F464256

General Info

Members Datasets Scaffolds Average Seq Length
565 369 1130 333

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10106747|Ga0105241_101067472
Length 392
Sequence MAALEIPAGNEGLQAGAGNDDRASQWLFGRKRPAKRRDLRRNGPVGVQFLFRTLECARGRRMSAVAPRHVSVLGREAVEMLSPHAGGIYVDATFGAGGYSRMILDTKGTRVIGIDRDRSAITSGFDLVDRADGRLTLVEDRFSNLAEVCAAQDIDAVDGVVMDVGVSSMQLDSAERGFSFRFGGPLDMRMGHDGPTAADVIAKASETDLANIIYIFGEERHSRGVARAIVAARKEAPITTTQALADIVGRVVRSKPNEIHPATRTFQALRIFVNAELDELHLALSAAERVLKPGGRLVVVSFHSLEDRIVKNFLNQRGKAGGGSRHLPEVAQAEPSFQILTRRPVTPGDAEISANPRARSAKLRAAERTAAPAHAADKLPAWPTIDAVMRGG

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
144 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
145 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
291 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
292 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
293 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
294 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
295 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
304 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
305 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
306 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
307 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
313 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
316 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
319 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
320 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
321 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
322 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
323 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
324 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
325 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
326 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
327 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
328 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
329 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
330 2791355199
331 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
332 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
333 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
334 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
335 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
336 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
337 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
338 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
339 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
340 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
341 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
342 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
343 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
344 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
345 2904699407
346 2906610324
347 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
348 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
349 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
350 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
351 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
352 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
353 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
354 2922425934
355 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
356 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
357 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
358 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
359 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
360 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
361 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
362 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
363 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
364 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
365 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
366 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
367 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
368 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
369 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0.53
Isolates 8.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.04
Nodule 6.55
Rhizoplane 6.9
Rhizosphere 61.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10106747 3300009174 Bacteria 2235
2 JGI25404J52841_10003909 3300003659 Bacteria 2985
3 JGI25404J52841_10008965 3300003659 Bacteria 2137
4 JGI25404J52841_10018149 3300003659 Bacteria 1524
5 Ga0065165_1044756 3300005262 Bacteria 1293
6 Ga0068869_100265783 3300005334 Bacteria 1375
7 Ga0070680_100048472 3300005336 Bacteria 3462
8 Ga0070680_100078039 3300005336 Bacteria 2728
9 Ga0070660_100006941 3300005339 Bacteria 7854
10 Ga0070674_100051862 3300005356 Bacteria 2828
11 Ga0070659_100025076 3300005366 Bacteria 4578
12 Ga0070667_100113013 3300005367 Bacteria 2356
13 Ga0070714_100252782 3300005435 Bacteria 1630
14 Ga0070713_100000737 3300005436 Bacteria 20973
15 Ga0070663_100071388 3300005455 Bacteria 2526
16 Ga0070663_100139075 3300005455 Bacteria 1852
17 Ga0070663_100181878 3300005455 Bacteria 1631
18 Ga0070663_100228324 3300005455 Bacteria 1465
19 Ga0070663_100324018 3300005455 Bacteria 1240
20 Ga0070678_100033005 3300005456 Bacteria 3589
21 Ga0070678_100041257 3300005456 Bacteria 3270
22 Ga0070678_100165609 3300005456 Bacteria 1795
23 Ga0070681_10277291 3300005458 Bacteria 1587
24 Ga0068867_100046272 3300005459 Bacteria 3195
25 Ga0070707_100083285 3300005468 Bacteria 3090
26 Ga0070684_100078477 3300005535 Bacteria 2917
27 Ga0070684_100175605 3300005535 Bacteria 1947
28 Ga0070697_100012461 3300005536 Bacteria 6662
29 Ga0068853_100025677 3300005539 Bacteria 4944
30 Ga0068853_100035442 3300005539 Bacteria 4238
31 Ga0068853_100097075 3300005539 Bacteria 2600
32 Ga0068853_100135051 3300005539 Bacteria 2211
33 Ga0070665_100035286 3300005548 Bacteria 5028
34 Ga0068855_100110586 3300005563 Bacteria 3154
35 Ga0068855_100152079 3300005563 Bacteria 2631
36 Ga0070664_100122015 3300005564 Bacteria 2283
37 Ga0068857_100018285 3300005577 Bacteria 6148
38 Ga0068856_100018359 3300005614 Bacteria 6779
39 Ga0068852_100005171 3300005616 Bacteria 9302
40 Ga0068852_100251929 3300005616 Bacteria 1692
41 Ga0068864_100067374 3300005618 Bacteria 3108
42 Ga0068866_10029928 3300005718 Bacteria 2608
43 Ga0068861_100128785 3300005719 Bacteria 2052
44 Ga0068861_100190649 3300005719 Bacteria 1713
45 Ga0068851_10007403 3300005834 Bacteria 5038
46 Ga0068858_100079376 3300005842 Bacteria 3049
47 Ga0068860_100138436 3300005843 Bacteria 2338
48 Ga0068862_100348981 3300005844 Bacteria 1372
49 Ga0068862_100434549 3300005844 Bacteria 1234
50 Ga0081455_10004734 3300005937 Bacteria 15128
51 Ga0081455_10007808 3300005937 Bacteria 11208
52 Ga0081455_10016954 3300005937 Bacteria 7002
53 Ga0081540_1002304 3300005983 Bacteria 15663
54 Ga0081540_1006170 3300005983 Bacteria 8787
55 Ga0081540_1006942 3300005983 Bacteria 8161
56 Ga0081540_1009315 3300005983 Bacteria 6773
57 Ga0081540_1010096 3300005983 Bacteria 6425
58 Ga0081540_1016124 3300005983 Bacteria 4693
59 Ga0081540_1054617 3300005983 Bacteria 1951
60 Ga0081540_1084573 3300005983 Bacteria 1416
61 Ga0081539_10017928 3300005985 Bacteria 4941
62 Ga0070717_10005839 3300006028 Bacteria 9020
63 Ga0070717_10009960 3300006028 Bacteria 7151
64 Ga0070717_10328014 3300006028 Bacteria 1365
65 Ga0075365_10045342 3300006038 Bacteria 2884
66 Ga0075365_10060689 3300006038 Bacteria 2523
67 Ga0075368_10005882 3300006042 Bacteria 4246
68 Ga0075363_100008428 3300006048 Bacteria 4798
69 Ga0075363_100016844 3300006048 Bacteria 3614
70 Ga0075363_100136544 3300006048 Bacteria 1378
71 Ga0070712_100037139 3300006175 Bacteria 3319
72 Ga0075367_10010997 3300006178 Bacteria 4772
73 Ga0075367_10027799 3300006178 Bacteria 3221
74 Ga0075367_10030229 3300006178 Bacteria 3104
75 Ga0075369_10011679 3300006186 Bacteria 3458
76 Ga0075369_10129618 3300006186 Bacteria 1145
77 Ga0075366_10023699 3300006195 Bacteria 3576
78 Ga0075434_100335438 3300006871 Bacteria 1532
79 Ga0068865_100023996 3300006881 Bacteria 3998
80 Ga0097620_100442187 3300006931 Bacteria 1396
81 Ga0099824_1010925 3300006942 Bacteria 10470
82 Ga0099795_10017149 3300007788 Bacteria 2305
83 Ga0105240_10083712 3300009093 Bacteria 3913
84 Ga0105240_10212051 3300009093 Bacteria 2262
85 Ga0105240_10235415 3300009093 Bacteria 2125
86 Ga0111539_10050924 3300009094 Bacteria 4933
87 Ga0111539_10290469 3300009094 Bacteria 1903
88 Ga0105245_10025333 3300009098 Bacteria 5217
89 Ga0114129_10030205 3300009147 Bacteria 7674
90 Ga0105243_10155291 3300009148 Bacteria 1967
91 Ga0105242_10135058 3300009176 Bacteria 2134
92 Ga0105248_10343959 3300009177 Bacteria 1679
93 Ga0105237_10008841 3300009545 Bacteria 10858
94 Ga0105238_10038174 3300009551 Bacteria 4878
95 Ga0105249_10245706 3300009553 Bacteria 1772
96 Ga0099796_10006685 3300010159 Bacteria 2969
97 Ga0105239_10044859 3300010375 Bacteria 4846
98 Ga0105239_10108687 3300010375 Bacteria 3073
99 Ga0105246_10187385 3300011119 Bacteria 1598
100 Ga0157370_10108080 3300013104 Bacteria 2601
101 Ga0157369_10037312 3300013105 Bacteria 5320
102 Ga0157378_10005423 3300013297 Bacteria 11182
103 Ga0163162_10039430 3300013306 Bacteria 4720
104 Ga0157372_10372253 3300013307 Bacteria 1664
105 Ga0157375_10018137 3300013308 Bacteria 6377
106 Ga0157375_10196693 3300013308 Bacteria 2171
107 Ga0163163_10054256 3300014325 Bacteria 3959
108 Ga0163163_10179875 3300014325 Bacteria 2162
109 Ga0157380_10118180 3300014326 Bacteria 2241
110 Ga0157380_10344369 3300014326 Bacteria 1392
111 Ga0157377_10102099 3300014745 Bacteria 1711
112 Ga0157379_10228269 3300014968 Bacteria 1687
113 Ga0157376_10110706 3300014969 Bacteria 2416
114 Ga0157376_10157934 3300014969 Bacteria 2053
115 Ga0206356_10999127 3300020070 Bacteria 1261
116 Ga0206353_10526543 3300020082 Bacteria 2458
117 Ga0213875_10004231 3300021388 Bacteria 7922
118 Ga0209233_1017502 3300025261 Bacteria 1950
119 Ga0209564_1000485 3300025295 Bacteria 66032
120 Ga0209758_1029463 3300025297 Bacteria 2294
121 Ga0207647_10116240 3300025904 Bacteria 1579
122 Ga0207645_10065282 3300025907 Bacteria 2326
123 Ga0207643_10037952 3300025908 Bacteria 2705
124 Ga0207705_10057717 3300025909 Bacteria 2800
125 Ga0207705_10199235 3300025909 Bacteria 1517
126 Ga0207654_10231413 3300025911 Bacteria 1231
127 Ga0207707_10009744 3300025912 Bacteria 8335
128 Ga0207695_10045639 3300025913 Bacteria 4650
129 Ga0207695_10103117 3300025913 Bacteria 2845
130 Ga0207695_10153360 3300025913 Bacteria 2241
131 Ga0207671_10165007 3300025914 Bacteria 1717
132 Ga0207693_10100202 3300025915 Bacteria 2271
133 Ga0207693_10152779 3300025915 Bacteria 1816
134 Ga0207663_10003103 3300025916 Bacteria 8061
135 Ga0207660_10017276 3300025917 Bacteria 4790
136 Ga0207660_10082761 3300025917 Bacteria 2362
137 Ga0207657_10002789 3300025919 Bacteria 18797
138 Ga0207657_10009166 3300025919 Bacteria 9982
139 Ga0207657_10223669 3300025919 Bacteria 1507
140 Ga0207649_10129436 3300025920 Bacteria 1712
141 Ga0207652_10026914 3300025921 Bacteria 4792
142 Ga0207652_10128177 3300025921 Bacteria 2261
143 Ga0207646_10044477 3300025922 Bacteria 3986
144 Ga0207700_10001341 3300025928 Bacteria 13962
145 Ga0207700_10052318 3300025928 Bacteria 3053
146 Ga0207664_10135871 3300025929 Bacteria 2075
147 Ga0207664_10213631 3300025929 Bacteria 1670
148 Ga0207644_10025924 3300025931 Bacteria 4035
149 Ga0207644_10271459 3300025931 Bacteria 1359
150 Ga0207690_10211414 3300025932 Bacteria 1479
151 Ga0207706_10030770 3300025933 Bacteria 4787
152 Ga0207706_10059207 3300025933 Bacteria 3373
153 Ga0207669_10049859 3300025937 Bacteria 2499
154 Ga0207704_10068997 3300025938 Bacteria 2231
155 Ga0207665_10060864 3300025939 Bacteria 2558
156 Ga0207665_10123310 3300025939 Bacteria 1832
157 Ga0207665_10361916 3300025939 Bacteria 1097
158 Ga0207691_10024095 3300025940 Bacteria 5724
159 Ga0207691_10107175 3300025940 Bacteria 2488
160 Ga0207711_10092636 3300025941 Bacteria 2660
161 Ga0207711_10131926 3300025941 Bacteria 2241
162 Ga0207689_10036612 3300025942 Bacteria 4073
163 Ga0207689_10112445 3300025942 Bacteria 2238
164 Ga0207689_10157449 3300025942 Bacteria 1872
165 Ga0207679_10014830 3300025945 Bacteria 5135
166 Ga0207667_10040971 3300025949 Bacteria 4929
167 Ga0207667_10205716 3300025949 Bacteria 2018
168 Ga0207667_10443534 3300025949 Bacteria 1319
169 Ga0207712_10281521 3300025961 Bacteria 1357
170 Ga0207668_10090473 3300025972 Bacteria 2246
171 Ga0207668_10254754 3300025972 Bacteria 1427
172 Ga0207668_10280298 3300025972 Bacteria 1366
173 Ga0207640_10072645 3300025981 Bacteria 2322
174 Ga0207658_10364229 3300025986 Bacteria 1262
175 Ga0207677_10071187 3300026023 Bacteria 2453
176 Ga0207703_10027603 3300026035 Bacteria 4470
177 Ga0207639_10042338 3300026041 Bacteria 3412
178 Ga0207639_10145880 3300026041 Bacteria 1977
179 Ga0207639_10223410 3300026041 Bacteria 1628
180 Ga0207678_10008446 3300026067 Bacteria 9083
181 Ga0207678_10040941 3300026067 Bacteria 4017
182 Ga0207678_10079088 3300026067 Bacteria 2816
183 Ga0207702_10015921 3300026078 Bacteria 6227
184 Ga0207641_10402499 3300026088 Bacteria 1314
185 Ga0207648_10132038 3300026089 Bacteria 2198
186 Ga0207674_10027243 3300026116 Bacteria 6050
187 Ga0207675_100374653 3300026118 Bacteria 1399
188 Ga0207675_100411464 3300026118 Bacteria 1334
189 Ga0207683_10037487 3300026121 Bacteria 4221
190 Ga0207683_10059426 3300026121 Bacteria 3358
191 Ga0207683_10082205 3300026121 Bacteria 2861
192 Ga0207683_10236526 3300026121 Bacteria 1666
193 Ga0207698_10066624 3300026142 Bacteria 2835
194 Ga0209389_1000023 3300027296 Bacteria 150730
195 Ga0209589_1000010 3300027357 Bacteria 237657
196 Ga0209489_100011 3300027361 Bacteria 244710
197 Ga0268266_10264387 3300028379 Bacteria 1595
198 Ga0268264_10000093 3300028381 Bacteria 232057
199 Ga0268264_10213648 3300028381 Bacteria 1772
200 Ga0265334_10011851 3300028573 Bacteria 3663
201 Ga0307517_10000085 3300028786 Bacteria 131200
202 Ga0307517_10150514 3300028786 Bacteria 1598
203 Ga0307515_10078972 3300028794 Bacteria 4318
204 Ga0307515_10242706 3300028794 Bacteria 1569
205 Ga0265330_10057589 3300031235 Bacteria 1695
206 Ga0265325_10049180 3300031241 Bacteria 2177
207 Ga0265340_10034255 3300031247 Bacteria 2526
208 Ga0265339_10042644 3300031249 Bacteria 2512
209 Ga0265331_10021773 3300031250 Bacteria 3276
210 Ga0307508_10049820 3300031616 Bacteria 3730
211 Ga0307508_10178732 3300031616 Bacteria 1725
212 Ga0265314_10148520 3300031711 Bacteria 1440
213 Ga0307516_10008463 3300031730 Bacteria 11640
214 Ga0307516_10195070 3300031730 Bacteria 1748
215 Ga0307516_10202264 3300031730 Bacteria 1705
216 Ga0307516_10309168 3300031730 Bacteria 1254
217 Ga0307410_10204207 3300031852 Bacteria 1511
218 Ga0307416_100217458 3300032002 Bacteria 1829
219 Ga0307415_100170540 3300032126 Bacteria 1696
220 Ga0307507_10147401 3300033179 Bacteria 1783
221 Ga0307510_10203875 3300033180 Bacteria 1509
222 Ga0315911_1000010 3300033442 Bacteria 322197
223 Ga0316215_1000538 3300033544 Bacteria 4160
224 Ga0373950_0014045 3300034818 Bacteria 1344
225 Ga0373928_0006063 3300035084 Bacteria 2318
226 Ga0373929_0016120 3300035085 Bacteria 1461
227 Ga0373934_0004243 3300035086 Bacteria 5288
228 Ga0373951_0045853 3300035091 Bacteria 1065
229 Ga0373923_0018561 3300035111 Bacteria 2679
230 Ga0373932_0004494 3300035112 Bacteria 3295
231 Ga0373936_0023057 3300035113 Bacteria 2424
232 Ga0373945_0108722 3300035116 Bacteria 1092
233 Ga0373953_0003844 3300035117 Bacteria 4728
234 Ga0373954_0003555 3300035118 Bacteria 6623
235 Ga0373957_0001601 3300035120 Bacteria 6192
236 Ga0373943_0002133 3300035170 Bacteria 8990
237 Ga0373946_0016813 3300035171 Bacteria 2792
238 Ga0373931_0011398 3300035691 Bacteria 4295
239 Ga0373935_0000259 3300035692 Bacteria 26229
240 Ga0373935_0031447 3300035692 Bacteria 3294
241 Ga0373927_0002522 3300035695 Bacteria 13350
242 Ga0373927_0007423 3300035695 Bacteria 7422
243 Ga0373927_0038511 3300035695 Bacteria 3104
244 Ga0373927_0089561 3300035695 Bacteria 1998
245 Ga0373927_0182849 3300035695 Bacteria 1375
246 Ga0373933_0008746 3300035724 Bacteria 5520
247 Ga0373947_0000217 3300035725 Bacteria 32254
248 Ga0373947_0013560 3300035725 Bacteria 4670
249 Ga0373937_0014756 3300036401 Bacteria 6898
250 Ga0373937_0027287 3300036401 Bacteria 5164
251 Ga0372808_000294 3300036459 Bacteria 3496
252 Ga0373925_0003792 3300037068 Bacteria 11621
253 Ga0373925_0012744 3300037068 Bacteria 6092
254 Ga0373925_0226616 3300037068 Bacteria 1493
255 Ga0395900_0067826 3300037418 Bacteria 3665
256 Ga0395898_0137402 3300037466 Bacteria 2340
257 Ga0395901_0248873 3300038443 Bacteria 1852
258 Ga0436365_1200085 3300039437 Bacteria 5790
259 Ga0466972_0000520 3300044658 Bacteria 19029
260 Ga0466965_0140965 3300044683 Bacteria 1255
261 Ga0466966_0005474 3300044684 Bacteria 8351
262 Ga0466961_0000081 3300044693 Bacteria 59450
263 Ga0466963_0006536 3300044694 Bacteria 6904
264 Ga0466963_0104587 3300044694 Bacteria 1940
265 Ga0466959_0007840 3300045049 Bacteria 7516
266 Ga0466959_0088585 3300045049 Bacteria 2225
267 Ga0495592_0004003 3300046454 Bacteria 10691
268 Ga0495592_0010878 3300046454 Bacteria 6865
269 Ga0495603_0000352 3300046455 Bacteria 24722
270 Ga0495603_0009224 3300046455 Bacteria 5963
271 Ga0495629_0000341 3300046459 Bacteria 39851
272 Ga0495629_0090105 3300046459 Bacteria 2140
273 Ga0495638_0148152 3300046460 Bacteria 1363
274 Ga0495653_0003343 3300046463 Bacteria 12890
275 Ga0495580_0003184 3300046472 Bacteria 14061
276 Ga0495582_0000245 3300046473 Bacteria 30263
277 Ga0495639_0000275 3300046475 Bacteria 25388
278 Ga0495639_0038018 3300046475 Bacteria 2160
279 Ga0495662_0001790 3300046476 Bacteria 10755
280 Ga0495664_0017791 3300046477 Bacteria 4064
281 Ga0495584_0099900 3300046491 Bacteria 1466
282 Ga0495594_0001300 3300046499 Bacteria 13017
283 Ga0495607_0039517 3300046501 Bacteria 2817
284 Ga0495610_0044994 3300046512 Bacteria 2187
285 Ga0495610_0096503 3300046512 Bacteria 1331
286 Ga0495620_0037158 3300046515 Bacteria 2172
287 Ga0495628_0012504 3300046516 Bacteria 7154
288 Ga0495628_0039880 3300046516 Bacteria 3755
289 Ga0495630_0003021 3300046517 Bacteria 11666
290 Ga0495631_0015793 3300046518 Bacteria 3611
291 Ga0495648_0001680 3300046524 Bacteria 21407
292 Ga0495648_0003398 3300046524 Bacteria 13990
293 Ga0495648_0104146 3300046524 Bacteria 1559
294 Ga0495652_0077136 3300046529 Bacteria 2763
295 Ga0495665_0000042 3300046531 Bacteria 49467
296 Ga0495640_0011597 3300046533 Bacteria 6773
297 Ga0495598_0004661 3300046537 Bacteria 2984
298 Ga0495609_0024409 3300046538 Bacteria 2774
299 Ga0495621_0030236 3300046539 Bacteria 1850
300 Ga0495645_0001286 3300046543 Bacteria 17104
301 Ga0495622_0001455 3300046557 Bacteria 11926
302 Ga0495622_0002944 3300046557 Bacteria 8113
303 Ga0495622_0041288 3300046557 Bacteria 2145
304 Ga0495667_0003108 3300046559 Bacteria 11138
305 Ga0495656_0028293 3300046615 Bacteria 2247
306 Ga0495656_0039458 3300046615 Bacteria 1961
307 Ga0495668_0072209 3300046616 Bacteria 1896
308 Ga0495668_0115168 3300046616 Bacteria 1470
309 Ga0495668_0147802 3300046616 Bacteria 1287
310 Ga0495634_0000249 3300046642 Bacteria 50835
311 Ga0495634_0009610 3300046642 Bacteria 7125
312 Ga0495625_0024104 3300046660 Bacteria 4637
313 Ga0495635_0000239 3300046663 Bacteria 34889
314 Ga0495661_0024354 3300046665 Bacteria 3918
315 Ga0495588_0003608 3300046674 Bacteria 6764
316 Ga0495588_0044419 3300046674 Bacteria 2276
317 Ga0495599_0001118 3300046678 Bacteria 15101
318 Ga0495646_0008784 3300046680 Bacteria 6417
319 Ga0495646_0015009 3300046680 Bacteria 4919
320 Ga0495647_0000418 3300046681 Bacteria 12174
321 Ga0495658_0001216 3300046683 Bacteria 13515
322 Ga0495669_0043583 3300046684 Bacteria 1998
323 Ga0495669_0148817 3300046684 Bacteria 1108
324 Ga0495613_0000929 3300046689 Bacteria 22466
325 Ga0495613_0039302 3300046689 Bacteria 3508
326 Ga0495624_0000538 3300046690 Bacteria 29656
327 Ga0495671_0094728 3300046692 Bacteria 1461
328 Ga0495589_0112921 3300046794 Bacteria 1311
329 Ga0495600_0014818 3300046809 Bacteria 4917
330 Ga0495581_0033829 3300047315 Bacteria 2959
331 Ga0495604_0006592 3300047317 Bacteria 9201
332 Ga0495604_0151234 3300047317 Bacteria 1649
333 Ga0495674_0054370 3300047319 Bacteria 3516
334 Ga0495672_0026159 3300047320 Bacteria 3725
335 Ga0495672_0065065 3300047320 Bacteria 2085
336 Ga0495676_0103244 3300047321 Bacteria 2105
337 Ga0495676_0270084 3300047321 Bacteria 1154
338 Ga0495677_0009831 3300047445 Bacteria 3525
339 Ga0495673_0057087 3300047469 Bacteria 1686
340 Ga0495684_0004414 3300047471 Bacteria 11000
341 Ga0495686_0024862 3300047472 Bacteria 3930
342 Ga0495686_0040115 3300047472 Bacteria 2988
343 Ga0495686_0041306 3300047472 Bacteria 2937
344 Ga0495686_0092659 3300047472 Bacteria 1832
345 Ga0495593_0000034 3300047673 Bacteria 57993
346 Ga0495593_0004126 3300047673 Bacteria 8642
347 Ga0495602_0055208 3300048088 Bacteria 3499
348 Ga0495614_0002600 3300048089 Bacteria 8028
349 Ga0496100_0008416 3300048903 Bacteria 5753
350 Ga0496100_0092199 3300048903 Bacteria 2070
351 Ga0496100_0250415 3300048903 Bacteria 1310
352 Ga0496101_0086414 3300048904 Bacteria 2326
353 Ga0496101_0189061 3300048904 Bacteria 1588
354 Ga0496101_0247222 3300048904 Bacteria 1389
355 Ga0496101_0293108 3300048904 Bacteria 1273
356 Ga0496102_0025975 3300048905 Bacteria 5219
357 Ga0496102_0039294 3300048905 Bacteria 4275
358 Ga0496104_0281394 3300048907 Bacteria 1576
359 Ga0496105_0013770 3300048908 Bacteria 6422
360 Ga0496106_0000649 3300048909 Bacteria 24884
361 Ga0496106_0076272 3300048909 Bacteria 2569
362 Ga0496106_0099691 3300048909 Bacteria 2252
363 Ga0496107_0016695 3300048910 Bacteria 5160
364 Ga0496109_0006785 3300048912 Bacteria 9645
365 Ga0496109_0032069 3300048912 Bacteria 4720
366 Ga0496109_0304386 3300048912 Bacteria 1503
367 Ga0496110_0008221 3300048913 Bacteria 8385
368 Ga0496110_0021224 3300048913 Bacteria 5494
369 Ga0496110_0367228 3300048913 Bacteria 1311
370 Ga0496111_0161891 3300048914 Bacteria 1662
371 Ga0496111_0208400 3300048914 Bacteria 1452
372 Ga0496112_0000037 3300048915 Bacteria 96876
373 Ga0496112_0003961 3300048915 Bacteria 12409
374 Ga0496112_0021901 3300048915 Bacteria 6082
375 Ga0496112_0102784 3300048915 Bacteria 2827
376 Ga0496112_0165641 3300048915 Bacteria 2176
377 Ga0496112_0288946 3300048915 Bacteria 1586
378 Ga0496113_0159050 3300048916 Bacteria 1785
379 Ga0496114_0157357 3300048917 Bacteria 1973
380 Ga0496115_0007240 3300048918 Bacteria 8156
381 Ga0496115_0021816 3300048918 Bacteria 4951
382 Ga0496115_0032633 3300048918 Bacteria 4108
383 Ga0496115_0054375 3300048918 Bacteria 3215
384 Ga0496115_0124303 3300048918 Bacteria 2124
385 Ga0496115_0275365 3300048918 Bacteria 1382
386 Ga0496116_0026092 3300048919 Bacteria 4280
387 Ga0496116_0116602 3300048919 Bacteria 1556
388 Ga0496117_0006544 3300048920 Bacteria 11729
389 Ga0496117_0013445 3300048920 Bacteria 7141
390 Ga0496117_0075581 3300048920 Bacteria 2237
391 Ga0496117_0102629 3300048920 Bacteria 1804
392 Ga0496118_0003970 3300048921 Bacteria 18053
393 Ga0496118_0060107 3300048921 Bacteria 2824
394 Ga0496118_0076246 3300048921 Bacteria 2385
395 Ga0496119_0029785 3300048922 Bacteria 3692
396 Ga0496120_0026718 3300048923 Bacteria 3561
397 Ga0496121_0000476 3300048924 Bacteria 78015
398 Ga0496121_0001742 3300048924 Bacteria 35564
399 Ga0496121_0003089 3300048924 Bacteria 24095
400 Ga0496121_0007886 3300048924 Bacteria 12739
401 Ga0496121_0066441 3300048924 Bacteria 2928
402 Ga0496121_0073520 3300048924 Bacteria 2739
403 Ga0496121_0074570 3300048924 Bacteria 2713
404 Ga0496121_0157710 3300048924 Bacteria 1663
405 Ga0496122_0060286 3300048925 Bacteria 2795
406 Ga0496123_0077422 3300048926 Bacteria 2042
407 Ga0496123_0117547 3300048926 Bacteria 1503
408 Ga0496124_0001128 3300048927 Bacteria 42017
409 Ga0496124_0043677 3300048927 Bacteria 3852
410 Ga0496124_0214415 3300048927 Bacteria 1454
411 Ga0496125_0000154 3300048928 Bacteria 152240
412 Ga0496125_0001251 3300048928 Bacteria 37908
413 Ga0496125_0012395 3300048928 Bacteria 8467
414 Ga0496125_0044517 3300048928 Bacteria 3752
415 Ga0496126_0002744 3300048929 Bacteria 23267
416 Ga0496126_0005646 3300048929 Bacteria 14209
417 Ga0496126_0005790 3300048929 Bacteria 13970
418 Ga0496126_0019810 3300048929 Bacteria 6617
419 Ga0496126_0073181 3300048929 Bacteria 3047
420 Ga0496126_0136588 3300048929 Bacteria 2114
421 Ga0496126_0175809 3300048929 Bacteria 1821
422 Ga0496126_0215657 3300048929 Bacteria 1614
423 Ga0496126_0271145 3300048929 Bacteria 1408
424 Ga0501031_0011177 3300049568 Bacteria 5850
425 Ga0501032_0003299 3300049569 Bacteria 12409
426 Ga0501033_0000124 3300049570 Bacteria 74731
427 Ga0501033_0037338 3300049570 Bacteria 3637
428 Ga0501036_0001379 3300049572 Bacteria 18654
429 Ga0501036_0057426 3300049572 Bacteria 3297
430 Ga0501037_0037968 3300049573 Bacteria 3550
431 Ga0501038_0000041 3300049574 Bacteria 120557
432 Ga0501038_0036322 3300049574 Bacteria 4325
433 Ga0501039_0000472 3300049575 Bacteria 29218
434 Ga0501039_0118576 3300049575 Bacteria 2073
435 Ga0501043_0022762 3300049579 Bacteria 4913
436 Ga0501047_0016600 3300049581 Bacteria 7028
437 Ga0501047_0023633 3300049581 Bacteria 5900
438 Ga0501067_0077869 3300049583 Bacteria 1837
439 Ga0501068_0021594 3300049584 Bacteria 3760
440 Ga0501069_0014051 3300049585 Bacteria 4277
441 Ga0501070_0004644 3300049586 Bacteria 11766
442 Ga0501070_0034844 3300049586 Bacteria 4207
443 Ga0501073_0028939 3300049589 Bacteria 3958
444 Ga0501080_0000638 3300049742 Bacteria 27778
445 Ga0501035_0002235 3300049822 Bacteria 19183
446 Ga0501035_0049374 3300049822 Bacteria 3771
447 Ga0501044_0071456 3300049823 Bacteria 3529
448 Ga0501045_0029715 3300049824 Bacteria 3952
449 nmdc:mga00v17_28583_c1 3300050491 Bacteria 3266
450 nmdc:mga00v17_94891_c1 3300050491 Bacteria 1877
451 nmdc:mga0yw44_19552_c1 3300050492 Bacteria 3738
452 nmdc:mga0yw44_31585_c1 3300050492 Bacteria 3081
453 nmdc:mga05p37_348275_c1 3300050507 Bacteria 1745
454 nmdc:mga08y16_158068_c1 3300050511 Bacteria 2355
455 nmdc:mga08y16_229255_c1 3300050511 Bacteria 1921
456 nmdc:mga0n895_53072_c1 3300050512 Bacteria 3981
457 nmdc:mga0a205_244607_c1 3300050515 Bacteria 1674
458 nmdc:mga0sz30_5341_c1 3300050516 Bacteria 4706
459 Ga0495601_0022259 3300053077 Bacteria 3890
460 Ga0495601_0113424 3300053077 Bacteria 1757
461 Ga0500635_0004467 3300053080 Bacteria 3609
462 Ga0495595_0004386 3300053084 Bacteria 5679
463 Ga0495595_0006944 3300053084 Bacteria 4623
464 Ga0495619_0004209 3300053085 Bacteria 9182
465 Ga0495619_0041813 3300053085 Bacteria 2999
466 Ga0500643_028088 3300053087 Bacteria 1742
467 Ga0500651_0000861 3300053093 Bacteria 14855
468 Ga0500651_0039325 3300053093 Bacteria 2978
469 Ga0500651_0183221 3300053093 Bacteria 1243
470 Ga0500566_0000157 3300053094 Bacteria 34534
471 Ga0500566_0016976 3300053094 Bacteria 4275
472 Ga0500566_0093266 3300053094 Bacteria 1661
473 Ga0500641_0006830 3300053096 Bacteria 4059
474 Ga0500641_0108380 3300053096 Bacteria 1194
475 Ga0500554_000813 3300053102 Bacteria 6155
476 Ga0500556_0000413 3300053104 Bacteria 31142
477 Ga0500557_000041 3300053105 Bacteria 64885
478 Ga0500592_001374 3300053116 Bacteria 3938
479 Ga0500595_000331 3300053119 Bacteria 31133
480 Ga0500595_001464 3300053119 Bacteria 12587
481 Ga0500595_005225 3300053119 Bacteria 5688
482 Ga0500595_011823 3300053119 Bacteria 3399
483 Ga0500642_0000005 3300053130 Bacteria 422725
484 Ga0500642_0025239 3300053130 Bacteria 2412
485 Ga0500655_011033 3300053133 Bacteria 1635
486 Ga0500658_0071925 3300053134 Bacteria 1461
487 Ga0500658_0092536 3300053134 Bacteria 1309
488 Ga0500559_0002794 3300053136 Bacteria 8831
489 Ga0500559_0030986 3300053136 Bacteria 2294
490 Ga0500568_0002149 3300053139 Bacteria 11891
491 Ga0500568_0014348 3300053139 Bacteria 3581
492 Ga0500568_0097246 3300053139 Bacteria 1107
493 Ga0500573_0002307 3300053140 Bacteria 9486
494 Ga0500586_004415 3300053145 Bacteria 3439
495 Ga0500588_0010416 3300053146 Bacteria 2244
496 Ga0500590_030324 3300053148 Bacteria 2806
497 Ga0500603_001303 3300053150 Bacteria 5725
498 Ga0500603_048710 3300053150 Bacteria 1153
499 Ga0500604_0001450 3300053151 Bacteria 6633
500 Ga0500604_0044019 3300053151 Bacteria 1358
501 Ga0500616_0000180 3300053153 Bacteria 106053
502 Ga0500622_0022981 3300053156 Bacteria 3302
503 Ga0500627_0117127 3300053158 Bacteria 1200
504 Ga0500634_0120028 3300053161 Bacteria 1281
505 Ga0500638_000259 3300053162 Bacteria 11614
506 Ga0500638_065247 3300053162 Bacteria 1746
507 Ga0500636_0002272 3300053177 Bacteria 10660
508 Ga0500637_0001727 3300053178 Bacteria 9419
509 Ga0500637_0011620 3300053178 Bacteria 4559
510 Ga0500645_011768 3300053730 Bacteria 2845
511 Ga0500601_002924 3300053737 Bacteria 1844
512 Ga0466962_0061795 3300061719 Bacteria 1788
513 Ga0466962_0077129 3300061719 Bacteria 1593
514 2513655034 2513237096 Bacteria 8722461
515 2513677804 2513237098 Bacteria 9902361
516 2513697443 2513237101 Bacteria 7952346
517 2513861050 2513237137 Bacteria 9558895
518 2513915943 2513237145 Bacteria 8979722
519 2515625428 2515154112 Bacteria 8294334
520 2517894752 2517572143 Bacteria 9484767
521 2524464083 2524023210 Bacteria 9029266
522 2603862607 2602042107 Bacteria 6226103
523 2671119166 2667528175 Bacteria 7532676
524 2723843064 2721755755 Bacteria 8322773
525 2793071227 2791355197 Bacteria 8420563
526 2793079527
527 2841943198 2841941048 Bacteria 8688029
528 2841976629 2841974524 Bacteria 8931498
529 2857529952 2857524615 Bacteria 6615449
530 2874612604 2874604998 Bacteria 7834745
531 2876812881 2876808645 Bacteria 8824342
532 2879118043 2879110137 Bacteria 8907982
533 2885378774 2885374607 Bacteria 8927485
534 2885384498 2885383462 Bacteria 9473874
535 2885413423 2885409591 Bacteria 9235467
536 2889033634 2889033259 Bacteria 9099371
537 2893069404 2893066018 Bacteria 6158120
538 2903751434 2903748898 Bacteria 9972761
539 2903773634 2903768456 Bacteria 9749579
540 2904697735 2904690495 Bacteria 9412302
541 2904705885
542 2906611472
543 2906641691 2906635258 Bacteria 8601019
544 2906660793 2906660503 Bacteria 8595048
545 2908745064 2908739725 Bacteria 8628932
546 2908757168 2908756301 Bacteria 8864324
547 2919077194 2919073203 Bacteria 6531949
548 2922367000 2922361189 Bacteria 7436256
549 2922390217 2922386360 Bacteria 7017218
550 2922427885
551 2935632187 2935630451 Bacteria 8169952
552 2935962036 2935959822 Bacteria 7869783
553 2941508135 2941507105 Bacteria 8166816
554 2941515360 2941515067 Bacteria 8166720
555 2941524065 2941523033 Bacteria 8169134
556 3005477595 3005474847 Bacteria 9259049
557 3005507116 3005506211 Bacteria 6943378
558 8006933624 8006933436 Bacteria 10410654
559 8006966536 8006964411 Bacteria 8966052
560 8006989365 8006984368 Bacteria 9651211
561 8006997848 8006994254 Bacteria 8309700
562 8019559567 8019555841 Bacteria 9642137
563 8019569667 8019565922 Bacteria 9639779
564 8056674882 8056673599 Bacteria 7871253
565 8056682374 8056681323 Bacteria 8472857
566 Ga0105241_10106747
567 JGI25404J52841_10003909
568 JGI25404J52841_10008965
569 JGI25404J52841_10018149
570 Ga0065165_1044756
571 Ga0068869_100265783
572 Ga0070680_100048472
573 Ga0070680_100078039
574 Ga0070660_100006941
575 Ga0070674_100051862
576 Ga0070659_100025076
577 Ga0070667_100113013
578 Ga0070714_100252782
579 Ga0070713_100000737
580 Ga0070663_100071388
581 Ga0070663_100139075
582 Ga0070663_100181878
583 Ga0070663_100228324
584 Ga0070663_100324018
585 Ga0070678_100033005
586 Ga0070678_100041257
587 Ga0070678_100165609
588 Ga0070681_10277291
589 Ga0068867_100046272
590 Ga0070707_100083285
591 Ga0070684_100078477
592 Ga0070684_100175605
593 Ga0070697_100012461
594 Ga0068853_100025677
595 Ga0068853_100035442
596 Ga0068853_100097075
597 Ga0068853_100135051
598 Ga0070665_100035286
599 Ga0068855_100110586
600 Ga0068855_100152079
601 Ga0070664_100122015
602 Ga0068857_100018285
603 Ga0068856_100018359
604 Ga0068852_100005171
605 Ga0068852_100251929
606 Ga0068864_100067374
607 Ga0068866_10029928
608 Ga0068861_100128785
609 Ga0068861_100190649
610 Ga0068851_10007403
611 Ga0068858_100079376
612 Ga0068860_100138436
613 Ga0068862_100348981
614 Ga0068862_100434549
615 Ga0081455_10004734
616 Ga0081455_10007808
617 Ga0081455_10016954
618 Ga0081540_1002304
619 Ga0081540_1006170
620 Ga0081540_1006942
621 Ga0081540_1009315
622 Ga0081540_1010096
623 Ga0081540_1016124
624 Ga0081540_1054617
625 Ga0081540_1084573
626 Ga0081539_10017928
627 Ga0070717_10005839
628 Ga0070717_10009960
629 Ga0070717_10328014
630 Ga0075365_10045342
631 Ga0075365_10060689
632 Ga0075368_10005882
633 Ga0075363_100008428
634 Ga0075363_100016844
635 Ga0075363_100136544
636 Ga0070712_100037139
637 Ga0075367_10010997
638 Ga0075367_10027799
639 Ga0075367_10030229
640 Ga0075369_10011679
641 Ga0075369_10129618
642 Ga0075366_10023699
643 Ga0075434_100335438
644 Ga0068865_100023996
645 Ga0097620_100442187
646 Ga0099824_1010925
647 Ga0099795_10017149
648 Ga0105240_10083712
649 Ga0105240_10212051
650 Ga0105240_10235415
651 Ga0111539_10050924
652 Ga0111539_10290469
653 Ga0105245_10025333
654 Ga0114129_10030205
655 Ga0105243_10155291
656 Ga0105242_10135058
657 Ga0105248_10343959
658 Ga0105237_10008841
659 Ga0105238_10038174
660 Ga0105249_10245706
661 Ga0099796_10006685
662 Ga0105239_10044859
663 Ga0105239_10108687
664 Ga0105246_10187385
665 Ga0157370_10108080
666 Ga0157369_10037312
667 Ga0157378_10005423
668 Ga0163162_10039430
669 Ga0157372_10372253
670 Ga0157375_10018137
671 Ga0157375_10196693
672 Ga0163163_10054256
673 Ga0163163_10179875
674 Ga0157380_10118180
675 Ga0157380_10344369
676 Ga0157377_10102099
677 Ga0157379_10228269
678 Ga0157376_10110706
679 Ga0157376_10157934
680 Ga0206356_10999127
681 Ga0206353_10526543
682 Ga0213875_10004231
683 Ga0209233_1017502
684 Ga0209564_1000485
685 Ga0209758_1029463
686 Ga0207647_10116240
687 Ga0207645_10065282
688 Ga0207643_10037952
689 Ga0207705_10057717
690 Ga0207705_10199235
691 Ga0207654_10231413
692 Ga0207707_10009744
693 Ga0207695_10045639
694 Ga0207695_10103117
695 Ga0207695_10153360
696 Ga0207671_10165007
697 Ga0207693_10100202
698 Ga0207693_10152779
699 Ga0207663_10003103
700 Ga0207660_10017276
701 Ga0207660_10082761
702 Ga0207657_10002789
703 Ga0207657_10009166
704 Ga0207657_10223669
705 Ga0207649_10129436
706 Ga0207652_10026914
707 Ga0207652_10128177
708 Ga0207646_10044477
709 Ga0207700_10001341
710 Ga0207700_10052318
711 Ga0207664_10135871
712 Ga0207664_10213631
713 Ga0207644_10025924
714 Ga0207644_10271459
715 Ga0207690_10211414
716 Ga0207706_10030770
717 Ga0207706_10059207
718 Ga0207669_10049859
719 Ga0207704_10068997
720 Ga0207665_10060864
721 Ga0207665_10123310
722 Ga0207665_10361916
723 Ga0207691_10024095
724 Ga0207691_10107175
725 Ga0207711_10092636
726 Ga0207711_10131926
727 Ga0207689_10036612
728 Ga0207689_10112445
729 Ga0207689_10157449
730 Ga0207679_10014830
731 Ga0207667_10040971
732 Ga0207667_10205716
733 Ga0207667_10443534
734 Ga0207712_10281521
735 Ga0207668_10090473
736 Ga0207668_10254754
737 Ga0207668_10280298
738 Ga0207640_10072645
739 Ga0207658_10364229
740 Ga0207677_10071187
741 Ga0207703_10027603
742 Ga0207639_10042338
743 Ga0207639_10145880
744 Ga0207639_10223410
745 Ga0207678_10008446
746 Ga0207678_10040941
747 Ga0207678_10079088
748 Ga0207702_10015921
749 Ga0207641_10402499
750 Ga0207648_10132038
751 Ga0207674_10027243
752 Ga0207675_100374653
753 Ga0207675_100411464
754 Ga0207683_10037487
755 Ga0207683_10059426
756 Ga0207683_10082205
757 Ga0207683_10236526
758 Ga0207698_10066624
759 Ga0209389_1000023
760 Ga0209589_1000010
761 Ga0209489_100011
762 Ga0268266_10264387
763 Ga0268264_10000093
764 Ga0268264_10213648
765 Ga0265334_10011851
766 Ga0307517_10000085
767 Ga0307517_10150514
768 Ga0307515_10078972
769 Ga0307515_10242706
770 Ga0265330_10057589
771 Ga0265325_10049180
772 Ga0265340_10034255
773 Ga0265339_10042644
774 Ga0265331_10021773
775 Ga0307508_10049820
776 Ga0307508_10178732
777 Ga0265314_10148520
778 Ga0307516_10008463
779 Ga0307516_10195070
780 Ga0307516_10202264
781 Ga0307516_10309168
782 Ga0307410_10204207
783 Ga0307416_100217458
784 Ga0307415_100170540
785 Ga0307507_10147401
786 Ga0307510_10203875
787 Ga0315911_1000010
788 Ga0316215_1000538
789 Ga0373950_0014045
790 Ga0373928_0006063
791 Ga0373929_0016120
792 Ga0373934_0004243
793 Ga0373951_0045853
794 Ga0373923_0018561
795 Ga0373932_0004494
796 Ga0373936_0023057
797 Ga0373945_0108722
798 Ga0373953_0003844
799 Ga0373954_0003555
800 Ga0373957_0001601
801 Ga0373943_0002133
802 Ga0373946_0016813
803 Ga0373931_0011398
804 Ga0373935_0000259
805 Ga0373935_0031447
806 Ga0373927_0002522
807 Ga0373927_0007423
808 Ga0373927_0038511
809 Ga0373927_0089561
810 Ga0373927_0182849
811 Ga0373933_0008746
812 Ga0373947_0000217
813 Ga0373947_0013560
814 Ga0373937_0014756
815 Ga0373937_0027287
816 Ga0372808_000294
817 Ga0373925_0003792
818 Ga0373925_0012744
819 Ga0373925_0226616
820 Ga0395900_0067826
821 Ga0395898_0137402
822 Ga0395901_0248873
823 Ga0436365_1200085
824 Ga0466972_0000520
825 Ga0466965_0140965
826 Ga0466966_0005474
827 Ga0466961_0000081
828 Ga0466963_0006536
829 Ga0466963_0104587
830 Ga0466959_0007840
831 Ga0466959_0088585
832 Ga0495592_0004003
833 Ga0495592_0010878
834 Ga0495603_0000352
835 Ga0495603_0009224
836 Ga0495629_0000341
837 Ga0495629_0090105
838 Ga0495638_0148152
839 Ga0495653_0003343
840 Ga0495580_0003184
841 Ga0495582_0000245
842 Ga0495639_0000275
843 Ga0495639_0038018
844 Ga0495662_0001790
845 Ga0495664_0017791
846 Ga0495584_0099900
847 Ga0495594_0001300
848 Ga0495607_0039517
849 Ga0495610_0044994
850 Ga0495610_0096503
851 Ga0495620_0037158
852 Ga0495628_0012504
853 Ga0495628_0039880
854 Ga0495630_0003021
855 Ga0495631_0015793
856 Ga0495648_0001680
857 Ga0495648_0003398
858 Ga0495648_0104146
859 Ga0495652_0077136
860 Ga0495665_0000042
861 Ga0495640_0011597
862 Ga0495598_0004661
863 Ga0495609_0024409
864 Ga0495621_0030236
865 Ga0495645_0001286
866 Ga0495622_0001455
867 Ga0495622_0002944
868 Ga0495622_0041288
869 Ga0495667_0003108
870 Ga0495656_0028293
871 Ga0495656_0039458
872 Ga0495668_0072209
873 Ga0495668_0115168
874 Ga0495668_0147802
875 Ga0495634_0000249
876 Ga0495634_0009610
877 Ga0495625_0024104
878 Ga0495635_0000239
879 Ga0495661_0024354
880 Ga0495588_0003608
881 Ga0495588_0044419
882 Ga0495599_0001118
883 Ga0495646_0008784
884 Ga0495646_0015009
885 Ga0495647_0000418
886 Ga0495658_0001216
887 Ga0495669_0043583
888 Ga0495669_0148817
889 Ga0495613_0000929
890 Ga0495613_0039302
891 Ga0495624_0000538
892 Ga0495671_0094728
893 Ga0495589_0112921
894 Ga0495600_0014818
895 Ga0495581_0033829
896 Ga0495604_0006592
897 Ga0495604_0151234
898 Ga0495674_0054370
899 Ga0495672_0026159
900 Ga0495672_0065065
901 Ga0495676_0103244
902 Ga0495676_0270084
903 Ga0495677_0009831
904 Ga0495673_0057087
905 Ga0495684_0004414
906 Ga0495686_0024862
907 Ga0495686_0040115
908 Ga0495686_0041306
909 Ga0495686_0092659
910 Ga0495593_0000034
911 Ga0495593_0004126
912 Ga0495602_0055208
913 Ga0495614_0002600
914 Ga0496100_0008416
915 Ga0496100_0092199
916 Ga0496100_0250415
917 Ga0496101_0086414
918 Ga0496101_0189061
919 Ga0496101_0247222
920 Ga0496101_0293108
921 Ga0496102_0025975
922 Ga0496102_0039294
923 Ga0496104_0281394
924 Ga0496105_0013770
925 Ga0496106_0000649
926 Ga0496106_0076272
927 Ga0496106_0099691
928 Ga0496107_0016695
929 Ga0496109_0006785
930 Ga0496109_0032069
931 Ga0496109_0304386
932 Ga0496110_0008221
933 Ga0496110_0021224
934 Ga0496110_0367228
935 Ga0496111_0161891
936 Ga0496111_0208400
937 Ga0496112_0000037
938 Ga0496112_0003961
939 Ga0496112_0021901
940 Ga0496112_0102784
941 Ga0496112_0165641
942 Ga0496112_0288946
943 Ga0496113_0159050
944 Ga0496114_0157357
945 Ga0496115_0007240
946 Ga0496115_0021816
947 Ga0496115_0032633
948 Ga0496115_0054375
949 Ga0496115_0124303
950 Ga0496115_0275365
951 Ga0496116_0026092
952 Ga0496116_0116602
953 Ga0496117_0006544
954 Ga0496117_0013445
955 Ga0496117_0075581
956 Ga0496117_0102629
957 Ga0496118_0003970
958 Ga0496118_0060107
959 Ga0496118_0076246
960 Ga0496119_0029785
961 Ga0496120_0026718
962 Ga0496121_0000476
963 Ga0496121_0001742
964 Ga0496121_0003089
965 Ga0496121_0007886
966 Ga0496121_0066441
967 Ga0496121_0073520
968 Ga0496121_0074570
969 Ga0496121_0157710
970 Ga0496122_0060286
971 Ga0496123_0077422
972 Ga0496123_0117547
973 Ga0496124_0001128
974 Ga0496124_0043677
975 Ga0496124_0214415
976 Ga0496125_0000154
977 Ga0496125_0001251
978 Ga0496125_0012395
979 Ga0496125_0044517
980 Ga0496126_0002744
981 Ga0496126_0005646
982 Ga0496126_0005790
983 Ga0496126_0019810
984 Ga0496126_0073181
985 Ga0496126_0136588
986 Ga0496126_0175809
987 Ga0496126_0215657
988 Ga0496126_0271145
989 Ga0501031_0011177
990 Ga0501032_0003299
991 Ga0501033_0000124
992 Ga0501033_0037338
993 Ga0501036_0001379
994 Ga0501036_0057426
995 Ga0501037_0037968
996 Ga0501038_0000041
997 Ga0501038_0036322
998 Ga0501039_0000472
999 Ga0501039_0118576
1000 Ga0501043_0022762
1001 Ga0501047_0016600
1002 Ga0501047_0023633
1003 Ga0501067_0077869
1004 Ga0501068_0021594
1005 Ga0501069_0014051
1006 Ga0501070_0004644
1007 Ga0501070_0034844
1008 Ga0501073_0028939
1009 Ga0501080_0000638
1010 Ga0501035_0002235
1011 Ga0501035_0049374
1012 Ga0501044_0071456
1013 Ga0501045_0029715
1014 nmdc:mga00v17_28583_c1
1015 nmdc:mga00v17_94891_c1
1016 nmdc:mga0yw44_19552_c1
1017 nmdc:mga0yw44_31585_c1
1018 nmdc:mga05p37_348275_c1
1019 nmdc:mga08y16_158068_c1
1020 nmdc:mga08y16_229255_c1
1021 nmdc:mga0n895_53072_c1
1022 nmdc:mga0a205_244607_c1
1023 nmdc:mga0sz30_5341_c1
1024 Ga0495601_0022259
1025 Ga0495601_0113424
1026 Ga0500635_0004467
1027 Ga0495595_0004386
1028 Ga0495595_0006944
1029 Ga0495619_0004209
1030 Ga0495619_0041813
1031 Ga0500643_028088
1032 Ga0500651_0000861
1033 Ga0500651_0039325
1034 Ga0500651_0183221
1035 Ga0500566_0000157
1036 Ga0500566_0016976
1037 Ga0500566_0093266
1038 Ga0500641_0006830
1039 Ga0500641_0108380
1040 Ga0500554_000813
1041 Ga0500556_0000413
1042 Ga0500557_000041
1043 Ga0500592_001374
1044 Ga0500595_000331
1045 Ga0500595_001464
1046 Ga0500595_005225
1047 Ga0500595_011823
1048 Ga0500642_0000005
1049 Ga0500642_0025239
1050 Ga0500655_011033
1051 Ga0500658_0071925
1052 Ga0500658_0092536
1053 Ga0500559_0002794
1054 Ga0500559_0030986
1055 Ga0500568_0002149
1056 Ga0500568_0014348
1057 Ga0500568_0097246
1058 Ga0500573_0002307
1059 Ga0500586_004415
1060 Ga0500588_0010416
1061 Ga0500590_030324
1062 Ga0500603_001303
1063 Ga0500603_048710
1064 Ga0500604_0001450
1065 Ga0500604_0044019
1066 Ga0500616_0000180
1067 Ga0500622_0022981
1068 Ga0500627_0117127
1069 Ga0500634_0120028
1070 Ga0500638_000259
1071 Ga0500638_065247
1072 Ga0500636_0002272
1073 Ga0500637_0001727
1074 Ga0500637_0011620
1075 Ga0500645_011768
1076 Ga0500601_002924
1077 Ga0466962_0061795
1078 Ga0466962_0077129
1079 2513655034
1080 2513677804
1081 2513697443
1082 2513861050
1083 2513915943
1084 2515625428
1085 2517894752
1086 2524464083
1087 2603862607
1088 2671119166
1089 2723843064
1090 2793071227
1091 2793079527
1092 2841943198
1093 2841976629
1094 2857529952
1095 2874612604
1096 2876812881
1097 2879118043
1098 2885378774
1099 2885384498
1100 2885413423
1101 2889033634
1102 2893069404
1103 2903751434
1104 2903773634
1105 2904697735
1106 2904705885
1107 2906611472
1108 2906641691
1109 2906660793
1110 2908745064
1111 2908757168
1112 2919077194
1113 2922367000
1114 2922390217
1115 2922427885
1116 2935632187
1117 2935962036
1118 2941508135
1119 2941515360
1120 2941524065
1121 3005477595
1122 3005507116
1123 8006933624
1124 8006966536
1125 8006989365
1126 8006997848
1127 8019559567
1128 8019569667
1129 8056674882
1130 8056682374

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

66

369

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.8992 6 303
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.8932 6 303
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.8905 13 304
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.8694 13 304
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.853 6 301
ID Description Score Start End Superfamily
af_F7F172_184_294_1.10.150.170 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9254 120 208 1.10.150.170
af_K7MMS9_87_190_1.10.150.170 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9106 120 210 1.10.150.170
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9072 6 303 3.40.50.150
af_F7F172_79_179_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9049 15 102 3.40.50.150
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8974 6 303 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A382S8E5-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9477 205 302 GO:0070475
GO:0071424
AF-A0A847JHT4-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199) 0.9353 1 105 GO:0005737
GO:0070475
GO:0071424
AF-A0A176Z2R9-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9345 1 325 GO:0005737
GO:0070475
GO:0071424
AF-A0A176Z2R9-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9317 1 325 GO:0005737
GO:0070475
GO:0071424
AF-A0A346A2Y3-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9292 1 325 GO:0005737
GO:0070475
GO:0071424

Map