | 3300046794 | Bacteria | 1311 |
| 329 | Ga0495600_0014818 | 3300046809 | Bacteria | 4917 |
| 330 | Ga0495581_0033829 | 3300047315 | Bacteria | 2959 |
| 331 | Ga0495604_0006592 | 3300047317 | Bacteria | 9201 |
| 332 | Ga0495604_0151234 | 3300047317 | Bacteria | 1649 |
| 333 | Ga0495674_0054370 | 3300047319 | Bacteria | 3516 |
| 334 | Ga0495672_0026159 | 3300047320 | Bacteria | 3725 |
| 335 | Ga0495672_0065065 | 3300047320 | Bacteria | 2085 |
| 336 | Ga0495676_0103244 | 3300047321 | Bacteria | 2105 |
| 337 | Ga0495676_0270084 | 3300047321 | Bacteria | 1154 |
| 338 | Ga0495677_0009831 | 3300047445 | Bacteria | 3525 |
| 339 | Ga0495673_0057087 | 3300047469 | Bacteria | 1686 |
| 340 | Ga0495684_0004414 | 3300047471 | Bacteria | 11000 |
| 341 | Ga0495686_0024862 | 3300047472 | Bacteria | 3930 |
| 342 | Ga0495686_0040115 | 3300047472 | Bacteria | 2988 |
| 343 | Ga0495686_0041306 | 3300047472 | Bacteria | 2937 |
| 344 | Ga0495686_0092659 | 3300047472 | Bacteria | 1832 |
| 345 | Ga0495593_0000034 | 3300047673 | Bacteria | 57993 |
| 346 | Ga0495593_0004126 | 3300047673 | Bacteria | 8642 |
| 347 | Ga0495602_0055208 | 3300048088 | Bacteria | 3499 |
| 348 | Ga0495614_0002600 | 3300048089 | Bacteria | 8028 |
| 349 | Ga0496100_0008416 | 3300048903 | Bacteria | 5753 |
| 350 | Ga0496100_0092199 | 3300048903 | Bacteria | 2070 |
| 351 | Ga0496100_0250415 | 3300048903 | Bacteria | 1310 |
| 352 | Ga0496101_0086414 | 3300048904 | Bacteria | 2326 |
| 353 | Ga0496101_0189061 | 3300048904 | Bacteria | 1588 |
| 354 | Ga0496101_0247222 | 3300048904 | Bacteria | 1389 |
| 355 | Ga0496101_0293108 | 3300048904 | Bacteria | 1273 |
| 356 | Ga0496102_0025975 | 3300048905 | Bacteria | 5219 |
| 357 | Ga0496102_0039294 | 3300048905 | Bacteria | 4275 |
| 358 | Ga0496104_0281394 | 3300048907 | Bacteria | 1576 |
| 359 | Ga0496105_0013770 | 3300048908 | Bacteria | 6422 |
| 360 | Ga0496106_0000649 | 3300048909 | Bacteria | 24884 |
| 361 | Ga0496106_0076272 | 3300048909 | Bacteria | 2569 |
| 362 | Ga0496106_0099691 | 3300048909 | Bacteria | 2252 |
| 363 | Ga0496107_0016695 | 3300048910 | Bacteria | 5160 |
| 364 | Ga0496109_0006785 | 3300048912 | Bacteria | 9645 |
| 365 | Ga0496109_0032069 | 3300048912 | Bacteria | 4720 |
| 366 | Ga0496109_0304386 | 3300048912 | Bacteria | 1503 |
| 367 | Ga0496110_0008221 | 3300048913 | Bacteria | 8385 |
| 368 | Ga0496110_0021224 | 3300048913 | Bacteria | 5494 |
| 369 | Ga0496110_0367228 | 3300048913 | Bacteria | 1311 |
| 370 | Ga0496111_0161891 | 3300048914 | Bacteria | 1662 |
| 371 | Ga0496111_0208400 | 3300048914 | Bacteria | 1452 |
| 372 | Ga0496112_0000037 | 3300048915 | Bacteria | 96876 |
| 373 | Ga0496112_0003961 | 3300048915 | Bacteria | 12409 |
| 374 | Ga0496112_0021901 | 3300048915 | Bacteria | 6082 |
| 375 | Ga0496112_0102784 | 3300048915 | Bacteria | 2827 |
| 376 | Ga0496112_0165641 | 3300048915 | Bacteria | 2176 |
| 377 | Ga0496112_0288946 | 3300048915 | Bacteria | 1586 |
| 378 | Ga0496113_0159050 | 3300048916 | Bacteria | 1785 |
| 379 | Ga0496114_0157357 | 3300048917 | Bacteria | 1973 |
| 380 | Ga0496115_0007240 | 3300048918 | Bacteria | 8156 |
| 381 | Ga0496115_0021816 | 3300048918 | Bacteria | 4951 |
| 382 | Ga0496115_0032633 | 3300048918 | Bacteria | 4108 |
| 383 | Ga0496115_0054375 | 3300048918 | Bacteria | 3215 |
| 384 | Ga0496115_0124303 | 3300048918 | Bacteria | 2124 |
| 385 | Ga0496115_0275365 | 3300048918 | Bacteria | 1382 |
| 386 | Ga0496116_0026092 | 3300048919 | Bacteria | 4280 |
| 387 | Ga0496116_0116602 | 3300048919 | Bacteria | 1556 |
| 388 | Ga0496117_0006544 | 3300048920 | Bacteria | 11729 |
| 389 | Ga0496117_0013445 | 3300048920 | Bacteria | 7141 |
| 390 | Ga0496117_0075581 | 3300048920 | Bacteria | 2237 |
| 391 | Ga0496117_0102629 | 3300048920 | Bacteria | 1804 |
| 392 | Ga0496118_0003970 | 3300048921 | Bacteria | 18053 |
| 393 | Ga0496118_0060107 | 3300048921 | Bacteria | 2824 |
| 394 | Ga0496118_0076246 | 3300048921 | Bacteria | 2385 |
| 395 | Ga0496119_0029785 | 3300048922 | Bacteria | 3692 |
| 396 | Ga0496120_0026718 | 3300048923 | Bacteria | 3561 |
| 397 | Ga0496121_0000476 | 3300048924 | Bacteria | 78015 |
| 398 | Ga0496121_0001742 | 3300048924 | Bacteria | 35564 |
| 399 | Ga0496121_0003089 | 3300048924 | Bacteria | 24095 |
| 400 | Ga0496121_0007886 | 3300048924 | Bacteria | 12739 |
| 401 | Ga0496121_0066441 | 3300048924 | Bacteria | 2928 |
| 402 | Ga0496121_0073520 | 3300048924 | Bacteria | 2739 |
| 403 | Ga0496121_0074570 | 3300048924 | Bacteria | 2713 |
| 404 | Ga0496121_0157710 | 3300048924 | Bacteria | 1663 |
| 405 | Ga0496122_0060286 | 3300048925 | Bacteria | 2795 |
| 406 | Ga0496123_0077422 | 3300048926 | Bacteria | 2042 |
| 407 | Ga0496123_0117547 | 3300048926 | Bacteria | 1503 |
| 408 | Ga0496124_0001128 | 3300048927 | Bacteria | 42017 |
| 409 | Ga0496124_0043677 | 3300048927 | Bacteria | 3852 |
| 410 | Ga0496124_0214415 | 3300048927 | Bacteria | 1454 |
| 411 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 412 | Ga0496125_0001251 | 3300048928 | Bacteria | 37908 |
| 413 | Ga0496125_0012395 | 3300048928 | Bacteria | 8467 |
| 414 | Ga0496125_0044517 | 3300048928 | Bacteria | 3752 |
| 415 | Ga0496126_0002744 | 3300048929 | Bacteria | 23267 |
| 416 | Ga0496126_0005646 | 3300048929 | Bacteria | 14209 |
| 417 | Ga0496126_0005790 | 3300048929 | Bacteria | 13970 |
| 418 | Ga0496126_0019810 | 3300048929 | Bacteria | 6617 |
| 419 | Ga0496126_0073181 | 3300048929 | Bacteria | 3047 |
| 420 | Ga0496126_0136588 | 3300048929 | Bacteria | 2114 |
| 421 | Ga0496126_0175809 | 3300048929 | Bacteria | 1821 |
| 422 | Ga0496126_0215657 | 3300048929 | Bacteria | 1614 |
| 423 | Ga0496126_0271145 | 3300048929 | Bacteria | 1408 |
| 424 | Ga0501031_0011177 | 3300049568 | Bacteria | 5850 |
| 425 | Ga0501032_0003299 | 3300049569 | Bacteria | 12409 |
| 426 | Ga0501033_0000124 | 3300049570 | Bacteria | 74731 |
| 427 | Ga0501033_0037338 | 3300049570 | Bacteria | 3637 |
| 428 | Ga0501036_0001379 | 3300049572 | Bacteria | 18654 |
| 429 | Ga0501036_0057426 | 3300049572 | Bacteria | 3297 |
| 430 | Ga0501037_0037968 | 3300049573 | Bacteria | 3550 |
| 431 | Ga0501038_0000041 | 3300049574 | Bacteria | 120557 |
| 432 | Ga0501038_0036322 | 3300049574 | Bacteria | 4325 |
| 433 | Ga0501039_0000472 | 3300049575 | Bacteria | 29218 |
| 434 | Ga0501039_0118576 | 3300049575 | Bacteria | 2073 |
| 435 | Ga0501043_0022762 | 3300049579 | Bacteria | 4913 |
| 436 | Ga0501047_0016600 | 3300049581 | Bacteria | 7028 |
| 437 | Ga0501047_0023633 | 3300049581 | Bacteria | 5900 |
| 438 | Ga0501067_0077869 | 3300049583 | Bacteria | 1837 |
| 439 | Ga0501068_0021594 | 3300049584 | Bacteria | 3760 |
| 440 | Ga0501069_0014051 | 3300049585 | Bacteria | 4277 |
| 441 | Ga0501070_0004644 | 3300049586 | Bacteria | 11766 |
| 442 | Ga0501070_0034844 | 3300049586 | Bacteria | 4207 |
| 443 | Ga0501073_0028939 | 3300049589 | Bacteria | 3958 |
| 444 | Ga0501080_0000638 | 3300049742 | Bacteria | 27778 |
| 445 | Ga0501035_0002235 | 3300049822 | Bacteria | 19183 |
| 446 | Ga0501035_0049374 | 3300049822 | Bacteria | 3771 |
| 447 | Ga0501044_0071456 | 3300049823 | Bacteria | 3529 |
| 448 | Ga0501045_0029715 | 3300049824 | Bacteria | 3952 |
| 449 | nmdc:mga00v17_28583_c1 | 3300050491 | Bacteria | 3266 |
| 450 | nmdc:mga00v17_94891_c1 | 3300050491 | Bacteria | 1877 |
| 451 | nmdc:mga0yw44_19552_c1 | 3300050492 | Bacteria | 3738 |
| 452 | nmdc:mga0yw44_31585_c1 | 3300050492 | Bacteria | 3081 |
| 453 | nmdc:mga05p37_348275_c1 | 3300050507 | Bacteria | 1745 |
| 454 | nmdc:mga08y16_158068_c1 | 3300050511 | Bacteria | 2355 |
| 455 | nmdc:mga08y16_229255_c1 | 3300050511 | Bacteria | 1921 |
| 456 | nmdc:mga0n895_53072_c1 | 3300050512 | Bacteria | 3981 |
| 457 | nmdc:mga0a205_244607_c1 | 3300050515 | Bacteria | 1674 |
| 458 | nmdc:mga0sz30_5341_c1 | 3300050516 | Bacteria | 4706 |
| 459 | Ga0495601_0022259 | 3300053077 | Bacteria | 3890 |
| 460 | Ga0495601_0113424 | 3300053077 | Bacteria | 1757 |
| 461 | Ga0500635_0004467 | 3300053080 | Bacteria | 3609 |
| 462 | Ga0495595_0004386 | 3300053084 | Bacteria | 5679 |
| 463 | Ga0495595_0006944 | 3300053084 | Bacteria | 4623 |
| 464 | Ga0495619_0004209 | 3300053085 | Bacteria | 9182 |
| 465 | Ga0495619_0041813 | 3300053085 | Bacteria | 2999 |
| 466 | Ga0500643_028088 | 3300053087 | Bacteria | 1742 |
| 467 | Ga0500651_0000861 | 3300053093 | Bacteria | 14855 |
| 468 | Ga0500651_0039325 | 3300053093 | Bacteria | 2978 |
| 469 | Ga0500651_0183221 | 3300053093 | Bacteria | 1243 |
| 470 | Ga0500566_0000157 | 3300053094 | Bacteria | 34534 |
| 471 | Ga0500566_0016976 | 3300053094 | Bacteria | 4275 |
| 472 | Ga0500566_0093266 | 3300053094 | Bacteria | 1661 |
| 473 | Ga0500641_0006830 | 3300053096 | Bacteria | 4059 |
| 474 | Ga0500641_0108380 | 3300053096 | Bacteria | 1194 |
| 475 | Ga0500554_000813 | 3300053102 | Bacteria | 6155 |
| 476 | Ga0500556_0000413 | 3300053104 | Bacteria | 31142 |
| 477 | Ga0500557_000041 | 3300053105 | Bacteria | 64885 |
| 478 | Ga0500592_001374 | 3300053116 | Bacteria | 3938 |
| 479 | Ga0500595_000331 | 3300053119 | Bacteria | 31133 |
| 480 | Ga0500595_001464 | 3300053119 | Bacteria | 12587 |
| 481 | Ga0500595_005225 | 3300053119 | Bacteria | 5688 |
| 482 | Ga0500595_011823 | 3300053119 | Bacteria | 3399 |
| 483 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 484 | Ga0500642_0025239 | 3300053130 | Bacteria | 2412 |
| 485 | Ga0500655_011033 | 3300053133 | Bacteria | 1635 |
| 486 | Ga0500658_0071925 | 3300053134 | Bacteria | 1461 |
| 487 | Ga0500658_0092536 | 3300053134 | Bacteria | 1309 |
| 488 | Ga0500559_0002794 | 3300053136 | Bacteria | 8831 |
| 489 | Ga0500559_0030986 | 3300053136 | Bacteria | 2294 |
| 490 | Ga0500568_0002149 | 3300053139 | Bacteria | 11891 |
| 491 | Ga0500568_0014348 | 3300053139 | Bacteria | 3581 |
| 492 | Ga0500568_0097246 | 3300053139 | Bacteria | 1107 |
| 493 | Ga0500573_0002307 | 3300053140 | Bacteria | 9486 |
| 494 | Ga0500586_004415 | 3300053145 | Bacteria | 3439 |
| 495 | Ga0500588_0010416 | 3300053146 | Bacteria | 2244 |
| 496 | Ga0500590_030324 | 3300053148 | Bacteria | 2806 |
| 497 | Ga0500603_001303 | 3300053150 | Bacteria | 5725 |
| 498 | Ga0500603_048710 | 3300053150 | Bacteria | 1153 |
| 499 | Ga0500604_0001450 | 3300053151 | Bacteria | 6633 |
| 500 | Ga0500604_0044019 | 3300053151 | Bacteria | 1358 |
| 501 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 502 | Ga0500622_0022981 | 3300053156 | Bacteria | 3302 |
| 503 | Ga0500627_0117127 | 3300053158 | Bacteria | 1200 |
| 504 | Ga0500634_0120028 | 3300053161 | Bacteria | 1281 |
| 505 | Ga0500638_000259 | 3300053162 | Bacteria | 11614 |
| 506 | Ga0500638_065247 | 3300053162 | Bacteria | 1746 |
| 507 | Ga0500636_0002272 | 3300053177 | Bacteria | 10660 |
| 508 | Ga0500637_0001727 | 3300053178 | Bacteria | 9419 |
| 509 | Ga0500637_0011620 | 3300053178 | Bacteria | 4559 |
| 510 | Ga0500645_011768 | 3300053730 | Bacteria | 2845 |
| 511 | Ga0500601_002924 | 3300053737 | Bacteria | 1844 |
| 512 | Ga0466962_0061795 | 3300061719 | Bacteria | 1788 |
| 513 | Ga0466962_0077129 | 3300061719 | Bacteria | 1593 |
| 514 | 2513655034 | 2513237096 | Bacteria | 8722461 |
| 515 | 2513677804 | 2513237098 | Bacteria | 9902361 |
| 516 | 2513697443 | 2513237101 | Bacteria | 7952346 |
| 517 | 2513861050 | 2513237137 | Bacteria | 9558895 |
| 518 | 2513915943 | 2513237145 | Bacteria | 8979722 |
| 519 | 2515625428 | 2515154112 | Bacteria | 8294334 |
| 520 | 2517894752 | 2517572143 | Bacteria | 9484767 |
| 521 | 2524464083 | 2524023210 | Bacteria | 9029266 |
| 522 | 2603862607 | 2602042107 | Bacteria | 6226103 |
| 523 | 2671119166 | 2667528175 | Bacteria | 7532676 |
| 524 | 2723843064 | 2721755755 | Bacteria | 8322773 |
| 525 | 2793071227 | 2791355197 | Bacteria | 8420563 |
| 526 | 2793079527 | |||
| 527 | 2841943198 | 2841941048 | Bacteria | 8688029 |
| 528 | 2841976629 | 2841974524 | Bacteria | 8931498 |
| 529 | 2857529952 | 2857524615 | Bacteria | 6615449 |
| 530 | 2874612604 | 2874604998 | Bacteria | 7834745 |
| 531 | 2876812881 | 2876808645 | Bacteria | 8824342 |
| 532 | 2879118043 | 2879110137 | Bacteria | 8907982 |
| 533 | 2885378774 | 2885374607 | Bacteria | 8927485 |
| 534 | 2885384498 | 2885383462 | Bacteria | 9473874 |
| 535 | 2885413423 | 2885409591 | Bacteria | 9235467 |
| 536 | 2889033634 | 2889033259 | Bacteria | 9099371 |
| 537 | 2893069404 | 2893066018 | Bacteria | 6158120 |
| 538 | 2903751434 | 2903748898 | Bacteria | 9972761 |
| 539 | 2903773634 | 2903768456 | Bacteria | 9749579 |
| 540 | 2904697735 | 2904690495 | Bacteria | 9412302 |
| 541 | 2904705885 | |||
| 542 | 2906611472 | |||
| 543 | 2906641691 | 2906635258 | Bacteria | 8601019 |
| 544 | 2906660793 | 2906660503 | Bacteria | 8595048 |
| 545 | 2908745064 | 2908739725 | Bacteria | 8628932 |
| 546 | 2908757168 | 2908756301 | Bacteria | 8864324 |
| 547 | 2919077194 | 2919073203 | Bacteria | 6531949 |
| 548 | 2922367000 | 2922361189 | Bacteria | 7436256 |
| 549 | 2922390217 | 2922386360 | Bacteria | 7017218 |
| 550 | 2922427885 | |||
| 551 | 2935632187 | 2935630451 | Bacteria | 8169952 |
| 552 | 2935962036 | 2935959822 | Bacteria | 7869783 |
| 553 | 2941508135 | 2941507105 | Bacteria | 8166816 |
| 554 | 2941515360 | 2941515067 | Bacteria | 8166720 |
| 555 | 2941524065 | 2941523033 | Bacteria | 8169134 |
| 556 | 3005477595 | 3005474847 | Bacteria | 9259049 |
| 557 | 3005507116 | 3005506211 | Bacteria | 6943378 |
| 558 | 8006933624 | 8006933436 | Bacteria | 10410654 |
| 559 | 8006966536 | 8006964411 | Bacteria | 8966052 |
| 560 | 8006989365 | 8006984368 | Bacteria | 9651211 |
| 561 | 8006997848 | 8006994254 | Bacteria | 8309700 |
| 562 | 8019559567 | 8019555841 | Bacteria | 9642137 |
| 563 | 8019569667 | 8019565922 | Bacteria | 9639779 |
| 564 | 8056674882 | 8056673599 | Bacteria | 7871253 |
| 565 | 8056682374 | 8056681323 | Bacteria | 8472857 |
| 566 | Ga0105241_10106747 | |||
| 567 | JGI25404J52841_10003909 | |||
| 568 | JGI25404J52841_10008965 | |||
| 569 | JGI25404J52841_10018149 | |||
| 570 | Ga0065165_1044756 | |||
| 571 | Ga0068869_100265783 | |||
| 572 | Ga0070680_100048472 | |||
| 573 | Ga0070680_100078039 | |||
| 574 | Ga0070660_100006941 | |||
| 575 | Ga0070674_100051862 | |||
| 576 | Ga0070659_100025076 | |||
| 577 | Ga0070667_100113013 | |||
| 578 | Ga0070714_100252782 | |||
| 579 | Ga0070713_100000737 | |||
| 580 | Ga0070663_100071388 | |||
| 581 | Ga0070663_100139075 | |||
| 582 | Ga0070663_100181878 | |||
| 583 | Ga0070663_100228324 | |||
| 584 | Ga0070663_100324018 | |||
| 585 | Ga0070678_100033005 | |||
| 586 | Ga0070678_100041257 | |||
| 587 | Ga0070678_100165609 | |||
| 588 | Ga0070681_10277291 | |||
| 589 | Ga0068867_100046272 | |||
| 590 | Ga0070707_100083285 | |||
| 591 | Ga0070684_100078477 | |||
| 592 | Ga0070684_100175605 | |||
| 593 | Ga0070697_100012461 | |||
| 594 | Ga0068853_100025677 | |||
| 595 | Ga0068853_100035442 | |||
| 596 | Ga0068853_100097075 | |||
| 597 | Ga0068853_100135051 | |||
| 598 | Ga0070665_100035286 | |||
| 599 | Ga0068855_100110586 | |||
| 600 | Ga0068855_100152079 | |||
| 601 | Ga0070664_100122015 | |||
| 602 | Ga0068857_100018285 | |||
| 603 | Ga0068856_100018359 | |||
| 604 | Ga0068852_100005171 | |||
| 605 | Ga0068852_100251929 | |||
| 606 | Ga0068864_100067374 | |||
| 607 | Ga0068866_10029928 | |||
| 608 | Ga0068861_100128785 | |||
| 609 | Ga0068861_100190649 | |||
| 610 | Ga0068851_10007403 | |||
| 611 | Ga0068858_100079376 | |||
| 612 | Ga0068860_100138436 | |||
| 613 | Ga0068862_100348981 | |||
| 614 | Ga0068862_100434549 | |||
| 615 | Ga0081455_10004734 | |||
| 616 | Ga0081455_10007808 | |||
| 617 | Ga0081455_10016954 | |||
| 618 | Ga0081540_1002304 | |||
| 619 | Ga0081540_1006170 | |||
| 620 | Ga0081540_1006942 | |||
| 621 | Ga0081540_1009315 | |||
| 622 | Ga0081540_1010096 | |||
| 623 | Ga0081540_1016124 | |||
| 624 | Ga0081540_1054617 | |||
| 625 | Ga0081540_1084573 | |||
| 626 | Ga0081539_10017928 | |||
| 627 | Ga0070717_10005839 | |||
| 628 | Ga0070717_10009960 | |||
| 629 | Ga0070717_10328014 | |||
| 630 | Ga0075365_10045342 | |||
| 631 | Ga0075365_10060689 | |||
| 632 | Ga0075368_10005882 | |||
| 633 | Ga0075363_100008428 | |||
| 634 | Ga0075363_100016844 | |||
| 635 | Ga0075363_100136544 | |||
| 636 | Ga0070712_100037139 | |||
| 637 | Ga0075367_10010997 | |||
| 638 | Ga0075367_10027799 | |||
| 639 | Ga0075367_10030229 | |||
| 640 | Ga0075369_10011679 | |||
| 641 | Ga0075369_10129618 | |||
| 642 | Ga0075366_10023699 | |||
| 643 | Ga0075434_100335438 | |||
| 644 | Ga0068865_100023996 | |||
| 645 | Ga0097620_100442187 | |||
| 646 | Ga0099824_1010925 | |||
| 647 | Ga0099795_10017149 | |||
| 648 | Ga0105240_10083712 | |||
| 649 | Ga0105240_10212051 | |||
| 650 | Ga0105240_10235415 | |||
| 651 | Ga0111539_10050924 | |||
| 652 | Ga0111539_10290469 | |||
| 653 | Ga0105245_10025333 | |||
| 654 | Ga0114129_10030205 | |||
| 655 | Ga0105243_10155291 | |||
| 656 | Ga0105242_10135058 | |||
| 657 | Ga0105248_10343959 | |||
| 658 | Ga0105237_10008841 | |||
| 659 | Ga0105238_10038174 | |||
| 660 | Ga0105249_10245706 | |||
| 661 | Ga0099796_10006685 | |||
| 662 | Ga0105239_10044859 | |||
| 663 | Ga0105239_10108687 | |||
| 664 | Ga0105246_10187385 | |||
| 665 | Ga0157370_10108080 | |||
| 666 | Ga0157369_10037312 | |||
| 667 | Ga0157378_10005423 | |||
| 668 | Ga0163162_10039430 | |||
| 669 | Ga0157372_10372253 | |||
| 670 | Ga0157375_10018137 | |||
| 671 | Ga0157375_10196693 | |||
| 672 | Ga0163163_10054256 | |||
| 673 | Ga0163163_10179875 | |||
| 674 | Ga0157380_10118180 | |||
| 675 | Ga0157380_10344369 | |||
| 676 | Ga0157377_10102099 | |||
| 677 | Ga0157379_10228269 | |||
| 678 | Ga0157376_10110706 | |||
| 679 | Ga0157376_10157934 | |||
| 680 | Ga0206356_10999127 | |||
| 681 | Ga0206353_10526543 | |||
| 682 | Ga0213875_10004231 | |||
| 683 | Ga0209233_1017502 | |||
| 684 | Ga0209564_1000485 | |||
| 685 | Ga0209758_1029463 | |||
| 686 | Ga0207647_10116240 | |||
| 687 | Ga0207645_10065282 | |||
| 688 | Ga0207643_10037952 | |||
| 689 | Ga0207705_10057717 | |||
| 690 | Ga0207705_10199235 | |||
| 691 | Ga0207654_10231413 | |||
| 692 | Ga0207707_10009744 | |||
| 693 | Ga0207695_10045639 | |||
| 694 | Ga0207695_10103117 | |||
| 695 | Ga0207695_10153360 | |||
| 696 | Ga0207671_10165007 | |||
| 697 | Ga0207693_10100202 | |||
| 698 | Ga0207693_10152779 | |||
| 699 | Ga0207663_10003103 | |||
| 700 | Ga0207660_10017276 | |||
| 701 | Ga0207660_10082761 | |||
| 702 | Ga0207657_10002789 | |||
| 703 | Ga0207657_10009166 | |||
| 704 | Ga0207657_10223669 | |||
| 705 | Ga0207649_10129436 | |||
| 706 | Ga0207652_10026914 | |||
| 707 | Ga0207652_10128177 | |||
| 708 | Ga0207646_10044477 | |||
| 709 | Ga0207700_10001341 | |||
| 710 | Ga0207700_10052318 | |||
| 711 | Ga0207664_10135871 | |||
| 712 | Ga0207664_10213631 | |||
| 713 | Ga0207644_10025924 | |||
| 714 | Ga0207644_10271459 | |||
| 715 | Ga0207690_10211414 | |||
| 716 | Ga0207706_10030770 | |||
| 717 | Ga0207706_10059207 | |||
| 718 | Ga0207669_10049859 | |||
| 719 | Ga0207704_10068997 | |||
| 720 | Ga0207665_10060864 | |||
| 721 | Ga0207665_10123310 | |||
| 722 | Ga0207665_10361916 | |||
| 723 | Ga0207691_10024095 | |||
| 724 | Ga0207691_10107175 | |||
| 725 | Ga0207711_10092636 | |||
| 726 | Ga0207711_10131926 | |||
| 727 | Ga0207689_10036612 | |||
| 728 | Ga0207689_10112445 | |||
| 729 | Ga0207689_10157449 | |||
| 730 | Ga0207679_10014830 | |||
| 731 | Ga0207667_10040971 | |||
| 732 | Ga0207667_10205716 | |||
| 733 | Ga0207667_10443534 | |||
| 734 | Ga0207712_10281521 | |||
| 735 | Ga0207668_10090473 | |||
| 736 | Ga0207668_10254754 | |||
| 737 | Ga0207668_10280298 | |||
| 738 | Ga0207640_10072645 | |||
| 739 | Ga0207658_10364229 | |||
| 740 | Ga0207677_10071187 | |||
| 741 | Ga0207703_10027603 | |||
| 742 | Ga0207639_10042338 | |||
| 743 | Ga0207639_10145880 | |||
| 744 | Ga0207639_10223410 | |||
| 745 | Ga0207678_10008446 | |||
| 746 | Ga0207678_10040941 | |||
| 747 | Ga0207678_10079088 | |||
| 748 | Ga0207702_10015921 | |||
| 749 | Ga0207641_10402499 | |||
| 750 | Ga0207648_10132038 | |||
| 751 | Ga0207674_10027243 | |||
| 752 | Ga0207675_100374653 | |||
| 753 | Ga0207675_100411464 | |||
| 754 | Ga0207683_10037487 | |||
| 755 | Ga0207683_10059426 | |||
| 756 | Ga0207683_10082205 | |||
| 757 | Ga0207683_10236526 | |||
| 758 | Ga0207698_10066624 | |||
| 759 | Ga0209389_1000023 | |||
| 760 | Ga0209589_1000010 | |||
| 761 | Ga0209489_100011 | |||
| 762 | Ga0268266_10264387 | |||
| 763 | Ga0268264_10000093 | |||
| 764 | Ga0268264_10213648 | |||
| 765 | Ga0265334_10011851 | |||
| 766 | Ga0307517_10000085 | |||
| 767 | Ga0307517_10150514 | |||
| 768 | Ga0307515_10078972 | |||
| 769 | Ga0307515_10242706 | |||
| 770 | Ga0265330_10057589 | |||
| 771 | Ga0265325_10049180 | |||
| 772 | Ga0265340_10034255 | |||
| 773 | Ga0265339_10042644 | |||
| 774 | Ga0265331_10021773 | |||
| 775 | Ga0307508_10049820 | |||
| 776 | Ga0307508_10178732 | |||
| 777 | Ga0265314_10148520 | |||
| 778 | Ga0307516_10008463 | |||
| 779 | Ga0307516_10195070 | |||
| 780 | Ga0307516_10202264 | |||
| 781 | Ga0307516_10309168 | |||
| 782 | Ga0307410_10204207 | |||
| 783 | Ga0307416_100217458 | |||
| 784 | Ga0307415_100170540 | |||
| 785 | Ga0307507_10147401 | |||
| 786 | Ga0307510_10203875 | |||
| 787 | Ga0315911_1000010 | |||
| 788 | Ga0316215_1000538 | |||
| 789 | Ga0373950_0014045 | |||
| 790 | Ga0373928_0006063 | |||
| 791 | Ga0373929_0016120 | |||
| 792 | Ga0373934_0004243 | |||
| 793 | Ga0373951_0045853 | |||
| 794 | Ga0373923_0018561 | |||
| 795 | Ga0373932_0004494 | |||
| 796 | Ga0373936_0023057 | |||
| 797 | Ga0373945_0108722 | |||
| 798 | Ga0373953_0003844 | |||
| 799 | Ga0373954_0003555 | |||
| 800 | Ga0373957_0001601 | |||
| 801 | Ga0373943_0002133 | |||
| 802 | Ga0373946_0016813 | |||
| 803 | Ga0373931_0011398 | |||
| 804 | Ga0373935_0000259 | |||
| 805 | Ga0373935_0031447 | |||
| 806 | Ga0373927_0002522 | |||
| 807 | Ga0373927_0007423 | |||
| 808 | Ga0373927_0038511 | |||
| 809 | Ga0373927_0089561 | |||
| 810 | Ga0373927_0182849 | |||
| 811 | Ga0373933_0008746 | |||
| 812 | Ga0373947_0000217 | |||
| 813 | Ga0373947_0013560 | |||
| 814 | Ga0373937_0014756 | |||
| 815 | Ga0373937_0027287 | |||
| 816 | Ga0372808_000294 | |||
| 817 | Ga0373925_0003792 | |||
| 818 | Ga0373925_0012744 | |||
| 819 | Ga0373925_0226616 | |||
| 820 | Ga0395900_0067826 | |||
| 821 | Ga0395898_0137402 | |||
| 822 | Ga0395901_0248873 | |||
| 823 | Ga0436365_1200085 | |||
| 824 | Ga0466972_0000520 | |||
| 825 | Ga0466965_0140965 | |||
| 826 | Ga0466966_0005474 | |||
| 827 | Ga0466961_0000081 | |||
| 828 | Ga0466963_0006536 | |||
| 829 | Ga0466963_0104587 | |||
| 830 | Ga0466959_0007840 | |||
| 831 | Ga0466959_0088585 | |||
| 832 | Ga0495592_0004003 | |||
| 833 | Ga0495592_0010878 | |||
| 834 | Ga0495603_0000352 | |||
| 835 | Ga0495603_0009224 | |||
| 836 | Ga0495629_0000341 | |||
| 837 | Ga0495629_0090105 | |||
| 838 | Ga0495638_0148152 | |||
| 839 | Ga0495653_0003343 | |||
| 840 | Ga0495580_0003184 | |||
| 841 | Ga0495582_0000245 | |||
| 842 | Ga0495639_0000275 | |||
| 843 | Ga0495639_0038018 | |||
| 844 | Ga0495662_0001790 | |||
| 845 | Ga0495664_0017791 | |||
| 846 | Ga0495584_0099900 | |||
| 847 | Ga0495594_0001300 | |||
| 848 | Ga0495607_0039517 | |||
| 849 | Ga0495610_0044994 | |||
| 850 | Ga0495610_0096503 | |||
| 851 | Ga0495620_0037158 | |||
| 852 | Ga0495628_0012504 | |||
| 853 | Ga0495628_0039880 | |||
| 854 | Ga0495630_0003021 | |||
| 855 | Ga0495631_0015793 | |||
| 856 | Ga0495648_0001680 | |||
| 857 | Ga0495648_0003398 | |||
| 858 | Ga0495648_0104146 | |||
| 859 | Ga0495652_0077136 | |||
| 860 | Ga0495665_0000042 | |||
| 861 | Ga0495640_0011597 | |||
| 862 | Ga0495598_0004661 | |||
| 863 | Ga0495609_0024409 | |||
| 864 | Ga0495621_0030236 | |||
| 865 | Ga0495645_0001286 | |||
| 866 | Ga0495622_0001455 | |||
| 867 | Ga0495622_0002944 | |||
| 868 | Ga0495622_0041288 | |||
| 869 | Ga0495667_0003108 | |||
| 870 | Ga0495656_0028293 | |||
| 871 | Ga0495656_0039458 | |||
| 872 | Ga0495668_0072209 | |||
| 873 | Ga0495668_0115168 | |||
| 874 | Ga0495668_0147802 | |||
| 875 | Ga0495634_0000249 | |||
| 876 | Ga0495634_0009610 | |||
| 877 | Ga0495625_0024104 | |||
| 878 | Ga0495635_0000239 | |||
| 879 | Ga0495661_0024354 | |||
| 880 | Ga0495588_0003608 | |||
| 881 | Ga0495588_0044419 | |||
| 882 | Ga0495599_0001118 | |||
| 883 | Ga0495646_0008784 | |||
| 884 | Ga0495646_0015009 | |||
| 885 | Ga0495647_0000418 | |||
| 886 | Ga0495658_0001216 | |||
| 887 | Ga0495669_0043583 | |||
| 888 | Ga0495669_0148817 | |||
| 889 | Ga0495613_0000929 | |||
| 890 | Ga0495613_0039302 | |||
| 891 | Ga0495624_0000538 | |||
| 892 | Ga0495671_0094728 | |||
| 893 | Ga0495589_0112921 | |||
| 894 | Ga0495600_0014818 | |||
| 895 | Ga0495581_0033829 | |||
| 896 | Ga0495604_0006592 | |||
| 897 | Ga0495604_0151234 | |||
| 898 | Ga0495674_0054370 | |||
| 899 | Ga0495672_0026159 | |||
| 900 | Ga0495672_0065065 | |||
| 901 | Ga0495676_0103244 | |||
| 902 | Ga0495676_0270084 | |||
| 903 | Ga0495677_0009831 | |||
| 904 | Ga0495673_0057087 | |||
| 905 | Ga0495684_0004414 | |||
| 906 | Ga0495686_0024862 | |||
| 907 | Ga0495686_0040115 | |||
| 908 | Ga0495686_0041306 | |||
| 909 | Ga0495686_0092659 | |||
| 910 | Ga0495593_0000034 | |||
| 911 | Ga0495593_0004126 | |||
| 912 | Ga0495602_0055208 | |||
| 913 | Ga0495614_0002600 | |||
| 914 | Ga0496100_0008416 | |||
| 915 | Ga0496100_0092199 | |||
| 916 | Ga0496100_0250415 | |||
| 917 | Ga0496101_0086414 | |||
| 918 | Ga0496101_0189061 | |||
| 919 | Ga0496101_0247222 | |||
| 920 | Ga0496101_0293108 | |||
| 921 | Ga0496102_0025975 | |||
| 922 | Ga0496102_0039294 | |||
| 923 | Ga0496104_0281394 | |||
| 924 | Ga0496105_0013770 | |||
| 925 | Ga0496106_0000649 | |||
| 926 | Ga0496106_0076272 | |||
| 927 | Ga0496106_0099691 | |||
| 928 | Ga0496107_0016695 | |||
| 929 | Ga0496109_0006785 | |||
| 930 | Ga0496109_0032069 | |||
| 931 | Ga0496109_0304386 | |||
| 932 | Ga0496110_0008221 | |||
| 933 | Ga0496110_0021224 | |||
| 934 | Ga0496110_0367228 | |||
| 935 | Ga0496111_0161891 | |||
| 936 | Ga0496111_0208400 | |||
| 937 | Ga0496112_0000037 | |||
| 938 | Ga0496112_0003961 | |||
| 939 | Ga0496112_0021901 | |||
| 940 | Ga0496112_0102784 | |||
| 941 | Ga0496112_0165641 | |||
| 942 | Ga0496112_0288946 | |||
| 943 | Ga0496113_0159050 | |||
| 944 | Ga0496114_0157357 | |||
| 945 | Ga0496115_0007240 | |||
| 946 | Ga0496115_0021816 | |||
| 947 | Ga0496115_0032633 | |||
| 948 | Ga0496115_0054375 | |||
| 949 | Ga0496115_0124303 | |||
| 950 | Ga0496115_0275365 | |||
| 951 | Ga0496116_0026092 | |||
| 952 | Ga0496116_0116602 | |||
| 953 | Ga0496117_0006544 | |||
| 954 | Ga0496117_0013445 | |||
| 955 | Ga0496117_0075581 | |||
| 956 | Ga0496117_0102629 | |||
| 957 | Ga0496118_0003970 | |||
| 958 | Ga0496118_0060107 | |||
| 959 | Ga0496118_0076246 | |||
| 960 | Ga0496119_0029785 | |||
| 961 | Ga0496120_0026718 | |||
| 962 | Ga0496121_0000476 | |||
| 963 | Ga0496121_0001742 | |||
| 964 | Ga0496121_0003089 | |||
| 965 | Ga0496121_0007886 | |||
| 966 | Ga0496121_0066441 | |||
| 967 | Ga0496121_0073520 | |||
| 968 | Ga0496121_0074570 | |||
| 969 | Ga0496121_0157710 | |||
| 970 | Ga0496122_0060286 | |||
| 971 | Ga0496123_0077422 | |||
| 972 | Ga0496123_0117547 | |||
| 973 | Ga0496124_0001128 | |||
| 974 | Ga0496124_0043677 | |||
| 975 | Ga0496124_0214415 | |||
| 976 | Ga0496125_0000154 | |||
| 977 | Ga0496125_0001251 | |||
| 978 | Ga0496125_0012395 | |||
| 979 | Ga0496125_0044517 | |||
| 980 | Ga0496126_0002744 | |||
| 981 | Ga0496126_0005646 | |||
| 982 | Ga0496126_0005790 | |||
| 983 | Ga0496126_0019810 | |||
| 984 | Ga0496126_0073181 | |||
| 985 | Ga0496126_0136588 | |||
| 986 | Ga0496126_0175809 | |||
| 987 | Ga0496126_0215657 | |||
| 988 | Ga0496126_0271145 | |||
| 989 | Ga0501031_0011177 | |||
| 990 | Ga0501032_0003299 | |||
| 991 | Ga0501033_0000124 | |||
| 992 | Ga0501033_0037338 | |||
| 993 | Ga0501036_0001379 | |||
| 994 | Ga0501036_0057426 | |||
| 995 | Ga0501037_0037968 | |||
| 996 | Ga0501038_0000041 | |||
| 997 | Ga0501038_0036322 | |||
| 998 | Ga0501039_0000472 | |||
| 999 | Ga0501039_0118576 | |||
| 1000 | Ga0501043_0022762 | |||
| 1001 | Ga0501047_0016600 | |||
| 1002 | Ga0501047_0023633 | |||
| 1003 | Ga0501067_0077869 | |||
| 1004 | Ga0501068_0021594 | |||
| 1005 | Ga0501069_0014051 | |||
| 1006 | Ga0501070_0004644 | |||
| 1007 | Ga0501070_0034844 | |||
| 1008 | Ga0501073_0028939 | |||
| 1009 | Ga0501080_0000638 | |||
| 1010 | Ga0501035_0002235 | |||
| 1011 | Ga0501035_0049374 | |||
| 1012 | Ga0501044_0071456 | |||
| 1013 | Ga0501045_0029715 | |||
| 1014 | nmdc:mga00v17_28583_c1 | |||
| 1015 | nmdc:mga00v17_94891_c1 | |||
| 1016 | nmdc:mga0yw44_19552_c1 | |||
| 1017 | nmdc:mga0yw44_31585_c1 | |||
| 1018 | nmdc:mga05p37_348275_c1 | |||
| 1019 | nmdc:mga08y16_158068_c1 | |||
| 1020 | nmdc:mga08y16_229255_c1 | |||
| 1021 | nmdc:mga0n895_53072_c1 | |||
| 1022 | nmdc:mga0a205_244607_c1 | |||
| 1023 | nmdc:mga0sz30_5341_c1 | |||
| 1024 | Ga0495601_0022259 | |||
| 1025 | Ga0495601_0113424 | |||
| 1026 | Ga0500635_0004467 | |||
| 1027 | Ga0495595_0004386 | |||
| 1028 | Ga0495595_0006944 | |||
| 1029 | Ga0495619_0004209 | |||
| 1030 | Ga0495619_0041813 | |||
| 1031 | Ga0500643_028088 | |||
| 1032 | Ga0500651_0000861 | |||
| 1033 | Ga0500651_0039325 | |||
| 1034 | Ga0500651_0183221 | |||
| 1035 | Ga0500566_0000157 | |||
| 1036 | Ga0500566_0016976 | |||
| 1037 | Ga0500566_0093266 | |||
| 1038 | Ga0500641_0006830 | |||
| 1039 | Ga0500641_0108380 | |||
| 1040 | Ga0500554_000813 | |||
| 1041 | Ga0500556_0000413 | |||
| 1042 | Ga0500557_000041 | |||
| 1043 | Ga0500592_001374 | |||
| 1044 | Ga0500595_000331 | |||
| 1045 | Ga0500595_001464 | |||
| 1046 | Ga0500595_005225 | |||
| 1047 | Ga0500595_011823 | |||
| 1048 | Ga0500642_0000005 | |||
| 1049 | Ga0500642_0025239 | |||
| 1050 | Ga0500655_011033 | |||
| 1051 | Ga0500658_0071925 | |||
| 1052 | Ga0500658_0092536 | |||
| 1053 | Ga0500559_0002794 | |||
| 1054 | Ga0500559_0030986 | |||
| 1055 | Ga0500568_0002149 | |||
| 1056 | Ga0500568_0014348 | |||
| 1057 | Ga0500568_0097246 | |||
| 1058 | Ga0500573_0002307 | |||
| 1059 | Ga0500586_004415 | |||
| 1060 | Ga0500588_0010416 | |||
| 1061 | Ga0500590_030324 | |||
| 1062 | Ga0500603_001303 | |||
| 1063 | Ga0500603_048710 | |||
| 1064 | Ga0500604_0001450 | |||
| 1065 | Ga0500604_0044019 | |||
| 1066 | Ga0500616_0000180 | |||
| 1067 | Ga0500622_0022981 | |||
| 1068 | Ga0500627_0117127 | |||
| 1069 | Ga0500634_0120028 | |||
| 1070 | Ga0500638_000259 | |||
| 1071 | Ga0500638_065247 | |||
| 1072 | Ga0500636_0002272 | |||
| 1073 | Ga0500637_0001727 | |||
| 1074 | Ga0500637_0011620 | |||
| 1075 | Ga0500645_011768 | |||
| 1076 | Ga0500601_002924 | |||
| 1077 | Ga0466962_0061795 | |||
| 1078 | Ga0466962_0077129 | |||
| 1079 | 2513655034 | |||
| 1080 | 2513677804 | |||
| 1081 | 2513697443 | |||
| 1082 | 2513861050 | |||
| 1083 | 2513915943 | |||
| 1084 | 2515625428 | |||
| 1085 | 2517894752 | |||
| 1086 | 2524464083 | |||
| 1087 | 2603862607 | |||
| 1088 | 2671119166 | |||
| 1089 | 2723843064 | |||
| 1090 | 2793071227 | |||
| 1091 | 2793079527 | |||
| 1092 | 2841943198 | |||
| 1093 | 2841976629 | |||
| 1094 | 2857529952 | |||
| 1095 | 2874612604 | |||
| 1096 | 2876812881 | |||
| 1097 | 2879118043 | |||
| 1098 | 2885378774 | |||
| 1099 | 2885384498 | |||
| 1100 | 2885413423 | |||
| 1101 | 2889033634 | |||
| 1102 | 2893069404 | |||
| 1103 | 2903751434 | |||
| 1104 | 2903773634 | |||
| 1105 | 2904697735 | |||
| 1106 | 2904705885 | |||
| 1107 | 2906611472 | |||
| 1108 | 2906641691 | |||
| 1109 | 2906660793 | |||
| 1110 | 2908745064 | |||
| 1111 | 2908757168 | |||
| 1112 | 2919077194 | |||
| 1113 | 2922367000 | |||
| 1114 | 2922390217 | |||
| 1115 | 2922427885 | |||
| 1116 | 2935632187 | |||
| 1117 | 2935962036 | |||
| 1118 | 2941508135 | |||
| 1119 | 2941515360 | |||
| 1120 | 2941524065 | |||
| 1121 | 3005477595 | |||
| 1122 | 3005507116 | |||
| 1123 | 8006933624 | |||
| 1124 | 8006966536 | |||
| 1125 | 8006989365 | |||
| 1126 | 8006997848 | |||
| 1127 | 8019559567 | |||
| 1128 | 8019569667 | |||
| 1129 | 8056674882 | |||
| 1130 | 8056682374 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.8992 | 6 | 303 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.8932 | 6 | 303 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.8905 | 13 | 304 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.8694 | 13 | 304 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.853 | 6 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F7F172_184_294_1.10.150.170 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9254 | 120 | 208 | 1.10.150.170 |
| af_K7MMS9_87_190_1.10.150.170 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9106 | 120 | 210 | 1.10.150.170 |
| 1wg8B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9072 | 6 | 303 | 3.40.50.150 |
| af_F7F172_79_179_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9049 | 15 | 102 | 3.40.50.150 |
| 1wg8B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8974 | 6 | 303 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382S8E5-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase | 0.9477 | 205 | 302 |
GO:0070475
GO:0071424 |
| AF-A0A847JHT4-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199) | 0.9353 | 1 | 105 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A176Z2R9-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9345 | 1 | 325 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A176Z2R9-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9317 | 1 | 325 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A346A2Y3-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9292 | 1 | 325 |
GO:0005737
GO:0070475 GO:0071424 |