F464263

General Info

Members Datasets Scaffolds Average Seq Length
565 254 1130 280

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10039728|Ga0157372_100397285
Length 318
Sequence MVNIGSKIFLYIANFLLTKVQGILVDSSPVILFGDIILVTSKRINSFFMDQRIINLYDEYTHKPLTRKDFFHRLTLLTGSSAAAMTVLPLLEVNHSKAVITDQEDLFTEHITYPGSKTEMQAYVARPKEEKKYAAVVVIHENRGLNPHIEDVTRRAAKAGYLAIAPNALSPLGGTPPNEDDARAKFQQLDAAETLQNFIKVFDYLPTRKDCNGKWGCVGFCWGGGMSNDLAVNVPSIKAAVAFYGRQPAHYAGLDERIDAGIPAYEEALKKAGVTYEMYMYDGVNHAFHNDTAPTRYNEAAAKLAWQRTLEFFGKYLK

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
178 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
201 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
216 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
217 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
218 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
219 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
222 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
223 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
224 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
225 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
231 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
232 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
233 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
234 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 2738541278 Niastella sp. CF465 Isolate Unclassified
252 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
253 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
254 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 1.42
Rhizosphere 89.56
Stem 0
Stem Tuber 0
Unclassified 14.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10039728 3300013307 Bacteria 5194
2 JGI24739J22299_10000159 3300001989 Bacteria 21947
3 JGI24744J21845_10013098 3300002077 Bacteria 1675
4 JGI24751J29686_10000936 3300002459 Bacteria 6506
5 rootH2_10000765 3300003320 Bacteria 17073
6 rootH2_10239466 3300003320 Unclassified 4885
7 rootL2_10001671 3300003322 Bacteria 1909
8 rootL2_10056687 3300003322 Bacteria 2709
9 rootL2_10226502 3300003322 Bacteria 2266
10 rootH1_10000182 3300003323 Bacteria 80743
11 rootH1_10012210 3300003323 Bacteria 61025
12 rootH1_10022147 3300003323 Bacteria 28450
13 rootH1_10223359 3300003323 Bacteria 10891
14 JGI25160J50197_1001166 3300003354 Bacteria 13403
15 Ga0055526_1012431 3300003771 Bacteria 3715
16 Ga0055526_1021069 3300003771 Bacteria 2285
17 Ga0055528_1000386 3300003790 Bacteria 35904
18 Ga0055530_10000288 3300003791 Bacteria 45971
19 Ga0055543_1023274 3300004625 Bacteria 1119
20 Ga0065165_1000128 3300005262 Bacteria 129513
21 Ga0065714_10136230 3300005288 Unclassified 1207
22 Ga0065704_10143114 3300005289 Bacteria 1498
23 Ga0065704_10181513 3300005289 Bacteria 1235
24 Ga0065712_10005930 3300005290 Bacteria 2893
25 Ga0065712_10029848 3300005290 Bacteria 1308
26 Ga0065712_10091269 3300005290 Bacteria 2381
27 Ga0065715_10006774 3300005293 Bacteria 5012
28 Ga0065707_10163385 3300005295 Bacteria 1543
29 Ga0070676_10022242 3300005328 Bacteria 3555
30 Ga0070676_10027899 3300005328 Bacteria 3205
31 Ga0070683_100004517 3300005329 Bacteria 11484
32 Ga0070683_100005266 3300005329 Bacteria 10769
33 Ga0070683_100061124 3300005329 Bacteria 3502
34 Ga0070683_100540581 3300005329 Bacteria 1114
35 Ga0070690_100002669 3300005330 Bacteria 9615
36 Ga0070670_100021078 3300005331 Bacteria 5605
37 Ga0070670_100032461 3300005331 Unclassified 4497
38 Ga0070670_100071052 3300005331 Bacteria 2988
39 Ga0070670_100109034 3300005331 Unclassified 2386
40 Ga0070670_100169445 3300005331 Bacteria 1894
41 Ga0070670_100273902 3300005331 Unclassified 1473
42 Ga0070677_10064205 3300005333 Unclassified 1524
43 Ga0068869_100003315 3300005334 Bacteria 9838
44 Ga0068869_100012995 3300005334 Bacteria 5523
45 Ga0068869_100073250 3300005334 Unclassified 2539
46 Ga0068869_100367830 3300005334 Unclassified 1176
47 Ga0070682_100000071 3300005337 Bacteria 94177
48 Ga0070682_100014036 3300005337 Bacteria 4623
49 Ga0068868_100050751 3300005338 Bacteria 3259
50 Ga0068868_100226283 3300005338 Bacteria 1567
51 Ga0070689_100039954 3300005340 Bacteria 3595
52 Ga0070689_100050116 3300005340 Bacteria 3225
53 Ga0070689_100119277 3300005340 Bacteria 2106
54 Ga0070689_100147074 3300005340 Bacteria 1898
55 Ga0070689_100341301 3300005340 Bacteria 1254
56 Ga0070689_100359812 3300005340 Bacteria 1222
57 Ga0070687_100012664 3300005343 Bacteria 3731
58 Ga0070687_100034606 3300005343 Bacteria 2502
59 Ga0070687_100210338 3300005343 Bacteria 1184
60 Ga0070661_100001842 3300005344 Bacteria 14679
61 Ga0070661_100055124 3300005344 Bacteria 2911
62 Ga0070661_100095277 3300005344 Bacteria 2207
63 Ga0070661_100166552 3300005344 Bacteria 1672
64 Ga0070668_100013579 3300005347 Bacteria 6081
65 Ga0070668_100023447 3300005347 Bacteria 4668
66 Ga0070668_100075376 3300005347 Bacteria 2634
67 Ga0070668_100485840 3300005347 Unclassified 1067
68 Ga0070669_100004598 3300005353 Bacteria 9963
69 Ga0070669_100006248 3300005353 Bacteria 8599
70 Ga0070669_100016206 3300005353 Bacteria 5316
71 Ga0070669_100107375 3300005353 Bacteria 2114
72 Ga0070675_100057949 3300005354 Unclassified 3194
73 Ga0070675_100060652 3300005354 Bacteria 3123
74 Ga0070675_100067164 3300005354 Bacteria 2967
75 Ga0070675_100090576 3300005354 Unclassified 2562
76 Ga0070675_100198177 3300005354 Bacteria 1742
77 Ga0070675_100346560 3300005354 Bacteria 1317
78 Ga0070675_100391277 3300005354 Bacteria 1239
79 Ga0070671_100028095 3300005355 Bacteria 4632
80 Ga0070671_100031511 3300005355 Bacteria 4380
81 Ga0070671_100421795 3300005355 Unclassified 1143
82 Ga0070674_100079579 3300005356 Bacteria 2338
83 Ga0070674_100088227 3300005356 Bacteria 2232
84 Ga0070674_100619902 3300005356 Bacteria 916
85 Ga0070673_100006447 3300005364 Bacteria 7626
86 Ga0070673_100035453 3300005364 Bacteria 3783
87 Ga0070673_100088019 3300005364 Bacteria 2532
88 Ga0070688_100006235 3300005365 Bacteria 6353
89 Ga0070688_100008980 3300005365 Bacteria 5446
90 Ga0070688_100058533 3300005365 Bacteria 2426
91 Ga0070688_100067000 3300005365 Bacteria 2286
92 Ga0070659_100001036 3300005366 Bacteria 20329
93 Ga0070667_100007255 3300005367 Bacteria 9210
94 Ga0070667_100018176 3300005367 Bacteria 5829
95 Ga0070667_100065043 3300005367 Bacteria 3096
96 Ga0070701_10081610 3300005438 Unclassified 1752
97 Ga0070700_100159277 3300005441 Unclassified 1552
98 Ga0070694_100312488 3300005444 Unclassified 1207
99 Ga0070663_100064497 3300005455 Bacteria 2647
100 Ga0070678_100000605 3300005456 Bacteria 17659
101 Ga0070678_100004247 3300005456 Bacteria 8097
102 Ga0070678_100025666 3300005456 Bacteria 3970
103 Ga0070662_100001598 3300005457 Bacteria 13989
104 Ga0070662_100035436 3300005457 Bacteria 3524
105 Ga0070662_100048197 3300005457 Bacteria 3069
106 Ga0068867_100002197 3300005459 Bacteria 13683
107 Ga0068867_100044771 3300005459 Bacteria 3243
108 Ga0068867_100138934 3300005459 Bacteria 1897
109 Ga0068867_100403858 3300005459 Bacteria 1153
110 Ga0070685_10023053 3300005466 Bacteria 3404
111 Ga0070685_10036827 3300005466 Bacteria 2767
112 Ga0070685_10069038 3300005466 Bacteria 2089
113 Ga0070698_100004820 3300005471 Bacteria 14803
114 Ga0070698_100011741 3300005471 Bacteria 9291
115 Ga0070698_100047989 3300005471 Bacteria 4364
116 Ga0070699_100172788 3300005518 Bacteria 1915
117 Ga0070679_100457867 3300005530 Bacteria 1220
118 Ga0070684_100000751 3300005535 Bacteria 22449
119 Ga0070684_100023672 3300005535 Bacteria 5141
120 Ga0070684_100027594 3300005535 Bacteria 4794
121 Ga0068853_100000824 3300005539 Bacteria 21660
122 Ga0068853_100443448 3300005539 Bacteria 1220
123 Ga0070672_100037484 3300005543 Bacteria 3699
124 Ga0070672_100050030 3300005543 Bacteria 3254
125 Ga0070672_100075795 3300005543 Unclassified 2686
126 Ga0070672_100341250 3300005543 Unclassified 1276
127 Ga0070686_100008083 3300005544 Bacteria 5877
128 Ga0070686_100160100 3300005544 Bacteria 1585
129 Ga0068855_100003486 3300005563 Bacteria 19264
130 Ga0070664_100000795 3300005564 Bacteria 24308
131 Ga0070664_100003189 3300005564 Bacteria 13252
132 Ga0070664_100049953 3300005564 Bacteria 3538
133 Ga0070664_100056929 3300005564 Bacteria 3322
134 Ga0070664_100090318 3300005564 Bacteria 2651
135 Ga0070664_100263360 3300005564 Bacteria 1551
136 Ga0070664_100310782 3300005564 Bacteria 1426
137 Ga0070664_100315694 3300005564 Unclassified 1415
138 Ga0070664_100623281 3300005564 Bacteria 1001
139 Ga0068857_100000427 3300005577 Bacteria 29758
140 Ga0068857_100016335 3300005577 Bacteria 6504
141 Ga0068857_100123490 3300005577 Unclassified 2332
142 Ga0068857_100349571 3300005577 Bacteria 1369
143 Ga0068854_100042619 3300005578 Bacteria 3213
144 Ga0068856_100023291 3300005614 Bacteria 6022
145 Ga0070702_100105147 3300005615 Bacteria 1739
146 Ga0070702_100246088 3300005615 Bacteria 1209
147 Ga0068859_100008036 3300005617 Bacteria 10695
148 Ga0068859_100011172 3300005617 Bacteria 9029
149 Ga0068859_100013292 3300005617 Bacteria 8260
150 Ga0068859_100067711 3300005617 Bacteria 3605
151 Ga0068859_100140661 3300005617 Bacteria 2487
152 Ga0068859_100295014 3300005617 Bacteria 1714
153 Ga0068864_100002506 3300005618 Bacteria 15183
154 Ga0068864_100035708 3300005618 Bacteria 4233
155 Ga0068864_100035901 3300005618 Bacteria 4221
156 Ga0068864_100045359 3300005618 Bacteria 3771
157 Ga0068864_100092269 3300005618 Bacteria 2673
158 Ga0068864_100173872 3300005618 Bacteria 1965
159 Ga0068864_100190829 3300005618 Bacteria 1878
160 Ga0068864_100208300 3300005618 Bacteria 1799
161 Ga0068866_10002055 3300005718 Bacteria 8375
162 Ga0068861_100001969 3300005719 Bacteria 13238
163 Ga0068861_100003918 3300005719 Bacteria 9949
164 Ga0068861_100296089 3300005719 Bacteria 1399
165 Ga0068851_10040997 3300005834 Unclassified 2328
166 Ga0068851_10054649 3300005834 Bacteria 2034
167 Ga0068870_10022457 3300005840 Bacteria 3100
168 Ga0068863_100052396 3300005841 Bacteria 3868
169 Ga0068863_100086953 3300005841 Bacteria 2962
170 Ga0068863_100293834 3300005841 Bacteria 1575
171 Ga0068858_100211258 3300005842 Bacteria 1836
172 Ga0068860_100009767 3300005843 Bacteria 9528
173 Ga0068860_100014617 3300005843 Bacteria 7682
174 Ga0068860_100122392 3300005843 Bacteria 2492
175 Ga0068862_100038932 3300005844 Bacteria 4036
176 Ga0081539_10000037 3300005985 Bacteria 296160
177 Ga0075366_10083788 3300006195 Bacteria 1906
178 Ga0075366_10096144 3300006195 Bacteria 1776
179 Ga0097621_100000018 3300006237 Bacteria 88867
180 Ga0097621_100004248 3300006237 Bacteria 9955
181 Ga0097621_100033777 3300006237 Bacteria 4076
182 Ga0097621_100067523 3300006237 Bacteria 2947
183 Ga0097621_100124037 3300006237 Bacteria 2193
184 Ga0097621_100582184 3300006237 Bacteria 1021
185 Ga0068871_100000275 3300006358 Bacteria 35449
186 Ga0068871_100007679 3300006358 Bacteria 7714
187 Ga0068871_100027759 3300006358 Bacteria 4430
188 Ga0068871_100214188 3300006358 Unclassified 1667
189 Ga0075428_100055539 3300006844 Bacteria 4338
190 Ga0075428_100162262 3300006844 Unclassified 2425
191 Ga0075428_100185116 3300006844 Unclassified 2253
192 Ga0075428_100200864 3300006844 Unclassified 2155
193 Ga0075428_100250948 3300006844 Unclassified 1907
194 Ga0075430_100028152 3300006846 Bacteria 4774
195 Ga0075430_100060426 3300006846 Unclassified 3185
196 Ga0075431_100349547 3300006847 Unclassified 1486
197 Ga0075429_100014661 3300006880 Bacteria 6796
198 Ga0075429_100048668 3300006880 Unclassified 3686
199 Ga0068865_100016855 3300006881 Bacteria 4686
200 Ga0068865_100037263 3300006881 Bacteria 3282
201 Ga0068865_100053649 3300006881 Bacteria 2798
202 Ga0097620_100008036 3300006931 Bacteria 10695
203 Ga0097620_100011171 3300006931 Bacteria 9029
204 Ga0097620_100013292 3300006931 Bacteria 8260
205 Ga0097620_100067715 3300006931 Bacteria 3605
206 Ga0097620_100140672 3300006931 Bacteria 2487
207 Ga0097620_100295015 3300006931 Bacteria 1714
208 Ga0105240_10205259 3300009093 Bacteria 2307
209 Ga0111539_10007214 3300009094 Bacteria 14247
210 Ga0105247_10060412 3300009101 Bacteria 2349
211 Ga0105247_10172069 3300009101 Bacteria 1440
212 Ga0105241_10041140 3300009174 Bacteria 3491
213 Ga0105241_10113448 3300009174 Bacteria 2173
214 Ga0105242_10018943 3300009176 Bacteria 5390
215 Ga0105242_10020429 3300009176 Bacteria 5194
216 Ga0105237_10218912 3300009545 Bacteria 1904
217 Ga0105249_10016454 3300009553 Bacteria 6563
218 Ga0105249_10017633 3300009553 Bacteria 6340
219 Ga0105249_10027713 3300009553 Bacteria 5112
220 Ga0105249_10084961 3300009553 Bacteria 2948
221 Ga0105249_10133806 3300009553 Unclassified 2370
222 Ga0105249_10199080 3300009553 Bacteria 1959
223 Ga0105239_10358987 3300010375 Unclassified 1645
224 Ga0105246_10035012 3300011119 Bacteria 3352
225 Ga0105246_10063280 3300011119 Bacteria 2580
226 Ga0157373_10020309 3300013100 Bacteria 4830
227 Ga0157371_10027496 3300013102 Unclassified 4126
228 Ga0157371_10036290 3300013102 Bacteria 3530
229 Ga0157374_10006447 3300013296 Bacteria 9963
230 Ga0157374_10090983 3300013296 Bacteria 2909
231 Ga0157374_10291522 3300013296 Bacteria 1613
232 Ga0157374_10305013 3300013296 Bacteria 1576
233 Ga0157374_10651703 3300013296 Bacteria 1065
234 Ga0157378_10050289 3300013297 Bacteria 3709
235 Ga0157378_10780075 3300013297 Bacteria 980
236 Ga0163162_10000773 3300013306 Bacteria 29793
237 Ga0163162_10026074 3300013306 Bacteria 5777
238 Ga0163162_10044947 3300013306 Bacteria 4424
239 Ga0163162_10046870 3300013306 Bacteria 4333
240 Ga0163162_10065340 3300013306 Bacteria 3685
241 Ga0163162_10182982 3300013306 Bacteria 2222
242 Ga0163162_10200216 3300013306 Bacteria 2126
243 Ga0157372_10024136 3300013307 Bacteria 6600
244 Ga0157372_10107483 3300013307 Unclassified 3192
245 Ga0157372_11085852 3300013307 Bacteria 926
246 Ga0157375_10004547 3300013308 Bacteria 12053
247 Ga0157375_10015493 3300013308 Bacteria 6825
248 Ga0157375_10027205 3300013308 Bacteria 5343
249 Ga0157375_10034613 3300013308 Bacteria 4813
250 Ga0157375_10043634 3300013308 Bacteria 4350
251 Ga0157375_10098616 3300013308 Bacteria 2999
252 Ga0163163_10004390 3300014325 Bacteria 12017
253 Ga0163163_10008393 3300014325 Bacteria 9173
254 Ga0163163_10013527 3300014325 Bacteria 7478
255 Ga0163163_10017383 3300014325 Bacteria 6706
256 Ga0163163_10260562 3300014325 Bacteria 1785
257 Ga0157380_10001574 3300014326 Bacteria 15001
258 Ga0157380_10030785 3300014326 Bacteria 4112
259 Ga0157380_10181235 3300014326 Unclassified 1851
260 Ga0157380_10245730 3300014326 Bacteria 1616
261 Ga0157380_10273561 3300014326 Bacteria 1541
262 Ga0157377_10006393 3300014745 Bacteria 5616
263 Ga0157379_10036805 3300014968 Bacteria 4363
264 Ga0157379_10120109 3300014968 Bacteria 2364
265 Ga0157379_10147483 3300014968 Bacteria 2122
266 Ga0157376_10000076 3300014969 Bacteria 75313
267 Ga0157376_10031239 3300014969 Bacteria 4262
268 Ga0157376_10150062 3300014969 Bacteria 2101
269 Ga0157376_10260921 3300014969 Bacteria 1623
270 Ga0163161_10004225 3300017792 Bacteria 10024
271 Ga0163161_10056431 3300017792 Bacteria 2852
272 Ga0163161_10183401 3300017792 Bacteria 1606
273 Ga0163161_10538263 3300017792 Unclassified 956
274 Ga0209673_1000085 3300025273 Bacteria 215647
275 Ga0209564_1004980 3300025295 Bacteria 7825
276 Ga0209564_1051159 3300025295 Bacteria 1005
277 Ga0209758_1007701 3300025297 Bacteria 7236
278 Ga0209758_1008347 3300025297 Bacteria 6738
279 Ga0209050_1000524 3300025298 Bacteria 63793
280 Ga0209050_1025451 3300025298 Bacteria 2010
281 Ga0207426_1001174 3300025302 Bacteria 23427
282 Ga0209257_1001638 3300025304 Bacteria 25639
283 Ga0207697_10163801 3300025315 Unclassified 971
284 Ga0207682_10027154 3300025893 Bacteria 2278
285 Ga0207688_10101964 3300025901 Bacteria 1658
286 Ga0207680_10093424 3300025903 Bacteria 1919
287 Ga0207647_10022491 3300025904 Bacteria 4185
288 Ga0207645_10000571 3300025907 Bacteria 30525
289 Ga0207645_10017668 3300025907 Bacteria 4703
290 Ga0207645_10062396 3300025907 Bacteria 2381
291 Ga0207643_10002295 3300025908 Bacteria 10408
292 Ga0207643_10024798 3300025908 Bacteria 3310
293 Ga0207695_10450956 3300025913 Unclassified 1169
294 Ga0207660_10085782 3300025917 Bacteria 2323
295 Ga0207662_10024771 3300025918 Unclassified 3454
296 Ga0207662_10028786 3300025918 Bacteria 3214
297 Ga0207662_10044295 3300025918 Bacteria 2627
298 Ga0207657_10089554 3300025919 Bacteria 2570
299 Ga0207649_10000985 3300025920 Bacteria 17629
300 Ga0207649_10008325 3300025920 Bacteria 5652
301 Ga0207649_10031430 3300025920 Bacteria 3155
302 Ga0207649_10148435 3300025920 Bacteria 1612
303 Ga0207652_10457929 3300025921 Unclassified 1150
304 Ga0207681_10005990 3300025923 Bacteria 7457
305 Ga0207681_10041752 3300025923 Bacteria 3060
306 Ga0207681_10053369 3300025923 Bacteria 2744
307 Ga0207681_10083174 3300025923 Bacteria 2265
308 Ga0207681_10132417 3300025923 Unclassified 1845
309 Ga0207681_10336371 3300025923 Bacteria 1205
310 Ga0207650_10001737 3300025925 Bacteria 15479
311 Ga0207650_10101248 3300025925 Bacteria 2218
312 Ga0207650_10149351 3300025925 Bacteria 1843
313 Ga0207650_10151343 3300025925 Unclassified 1831
314 Ga0207650_10562466 3300025925 Bacteria 957
315 Ga0207659_10016941 3300025926 Bacteria 4753
316 Ga0207659_10041876 3300025926 Bacteria 3209
317 Ga0207659_10053756 3300025926 Unclassified 2873
318 Ga0207659_10249544 3300025926 Bacteria 1439
319 Ga0207659_10386894 3300025926 Bacteria 1167
320 Ga0207644_10012160 3300025931 Bacteria 5712
321 Ga0207644_10192806 3300025931 Bacteria 1603
322 Ga0207644_10404836 3300025931 Bacteria 1116
323 Ga0207706_10001247 3300025933 Bacteria 25629
324 Ga0207706_10012699 3300025933 Bacteria 7668
325 Ga0207706_10012901 3300025933 Bacteria 7605
326 Ga0207706_10042849 3300025933 Bacteria 4011
327 Ga0207686_10002769 3300025934 Bacteria 9490
328 Ga0207686_10070861 3300025934 Bacteria 2241
329 Ga0207686_10443346 3300025934 Unclassified 997
330 Ga0207670_10002792 3300025936 Bacteria 9205
331 Ga0207670_10056846 3300025936 Bacteria 2651
332 Ga0207670_10067090 3300025936 Bacteria 2467
333 Ga0207670_10121721 3300025936 Bacteria 1898
334 Ga0207670_10159010 3300025936 Bacteria 1685
335 Ga0207670_10349458 3300025936 Bacteria 1170
336 Ga0207669_10019880 3300025937 Unclassified 3507
337 Ga0207669_10384677 3300025937 Bacteria 1094
338 Ga0207704_10033534 3300025938 Bacteria 2921
339 Ga0207704_10042422 3300025938 Bacteria 2678
340 Ga0207691_10005639 3300025940 Bacteria 12104
341 Ga0207691_10018871 3300025940 Bacteria 6532
342 Ga0207691_10034746 3300025940 Bacteria 4685
343 Ga0207691_10075396 3300025940 Bacteria 3041
344 Ga0207691_10100987 3300025940 Unclassified 2574
345 Ga0207691_10428951 3300025940 Unclassified 1126
346 Ga0207689_10000939 3300025942 Bacteria 28012
347 Ga0207689_10001600 3300025942 Bacteria 21433
348 Ga0207689_10003568 3300025942 Bacteria 14223
349 Ga0207689_10128718 3300025942 Bacteria 2083
350 Ga0207689_10346706 3300025942 Unclassified 1234
351 Ga0207689_10610910 3300025942 Unclassified 918
352 Ga0207661_10002365 3300025944 Bacteria 12980
353 Ga0207661_10003998 3300025944 Bacteria 10303
354 Ga0207661_10119435 3300025944 Bacteria 2242
355 Ga0207661_10674800 3300025944 Bacteria 950
356 Ga0207679_10000247 3300025945 Bacteria 41238
357 Ga0207679_10170757 3300025945 Bacteria 1790
358 Ga0207667_10031638 3300025949 Bacteria 5710
359 Ga0207651_10042189 3300025960 Bacteria 3034
360 Ga0207651_10320709 3300025960 Bacteria 1295
361 Ga0207651_10401310 3300025960 Bacteria 1166
362 Ga0207712_10000887 3300025961 Bacteria 21720
363 Ga0207712_10002875 3300025961 Bacteria 11006
364 Ga0207712_10008393 3300025961 Bacteria 6525
365 Ga0207712_10011042 3300025961 Bacteria 5749
366 Ga0207712_10014283 3300025961 Bacteria 5104
367 Ga0207712_10109980 3300025961 Bacteria 2065
368 Ga0207712_10307790 3300025961 Bacteria 1303
369 Ga0207712_10327451 3300025961 Unclassified 1266
370 Ga0207712_10407122 3300025961 Bacteria 1145
371 Ga0207668_10051778 3300025972 Bacteria 2838
372 Ga0207668_10363957 3300025972 Bacteria 1213
373 Ga0207658_10040251 3300025986 Bacteria 3377
374 Ga0207658_10082502 3300025986 Unclassified 2469
375 Ga0207658_10117114 3300025986 Bacteria 2117
376 Ga0207677_10064505 3300026023 Bacteria 2551
377 Ga0207677_10196638 3300026023 Bacteria 1599
378 Ga0207703_10058692 3300026035 Bacteria 3141
379 Ga0207703_10061757 3300026035 Bacteria 3068
380 Ga0207703_10073135 3300026035 Bacteria 2835
381 Ga0207703_10141214 3300026035 Unclassified 2090
382 Ga0207639_10012793 3300026041 Bacteria 5855
383 Ga0207639_10054427 3300026041 Bacteria 3058
384 Ga0207639_10599955 3300026041 Unclassified 1015
385 Ga0207708_10022687 3300026075 Bacteria 4739
386 Ga0207708_10236295 3300026075 Unclassified 1469
387 Ga0207702_10099997 3300026078 Bacteria 2558
388 Ga0207641_10005107 3300026088 Bacteria 11244
389 Ga0207641_10051999 3300026088 Bacteria 3469
390 Ga0207641_10114023 3300026088 Bacteria 2401
391 Ga0207641_10121325 3300026088 Bacteria 2333
392 Ga0207641_10184932 3300026088 Bacteria 1911
393 Ga0207641_10335083 3300026088 Bacteria 1438
394 Ga0207641_10336970 3300026088 Bacteria 1434
395 Ga0207648_10001686 3300026089 Bacteria 24217
396 Ga0207648_10002203 3300026089 Bacteria 21158
397 Ga0207648_10010609 3300026089 Bacteria 8712
398 Ga0207648_10041009 3300026089 Bacteria 4066
399 Ga0207648_10163840 3300026089 Bacteria 1964
400 Ga0207676_10019937 3300026095 Bacteria 4898
401 Ga0207676_10052901 3300026095 Bacteria 3176
402 Ga0207676_10075263 3300026095 Bacteria 2723
403 Ga0207676_10109062 3300026095 Bacteria 2312
404 Ga0207676_10161056 3300026095 Bacteria 1944
405 Ga0207676_10323276 3300026095 Bacteria 1417
406 Ga0207676_10395144 3300026095 Unclassified 1291
407 Ga0207674_10001291 3300026116 Bacteria 32707
408 Ga0207674_10037377 3300026116 Bacteria 5050
409 Ga0207674_10078664 3300026116 Unclassified 3303
410 Ga0207674_10206749 3300026116 Bacteria 1912
411 Ga0207674_10237701 3300026116 Bacteria 1769
412 Ga0207674_10474769 3300026116 Bacteria 1209
413 Ga0207675_100001768 3300026118 Bacteria 21608
414 Ga0207675_100002694 3300026118 Bacteria 17524
415 Ga0207675_100028220 3300026118 Bacteria 5226
416 Ga0207675_100051469 3300026118 Bacteria 3843
417 Ga0207675_100404841 3300026118 Bacteria 1345
418 Ga0207683_10000535 3300026121 Bacteria 35178
419 Ga0207683_10006885 3300026121 Bacteria 9735
420 Ga0207683_10037194 3300026121 Archaea 4238
421 Ga0207683_10038549 3300026121 Bacteria 4166
422 Ga0207683_10500791 3300026121 Bacteria 1122
423 Ga0207698_10101800 3300026142 Bacteria 2383
424 Ga0207698_10112024 3300026142 Bacteria 2289
425 Ga0207698_10412991 3300026142 Bacteria 1293
426 Ga0207428_10011923 3300027907 Bacteria 7652
427 Ga0268266_10177075 3300028379 Bacteria 1939
428 Ga0268265_10071601 3300028380 Bacteria 2701
429 Ga0268264_10013896 3300028381 Bacteria 6618
430 Ga0268264_10019426 3300028381 Bacteria 5553
431 Ga0268264_10185356 3300028381 Bacteria 1893
432 Ga0265327_10080292 3300031251 Bacteria 1613
433 Ga0307513_10254384 3300031456 Bacteria 1550
434 Ga0307509_10078756 3300031507 Bacteria 3413
435 Ga0307509_10225167 3300031507 Bacteria 1683
436 Ga0307509_10345974 3300031507 Unclassified 1212
437 Ga0307408_100000652 3300031548 Bacteria 29132
438 Ga0307408_100058808 3300031548 Bacteria 2796
439 Ga0307408_100089415 3300031548 Bacteria 2321
440 Ga0307508_10008362 3300031616 Bacteria 9562
441 Ga0307413_10100519 3300031824 Bacteria 1910
442 Ga0307518_10118916 3300031838 Unclassified 1873
443 Ga0307410_10225135 3300031852 Unclassified 1445
444 Ga0307406_10180253 3300031901 Bacteria 1537
445 Ga0307407_10025387 3300031903 Bacteria 3122
446 Ga0307407_10170510 3300031903 Bacteria 1433
447 Ga0307412_10007233 3300031911 Bacteria 6297
448 Ga0307412_10149345 3300031911 Bacteria 1722
449 Ga0307416_100000322 3300032002 Bacteria 24686
450 Ga0307416_100140303 3300032002 Bacteria 2195
451 Ga0307414_10040137 3300032004 Bacteria 3159
452 Ga0307415_100002700 3300032126 Bacteria 8864
453 Ga0373924_0007396 3300035410 Unclassified 3965
454 Ga0373927_0145496 3300035695 Bacteria 1551
455 Ga0373933_0083426 3300035724 Unclassified 1963
456 Ga0395905_0046088 3300037471 Unclassified 4088
457 Ga0395905_0411868 3300037471 Unclassified 1247
458 Ga0436365_0181133 3300039437 Unclassified 1121
459 Ga0436365_1052711 3300039437 Bacteria 25242
460 Ga0439439_0087531 3300041406 Unclassified 848
461 Ga0451797_1404866 3300041453 Unclassified 773
462 Ga0439441_001764 3300042001 Unclassified 2916
463 Ga0439441_006465 3300042001 Bacteria 1861
464 Ga0439445_0021053 3300042004 Bacteria 1636
465 Ga0439457_013802 3300042014 Bacteria 1813
466 Ga0450896_011539 3300042133 Bacteria 1245
467 Ga0439434_0002558 3300042435 Bacteria 5296
468 Ga0451577_0004985 3300042876 Bacteria 13768
469 Ga0451577_0537743 3300042876 Bacteria 1061
470 Ga0466961_0113119 3300044693 Bacteria 1707
471 Ga0453684_0107388 3300044712 Unclassified 3399
472 Ga0466957_0000578 3300044842 Bacteria 18516
473 Ga0495638_0062044 3300046460 Unclassified 2308
474 Ga0495582_0203572 3300046473 Bacteria 1131
475 Ga0495630_0184083 3300046517 Bacteria 1593
476 Ga0495668_0003813 3300046616 Bacteria 11034
477 Ga0495625_0439960 3300046660 Bacteria 807
478 Ga0495599_0349178 3300046678 Unclassified 887
479 Ga0495672_0007236 3300047320 Bacteria 8375
480 Ga0495672_0063816 3300047320 Bacteria 2112
481 Ga0495680_0118674 3300047322 Bacteria 1955
482 Ga0495686_0063214 3300047472 Bacteria 2294
483 Ga0495686_0188938 3300047472 Bacteria 1188
484 Ga0496100_0129365 3300048903 Bacteria 1776
485 Ga0496101_0384857 3300048904 Unclassified 1104
486 Ga0496104_0297356 3300048907 Bacteria 1527
487 Ga0496105_0347111 3300048908 Bacteria 1186
488 Ga0496106_0518835 3300048909 Unclassified 957
489 Ga0496110_0125425 3300048913 Bacteria 2316
490 Ga0496114_0054321 3300048917 Bacteria 3340
491 Ga0501298_000444 3300049521 Bacteria 5567
492 Ga0501300_001207 3300049523 Bacteria 3924
493 Ga0501032_0010733 3300049569 Bacteria 6594
494 Ga0501034_0008758 3300049571 Bacteria 10650
495 Ga0501034_0017551 3300049571 Bacteria 7339
496 Ga0501034_0170160 3300049571 Bacteria 2146
497 Ga0501036_0012212 3300049572 Bacteria 7116
498 Ga0501037_0017158 3300049573 Bacteria 5328
499 Ga0501037_0056114 3300049573 Unclassified 2878
500 Ga0501038_0300146 3300049574 Bacteria 1261
501 Ga0501039_0078269 3300049575 Unclassified 2572
502 Ga0501039_0115088 3300049575 Bacteria 2104
503 Ga0501043_0049149 3300049579 Unclassified 3315
504 Ga0501043_0059268 3300049579 Unclassified 3004
505 Ga0501043_0069112 3300049579 Bacteria 2774
506 Ga0501043_0173993 3300049579 Bacteria 1679
507 Ga0501046_0070859 3300049580 Unclassified 2709
508 Ga0501047_0009459 3300049581 Bacteria 9207
509 Ga0501047_0054864 3300049581 Bacteria 3854
510 Ga0501047_0163006 3300049581 Unclassified 2101
511 Ga0501067_0041303 3300049583 Bacteria 2561
512 Ga0501073_0018578 3300049589 Bacteria 5026
513 Ga0501073_0103769 3300049589 Unclassified 1974
514 Ga0501074_0100038 3300049590 Unclassified 2075
515 Ga0501077_0205578 3300049593 Bacteria 1251
516 Ga0501198_000560 3300049649 Bacteria 4648
517 Ga0501201_000453 3300049651 Bacteria 3780
518 Ga0501216_022785 3300049660 Bacteria 1109
519 Ga0501217_006451 3300049661 Unclassified 2493
520 Ga0501223_005125 3300049663 Bacteria 2769
521 Ga0501235_000507 3300049669 Bacteria 7781
522 Ga0501235_034810 3300049669 Bacteria 1143
523 Ga0501243_000292 3300049675 Bacteria 6458
524 Ga0501252_001749 3300049682 Bacteria 2066
525 Ga0501257_002778 3300049686 Bacteria 3703
526 Ga0501259_000215 3300049688 Bacteria 8882
527 Ga0501261_001529 3300049690 Bacteria 2846
528 Ga0501225_0001574 3300049705 Bacteria 7148
529 Ga0501225_0015013 3300049705 Bacteria 2161
530 Ga0501245_001570 3300049708 Bacteria 2976
531 Ga0501079_0136462 3300049741 Unclassified 1910
532 Ga0501083_0003657 3300049744 Bacteria 10792
533 Ga0501232_006801 3300049757 Bacteria 1187
534 Ga0501266_005536 3300049763 Bacteria 1570
535 Ga0501268_003890 3300049765 Bacteria 2075
536 Ga0501270_003227 3300049767 Bacteria 1742
537 Ga0501282_001927 3300049778 Bacteria 2286
538 Ga0501035_0002820 3300049822 Bacteria 16814
539 Ga0501035_0083619 3300049822 Bacteria 2816
540 Ga0501044_0002309 3300049823 Bacteria 21726
541 Ga0501044_0024007 3300049823 Bacteria 6478
542 Ga0501044_0459462 3300049823 Bacteria 1179
543 nmdc:mga0k408_29803_c1 3300050493 Bacteria 3108
544 nmdc:mga09592_260536_c1 3300050508 Unclassified 1504
545 nmdc:mga0qj67_30076_c1 3300050509 Bacteria 4224
546 nmdc:mga06r32_271578_c1 3300050510 Unclassified 1683
547 nmdc:mga08y16_14118_c1 3300050511 Bacteria 8409
548 Ga0495619_0141674 3300053085 Unclassified 1656
549 Ga0500583_0000546 3300053092 Bacteria 11466
550 Ga0500641_0023563 3300053096 Bacteria 2368
551 Ga0500658_0071219 3300053134 Bacteria 1468
552 Ga0500604_0020591 3300053151 Bacteria 1858
553 Ga0500616_0016137 3300053153 Bacteria 4259
554 Ga0500616_0017408 3300053153 Bacteria 4077
555 Ga0500616_0111991 3300053153 Bacteria 1317
556 Ga0500622_0000015 3300053156 Bacteria 346227
557 Ga0500622_0000022 3300053156 Bacteria 267246
558 Ga0500622_0004874 3300053156 Bacteria 8215
559 Ga0500622_0073683 3300053156 Bacteria 1722
560 Ga0500611_000076 3300053727 Bacteria 38269
561 Ga0501084_0389316 3300054114 Unclassified 1178
562 2738726230 2738541278 Bacteria 9755573
563 2840678188 2840677318 Bacteria 2664183
564 2896086006 2896085136 Bacteria 6129793
565 2896110537 2896109856 Bacteria 7140722
566 Ga0157372_10039728
567 JGI24739J22299_10000159
568 JGI24744J21845_10013098
569 JGI24751J29686_10000936
570 rootH2_10000765
571 rootH2_10239466
572 rootL2_10001671
573 rootL2_10056687
574 rootL2_10226502
575 rootH1_10000182
576 rootH1_10012210
577 rootH1_10022147
578 rootH1_10223359
579 JGI25160J50197_1001166
580 Ga0055526_1012431
581 Ga0055526_1021069
582 Ga0055528_1000386
583 Ga0055530_10000288
584 Ga0055543_1023274
585 Ga0065165_1000128
586 Ga0065714_10136230
587 Ga0065704_10143114
588 Ga0065704_10181513
589 Ga0065712_10005930
590 Ga0065712_10029848
591 Ga0065712_10091269
592 Ga0065715_10006774
593 Ga0065707_10163385
594 Ga0070676_10022242
595 Ga0070676_10027899
596 Ga0070683_100004517
597 Ga0070683_100005266
598 Ga0070683_100061124
599 Ga0070683_100540581
600 Ga0070690_100002669
601 Ga0070670_100021078
602 Ga0070670_100032461
603 Ga0070670_100071052
604 Ga0070670_100109034
605 Ga0070670_100169445
606 Ga0070670_100273902
607 Ga0070677_10064205
608 Ga0068869_100003315
609 Ga0068869_100012995
610 Ga0068869_100073250
611 Ga0068869_100367830
612 Ga0070682_100000071
613 Ga0070682_100014036
614 Ga0068868_100050751
615 Ga0068868_100226283
616 Ga0070689_100039954
617 Ga0070689_100050116
618 Ga0070689_100119277
619 Ga0070689_100147074
620 Ga0070689_100341301
621 Ga0070689_100359812
622 Ga0070687_100012664
623 Ga0070687_100034606
624 Ga0070687_100210338
625 Ga0070661_100001842
626 Ga0070661_100055124
627 Ga0070661_100095277
628 Ga0070661_100166552
629 Ga0070668_100013579
630 Ga0070668_100023447
631 Ga0070668_100075376
632 Ga0070668_100485840
633 Ga0070669_100004598
634 Ga0070669_100006248
635 Ga0070669_100016206
636 Ga0070669_100107375
637 Ga0070675_100057949
638 Ga0070675_100060652
639 Ga0070675_100067164
640 Ga0070675_100090576
641 Ga0070675_100198177
642 Ga0070675_100346560
643 Ga0070675_100391277
644 Ga0070671_100028095
645 Ga0070671_100031511
646 Ga0070671_100421795
647 Ga0070674_100079579
648 Ga0070674_100088227
649 Ga0070674_100619902
650 Ga0070673_100006447
651 Ga0070673_100035453
652 Ga0070673_100088019
653 Ga0070688_100006235
654 Ga0070688_100008980
655 Ga0070688_100058533
656 Ga0070688_100067000
657 Ga0070659_100001036
658 Ga0070667_100007255
659 Ga0070667_100018176
660 Ga0070667_100065043
661 Ga0070701_10081610
662 Ga0070700_100159277
663 Ga0070694_100312488
664 Ga0070663_100064497
665 Ga0070678_100000605
666 Ga0070678_100004247
667 Ga0070678_100025666
668 Ga0070662_100001598
669 Ga0070662_100035436
670 Ga0070662_100048197
671 Ga0068867_100002197
672 Ga0068867_100044771
673 Ga0068867_100138934
674 Ga0068867_100403858
675 Ga0070685_10023053
676 Ga0070685_10036827
677 Ga0070685_10069038
678 Ga0070698_100004820
679 Ga0070698_100011741
680 Ga0070698_100047989
681 Ga0070699_100172788
682 Ga0070679_100457867
683 Ga0070684_100000751
684 Ga0070684_100023672
685 Ga0070684_100027594
686 Ga0068853_100000824
687 Ga0068853_100443448
688 Ga0070672_100037484
689 Ga0070672_100050030
690 Ga0070672_100075795
691 Ga0070672_100341250
692 Ga0070686_100008083
693 Ga0070686_100160100
694 Ga0068855_100003486
695 Ga0070664_100000795
696 Ga0070664_100003189
697 Ga0070664_100049953
698 Ga0070664_100056929
699 Ga0070664_100090318
700 Ga0070664_100263360
701 Ga0070664_100310782
702 Ga0070664_100315694
703 Ga0070664_100623281
704 Ga0068857_100000427
705 Ga0068857_100016335
706 Ga0068857_100123490
707 Ga0068857_100349571
708 Ga0068854_100042619
709 Ga0068856_100023291
710 Ga0070702_100105147
711 Ga0070702_100246088
712 Ga0068859_100008036
713 Ga0068859_100011172
714 Ga0068859_100013292
715 Ga0068859_100067711
716 Ga0068859_100140661
717 Ga0068859_100295014
718 Ga0068864_100002506
719 Ga0068864_100035708
720 Ga0068864_100035901
721 Ga0068864_100045359
722 Ga0068864_100092269
723 Ga0068864_100173872
724 Ga0068864_100190829
725 Ga0068864_100208300
726 Ga0068866_10002055
727 Ga0068861_100001969
728 Ga0068861_100003918
729 Ga0068861_100296089
730 Ga0068851_10040997
731 Ga0068851_10054649
732 Ga0068870_10022457
733 Ga0068863_100052396
734 Ga0068863_100086953
735 Ga0068863_100293834
736 Ga0068858_100211258
737 Ga0068860_100009767
738 Ga0068860_100014617
739 Ga0068860_100122392
740 Ga0068862_100038932
741 Ga0081539_10000037
742 Ga0075366_10083788
743 Ga0075366_10096144
744 Ga0097621_100000018
745 Ga0097621_100004248
746 Ga0097621_100033777
747 Ga0097621_100067523
748 Ga0097621_100124037
749 Ga0097621_100582184
750 Ga0068871_100000275
751 Ga0068871_100007679
752 Ga0068871_100027759
753 Ga0068871_100214188
754 Ga0075428_100055539
755 Ga0075428_100162262
756 Ga0075428_100185116
757 Ga0075428_100200864
758 Ga0075428_100250948
759 Ga0075430_100028152
760 Ga0075430_100060426
761 Ga0075431_100349547
762 Ga0075429_100014661
763 Ga0075429_100048668
764 Ga0068865_100016855
765 Ga0068865_100037263
766 Ga0068865_100053649
767 Ga0097620_100008036
768 Ga0097620_100011171
769 Ga0097620_100013292
770 Ga0097620_100067715
771 Ga0097620_100140672
772 Ga0097620_100295015
773 Ga0105240_10205259
774 Ga0111539_10007214
775 Ga0105247_10060412
776 Ga0105247_10172069
777 Ga0105241_10041140
778 Ga0105241_10113448
779 Ga0105242_10018943
780 Ga0105242_10020429
781 Ga0105237_10218912
782 Ga0105249_10016454
783 Ga0105249_10017633
784 Ga0105249_10027713
785 Ga0105249_10084961
786 Ga0105249_10133806
787 Ga0105249_10199080
788 Ga0105239_10358987
789 Ga0105246_10035012
790 Ga0105246_10063280
791 Ga0157373_10020309
792 Ga0157371_10027496
793 Ga0157371_10036290
794 Ga0157374_10006447
795 Ga0157374_10090983
796 Ga0157374_10291522
797 Ga0157374_10305013
798 Ga0157374_10651703
799 Ga0157378_10050289
800 Ga0157378_10780075
801 Ga0163162_10000773
802 Ga0163162_10026074
803 Ga0163162_10044947
804 Ga0163162_10046870
805 Ga0163162_10065340
806 Ga0163162_10182982
807 Ga0163162_10200216
808 Ga0157372_10024136
809 Ga0157372_10107483
810 Ga0157372_11085852
811 Ga0157375_10004547
812 Ga0157375_10015493
813 Ga0157375_10027205
814 Ga0157375_10034613
815 Ga0157375_10043634
816 Ga0157375_10098616
817 Ga0163163_10004390
818 Ga0163163_10008393
819 Ga0163163_10013527
820 Ga0163163_10017383
821 Ga0163163_10260562
822 Ga0157380_10001574
823 Ga0157380_10030785
824 Ga0157380_10181235
825 Ga0157380_10245730
826 Ga0157380_10273561
827 Ga0157377_10006393
828 Ga0157379_10036805
829 Ga0157379_10120109
830 Ga0157379_10147483
831 Ga0157376_10000076
832 Ga0157376_10031239
833 Ga0157376_10150062
834 Ga0157376_10260921
835 Ga0163161_10004225
836 Ga0163161_10056431
837 Ga0163161_10183401
838 Ga0163161_10538263
839 Ga0209673_1000085
840 Ga0209564_1004980
841 Ga0209564_1051159
842 Ga0209758_1007701
843 Ga0209758_1008347
844 Ga0209050_1000524
845 Ga0209050_1025451
846 Ga0207426_1001174
847 Ga0209257_1001638
848 Ga0207697_10163801
849 Ga0207682_10027154
850 Ga0207688_10101964
851 Ga0207680_10093424
852 Ga0207647_10022491
853 Ga0207645_10000571
854 Ga0207645_10017668
855 Ga0207645_10062396
856 Ga0207643_10002295
857 Ga0207643_10024798
858 Ga0207695_10450956
859 Ga0207660_10085782
860 Ga0207662_10024771
861 Ga0207662_10028786
862 Ga0207662_10044295
863 Ga0207657_10089554
864 Ga0207649_10000985
865 Ga0207649_10008325
866 Ga0207649_10031430
867 Ga0207649_10148435
868 Ga0207652_10457929
869 Ga0207681_10005990
870 Ga0207681_10041752
871 Ga0207681_10053369
872 Ga0207681_10083174
873 Ga0207681_10132417
874 Ga0207681_10336371
875 Ga0207650_10001737
876 Ga0207650_10101248
877 Ga0207650_10149351
878 Ga0207650_10151343
879 Ga0207650_10562466
880 Ga0207659_10016941
881 Ga0207659_10041876
882 Ga0207659_10053756
883 Ga0207659_10249544
884 Ga0207659_10386894
885 Ga0207644_10012160
886 Ga0207644_10192806
887 Ga0207644_10404836
888 Ga0207706_10001247
889 Ga0207706_10012699
890 Ga0207706_10012901
891 Ga0207706_10042849
892 Ga0207686_10002769
893 Ga0207686_10070861
894 Ga0207686_10443346
895 Ga0207670_10002792
896 Ga0207670_10056846
897 Ga0207670_10067090
898 Ga0207670_10121721
899 Ga0207670_10159010
900 Ga0207670_10349458
901 Ga0207669_10019880
902 Ga0207669_10384677
903 Ga0207704_10033534
904 Ga0207704_10042422
905 Ga0207691_10005639
906 Ga0207691_10018871
907 Ga0207691_10034746
908 Ga0207691_10075396
909 Ga0207691_10100987
910 Ga0207691_10428951
911 Ga0207689_10000939
912 Ga0207689_10001600
913 Ga0207689_10003568
914 Ga0207689_10128718
915 Ga0207689_10346706
916 Ga0207689_10610910
917 Ga0207661_10002365
918 Ga0207661_10003998
919 Ga0207661_10119435
920 Ga0207661_10674800
921 Ga0207679_10000247
922 Ga0207679_10170757
923 Ga0207667_10031638
924 Ga0207651_10042189
925 Ga0207651_10320709
926 Ga0207651_10401310
927 Ga0207712_10000887
928 Ga0207712_10002875
929 Ga0207712_10008393
930 Ga0207712_10011042
931 Ga0207712_10014283
932 Ga0207712_10109980
933 Ga0207712_10307790
934 Ga0207712_10327451
935 Ga0207712_10407122
936 Ga0207668_10051778
937 Ga0207668_10363957
938 Ga0207658_10040251
939 Ga0207658_10082502
940 Ga0207658_10117114
941 Ga0207677_10064505
942 Ga0207677_10196638
943 Ga0207703_10058692
944 Ga0207703_10061757
945 Ga0207703_10073135
946 Ga0207703_10141214
947 Ga0207639_10012793
948 Ga0207639_10054427
949 Ga0207639_10599955
950 Ga0207708_10022687
951 Ga0207708_10236295
952 Ga0207702_10099997
953 Ga0207641_10005107
954 Ga0207641_10051999
955 Ga0207641_10114023
956 Ga0207641_10121325
957 Ga0207641_10184932
958 Ga0207641_10335083
959 Ga0207641_10336970
960 Ga0207648_10001686
961 Ga0207648_10002203
962 Ga0207648_10010609
963 Ga0207648_10041009
964 Ga0207648_10163840
965 Ga0207676_10019937
966 Ga0207676_10052901
967 Ga0207676_10075263
968 Ga0207676_10109062
969 Ga0207676_10161056
970 Ga0207676_10323276
971 Ga0207676_10395144
972 Ga0207674_10001291
973 Ga0207674_10037377
974 Ga0207674_10078664
975 Ga0207674_10206749
976 Ga0207674_10237701
977 Ga0207674_10474769
978 Ga0207675_100001768
979 Ga0207675_100002694
980 Ga0207675_100028220
981 Ga0207675_100051469
982 Ga0207675_100404841
983 Ga0207683_10000535
984 Ga0207683_10006885
985 Ga0207683_10037194
986 Ga0207683_10038549
987 Ga0207683_10500791
988 Ga0207698_10101800
989 Ga0207698_10112024
990 Ga0207698_10412991
991 Ga0207428_10011923
992 Ga0268266_10177075
993 Ga0268265_10071601
994 Ga0268264_10013896
995 Ga0268264_10019426
996 Ga0268264_10185356
997 Ga0265327_10080292
998 Ga0307513_10254384
999 Ga0307509_10078756
1000 Ga0307509_10225167
1001 Ga0307509_10345974
1002 Ga0307408_100000652
1003 Ga0307408_100058808
1004 Ga0307408_100089415
1005 Ga0307508_10008362
1006 Ga0307413_10100519
1007 Ga0307518_10118916
1008 Ga0307410_10225135
1009 Ga0307406_10180253
1010 Ga0307407_10025387
1011 Ga0307407_10170510
1012 Ga0307412_10007233
1013 Ga0307412_10149345
1014 Ga0307416_100000322
1015 Ga0307416_100140303
1016 Ga0307414_10040137
1017 Ga0307415_100002700
1018 Ga0373924_0007396
1019 Ga0373927_0145496
1020 Ga0373933_0083426
1021 Ga0395905_0046088
1022 Ga0395905_0411868
1023 Ga0436365_0181133
1024 Ga0436365_1052711
1025 Ga0439439_0087531
1026 Ga0451797_1404866
1027 Ga0439441_001764
1028 Ga0439441_006465
1029 Ga0439445_0021053
1030 Ga0439457_013802
1031 Ga0450896_011539
1032 Ga0439434_0002558
1033 Ga0451577_0004985
1034 Ga0451577_0537743
1035 Ga0466961_0113119
1036 Ga0453684_0107388
1037 Ga0466957_0000578
1038 Ga0495638_0062044
1039 Ga0495582_0203572
1040 Ga0495630_0184083
1041 Ga0495668_0003813
1042 Ga0495625_0439960
1043 Ga0495599_0349178
1044 Ga0495672_0007236
1045 Ga0495672_0063816
1046 Ga0495680_0118674
1047 Ga0495686_0063214
1048 Ga0495686_0188938
1049 Ga0496100_0129365
1050 Ga0496101_0384857
1051 Ga0496104_0297356
1052 Ga0496105_0347111
1053 Ga0496106_0518835
1054 Ga0496110_0125425
1055 Ga0496114_0054321
1056 Ga0501298_000444
1057 Ga0501300_001207
1058 Ga0501032_0010733
1059 Ga0501034_0008758
1060 Ga0501034_0017551
1061 Ga0501034_0170160
1062 Ga0501036_0012212
1063 Ga0501037_0017158
1064 Ga0501037_0056114
1065 Ga0501038_0300146
1066 Ga0501039_0078269
1067 Ga0501039_0115088
1068 Ga0501043_0049149
1069 Ga0501043_0059268
1070 Ga0501043_0069112
1071 Ga0501043_0173993
1072 Ga0501046_0070859
1073 Ga0501047_0009459
1074 Ga0501047_0054864
1075 Ga0501047_0163006
1076 Ga0501067_0041303
1077 Ga0501073_0018578
1078 Ga0501073_0103769
1079 Ga0501074_0100038
1080 Ga0501077_0205578
1081 Ga0501198_000560
1082 Ga0501201_000453
1083 Ga0501216_022785
1084 Ga0501217_006451
1085 Ga0501223_005125
1086 Ga0501235_000507
1087 Ga0501235_034810
1088 Ga0501243_000292
1089 Ga0501252_001749
1090 Ga0501257_002778
1091 Ga0501259_000215
1092 Ga0501261_001529
1093 Ga0501225_0001574
1094 Ga0501225_0015013
1095 Ga0501245_001570
1096 Ga0501079_0136462
1097 Ga0501083_0003657
1098 Ga0501232_006801
1099 Ga0501266_005536
1100 Ga0501268_003890
1101 Ga0501270_003227
1102 Ga0501282_001927
1103 Ga0501035_0002820
1104 Ga0501035_0083619
1105 Ga0501044_0002309
1106 Ga0501044_0024007
1107 Ga0501044_0459462
1108 nmdc:mga0k408_29803_c1
1109 nmdc:mga09592_260536_c1
1110 nmdc:mga0qj67_30076_c1
1111 nmdc:mga06r32_271578_c1
1112 nmdc:mga08y16_14118_c1
1113 Ga0495619_0141674
1114 Ga0500583_0000546
1115 Ga0500641_0023563
1116 Ga0500658_0071219
1117 Ga0500604_0020591
1118 Ga0500616_0016137
1119 Ga0500616_0017408
1120 Ga0500616_0111991
1121 Ga0500622_0000015
1122 Ga0500622_0000022
1123 Ga0500622_0004874
1124 Ga0500622_0073683
1125 Ga0500611_000076
1126 Ga0501084_0389316
1127 2738726230
1128 2840678188
1129 2896086006
1130 2896110537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

120

317

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9643 50 284
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9485 50 284
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8971 60 285
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8945 60 281
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.8937 58 285
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9602 50 284 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9522 50 284 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9191 60 284 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9166 76 284 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9131 58 285 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3C1TI09-F1-model_v4 Carboxymethylenebutenolidase 1.004 175 283 GO:0016787
AF-A0A1I1KUD9-F1-model_v4 Dienelactone hydrolase family protein 1.001 154 283 GO:0016787
AF-A0A3N5H463-F1-model_v4 Dienelactone hydrolase family protein 0.9974 180 283 GO:0016787
AF-A0A6N3QHR6-F1-model_v4 Putative enzyme 0.9972 170 285 GO:0016787
AF-A0A4R2BIH8-F1-model_v4 Dienelactone hydrolase family protein 0.9964 181 283 GO:0016787

Map