F464266

General Info

Members Datasets Scaffolds Average Seq Length
565 250 1130 229

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10106459|Ga0213875_101064592
Length 244
Sequence MRVESGLGFEPIEQIYARVYQAVKPRATLPTITVHFREYANPNSRIRLEEGHMIVDISDLLKNAPASIQEALALILIEKLFRRRPSPSVLALYRRYLNRVDIRQQMYRIKQERGRKTVLDPKGRVYDLCEVFEELNLKYFYGLMARPRLGWSVRKSRTILGHYDPSHHVIVLTNVLDSPDAPELIVQYVMFHEMLHLKYPTQHKGHHRCVHTPDFKAAEKRFERFPEAQQALKLFLQGSWKQAG

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
116 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
117 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
118 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.19
Rhizosphere 95.93
Stem 0
Stem Tuber 0
Unclassified 19.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10106459 3300021388 Bacteria 1309
2 MBSR1b_contig_6142972 2162886012 Unclassified 4556
3 LJNas_1001344 3300000546 Unclassified 3584
4 Ga0065715_10105172 3300005293 Unclassified 2910
5 Ga0070676_10010631 3300005328 Unclassified 4993
6 Ga0070683_100002268 3300005329 Bacteria 15236
7 Ga0070690_100015140 3300005330 Bacteria 4593
8 Ga0070690_100377539 3300005330 Bacteria 1035
9 Ga0070670_100007488 3300005331 Bacteria 9272
10 Ga0070670_100013807 3300005331 Bacteria 6923
11 Ga0070670_100293922 3300005331 Unclassified 1420
12 Ga0068869_100001031 3300005334 Bacteria 16214
13 Ga0068869_100017672 3300005334 Bacteria 4840
14 Ga0068869_100019468 3300005334 Bacteria 4639
15 Ga0070666_10015167 3300005335 Bacteria 4913
16 Ga0070666_10087256 3300005335 Unclassified 2138
17 Ga0070682_100143022 3300005337 Bacteria 1633
18 Ga0070682_100327947 3300005337 Bacteria 1133
19 Ga0068868_100001274 3300005338 Bacteria 17366
20 Ga0068868_100003525 3300005338 Bacteria 10903
21 Ga0068868_100032638 3300005338 Bacteria 4007
22 Ga0068868_100076478 3300005338 Unclassified 2676
23 Ga0070660_100001737 3300005339 Bacteria 14944
24 Ga0070687_100055230 3300005343 Unclassified 2073
25 Ga0070661_100003397 3300005344 Bacteria 10986
26 Ga0070661_100004901 3300005344 Bacteria 9216
27 Ga0070661_100113903 3300005344 Unclassified 2021
28 Ga0070692_10090102 3300005345 Bacteria 1666
29 Ga0070668_100074012 3300005347 Bacteria 2657
30 Ga0070669_100037233 3300005353 Unclassified 3529
31 Ga0070675_100051727 3300005354 Unclassified 3376
32 Ga0070675_100101059 3300005354 Unclassified 2429
33 Ga0070675_100739357 3300005354 Unclassified 897
34 Ga0070673_100021679 3300005364 Bacteria 4664
35 Ga0070673_100070220 3300005364 Bacteria 2810
36 Ga0070673_100083659 3300005364 Unclassified 2593
37 Ga0070688_100028516 3300005365 Unclassified 3333
38 Ga0070659_100049675 3300005366 Bacteria 3299
39 Ga0070667_100320998 3300005367 Bacteria 1397
40 Ga0070667_100606840 3300005367 Bacteria 1008
41 Ga0070709_10361162 3300005434 Bacteria 1075
42 Ga0070714_100007677 3300005435 Bacteria 8401
43 Ga0070714_100019607 3300005435 Bacteria 5514
44 Ga0070714_100231260 3300005435 Unclassified 1703
45 Ga0070714_100525739 3300005435 Bacteria 1130
46 Ga0070714_100540470 3300005435 Bacteria 1115
47 Ga0070713_100005719 3300005436 Bacteria 8539
48 Ga0070713_100006013 3300005436 Bacteria 8357
49 Ga0070713_100015855 3300005436 Bacteria 5649
50 Ga0070713_100081334 3300005436 Bacteria 2764
51 Ga0070713_100236825 3300005436 Bacteria 1661
52 Ga0070713_100395721 3300005436 Bacteria 1289
53 Ga0070713_100417986 3300005436 Bacteria 1255
54 Ga0070713_100552774 3300005436 Bacteria 1090
55 Ga0070710_10026849 3300005437 Bacteria 3065
56 Ga0070710_10058936 3300005437 Bacteria 2179
57 Ga0070701_10054142 3300005438 Unclassified 2091
58 Ga0070711_100002184 3300005439 Bacteria 11106
59 Ga0070711_100115709 3300005439 Bacteria 1975
60 Ga0070711_100175263 3300005439 Bacteria 1638
61 Ga0070711_100654614 3300005439 Bacteria 881
62 Ga0070700_100206894 3300005441 Bacteria 1382
63 Ga0070694_100168918 3300005444 Unclassified 1610
64 Ga0070708_100013653 3300005445 Bacteria 6659
65 Ga0070663_100006908 3300005455 Bacteria 6872
66 Ga0070663_100007702 3300005455 Bacteria 6575
67 Ga0070678_100057332 3300005456 Unclassified 2853
68 Ga0070662_100006729 3300005457 Bacteria 7430
69 Ga0070662_100017556 3300005457 Bacteria 4826
70 Ga0070681_10000034 3300005458 Bacteria 98600
71 Ga0070681_10003943 3300005458 Bacteria 13978
72 Ga0070681_10011290 3300005458 Bacteria 8836
73 Ga0070681_10044615 3300005458 Bacteria 4438
74 Ga0070681_10233131 3300005458 Unclassified 1755
75 Ga0070681_10335764 3300005458 Bacteria 1421
76 Ga0068867_100013178 3300005459 Bacteria 5855
77 Ga0068867_100029442 3300005459 Bacteria 3956
78 Ga0070685_10003473 3300005466 Bacteria 8014
79 Ga0070685_10083580 3300005466 Bacteria 1918
80 Ga0070706_100002114 3300005467 Bacteria 20233
81 Ga0070706_100047769 3300005467 Bacteria 3950
82 Ga0070707_100006263 3300005468 Bacteria 11071
83 Ga0070707_100403703 3300005468 Bacteria 1327
84 Ga0070698_100000216 3300005471 Bacteria 56257
85 Ga0070698_100033368 3300005471 Bacteria 5332
86 Ga0070698_100048952 3300005471 Unclassified 4317
87 Ga0070699_100022523 3300005518 Bacteria 5430
88 Ga0070699_100125193 3300005518 Unclassified 2262
89 Ga0070699_100670693 3300005518 Bacteria 947
90 Ga0070699_100871715 3300005518 Unclassified 824
91 Ga0070679_100000270 3300005530 Bacteria 43437
92 Ga0070679_100072008 3300005530 Bacteria 3448
93 Ga0070679_100095226 3300005530 Unclassified 2965
94 Ga0070684_100003168 3300005535 Bacteria 12301
95 Ga0070684_100036211 3300005535 Bacteria 4228
96 Ga0070684_100321919 3300005535 Bacteria 1420
97 Ga0070697_100000763 3300005536 Bacteria 24081
98 Ga0070697_100007580 3300005536 Bacteria 8449
99 Ga0070697_100022129 3300005536 Bacteria 5044
100 Ga0070697_100026351 3300005536 Unclassified 4643
101 Ga0070697_100324742 3300005536 Bacteria 1326
102 Ga0070697_100339705 3300005536 Bacteria 1296
103 Ga0070697_100360906 3300005536 Bacteria 1256
104 Ga0068853_100021860 3300005539 Bacteria 5336
105 Ga0068853_100035868 3300005539 Bacteria 4214
106 Ga0068853_100055054 3300005539 Unclassified 3428
107 Ga0070672_100002457 3300005543 Bacteria 11764
108 Ga0070672_100616609 3300005543 Bacteria 946
109 Ga0070686_100011378 3300005544 Bacteria 5046
110 Ga0070695_100072975 3300005545 Bacteria 2251
111 Ga0070695_100118064 3300005545 Bacteria 1811
112 Ga0070696_100049944 3300005546 Bacteria 2906
113 Ga0070696_100466138 3300005546 Bacteria 999
114 Ga0070693_100074321 3300005547 Bacteria 2010
115 Ga0070693_100169969 3300005547 Unclassified 1395
116 Ga0070665_100008025 3300005548 Bacteria 10692
117 Ga0068855_100000414 3300005563 Bacteria 52978
118 Ga0068855_100003902 3300005563 Bacteria 18211
119 Ga0068855_100006845 3300005563 Bacteria 13830
120 Ga0068855_100020846 3300005563 Bacteria 7860
121 Ga0068855_100190557 3300005563 Bacteria 2313
122 Ga0070664_100001867 3300005564 Bacteria 16896
123 Ga0070664_100009789 3300005564 Bacteria 7765
124 Ga0070664_100030441 3300005564 Unclassified 4503
125 Ga0070664_100048159 3300005564 Bacteria 3602
126 Ga0070664_100597538 3300005564 Bacteria 1023
127 Ga0068857_100000145 3300005577 Bacteria 43701
128 Ga0068857_100000834 3300005577 Bacteria 23089
129 Ga0068857_100007151 3300005577 Bacteria 9615
130 Ga0068854_100003316 3300005578 Bacteria 10034
131 Ga0068854_100018013 3300005578 Unclassified 4735
132 Ga0068854_100023295 3300005578 Bacteria 4228
133 Ga0068854_100191964 3300005578 Bacteria 1601
134 Ga0068854_100239095 3300005578 Bacteria 1445
135 Ga0068854_100239776 3300005578 Unclassified 1443
136 Ga0068856_100000240 3300005614 Bacteria 59772
137 Ga0068856_100000541 3300005614 Bacteria 41709
138 Ga0068856_100001202 3300005614 Bacteria 27260
139 Ga0068856_100001857 3300005614 Bacteria 22056
140 Ga0068856_100006280 3300005614 Bacteria 11664
141 Ga0068856_100009947 3300005614 Bacteria 9238
142 Ga0068856_100085458 3300005614 Bacteria 3134
143 Ga0068856_100448963 3300005614 Bacteria 1310
144 Ga0068856_100571119 3300005614 Bacteria 1152
145 Ga0070702_100015230 3300005615 Bacteria 3921
146 Ga0068852_100009567 3300005616 Bacteria 7200
147 Ga0068852_100030141 3300005616 Bacteria 4463
148 Ga0068859_100002087 3300005617 Bacteria 20362
149 Ga0068859_100359756 3300005617 Bacteria 1550
150 Ga0068864_100000293 3300005618 Bacteria 44451
151 Ga0068864_100033248 3300005618 Bacteria 4384
152 Ga0068864_100079355 3300005618 Unclassified 2874
153 Ga0068864_100087153 3300005618 Bacteria 2748
154 Ga0068866_10001118 3300005718 Bacteria 11772
155 Ga0068866_10007735 3300005718 Bacteria 4509
156 Ga0068861_100259135 3300005719 Bacteria 1488
157 Ga0068851_10003080 3300005834 Bacteria 7379
158 Ga0068851_10016663 3300005834 Bacteria 3520
159 Ga0068870_10005005 3300005840 Bacteria 5755
160 Ga0068863_100022639 3300005841 Bacteria 6001
161 Ga0068858_100001387 3300005842 Bacteria 24924
162 Ga0068858_100017995 3300005842 Bacteria 6618
163 Ga0068858_100020235 3300005842 Bacteria 6224
164 Ga0068858_100025114 3300005842 Bacteria 5544
165 Ga0068860_100028042 3300005843 Bacteria 5422
166 Ga0068860_100132780 3300005843 Bacteria 2390
167 Ga0068860_100370052 3300005843 Bacteria 1413
168 Ga0068862_100007154 3300005844 Bacteria 9262
169 Ga0068862_100012824 3300005844 Bacteria 6933
170 Ga0070717_10005017 3300006028 Bacteria 9638
171 Ga0070717_10032919 3300006028 Bacteria 4180
172 Ga0070717_10063272 3300006028 Bacteria 3070
173 Ga0070717_10331919 3300006028 Bacteria 1357
174 Ga0070717_10451909 3300006028 Bacteria 1158
175 Ga0070717_11001399 3300006028 Bacteria 761
176 Ga0070715_10213222 3300006163 Bacteria 988
177 Ga0070716_100087155 3300006173 Bacteria 1880
178 Ga0097621_100000770 3300006237 Bacteria 22480
179 Ga0097621_100000942 3300006237 Bacteria 20383
180 Ga0097621_100001923 3300006237 Bacteria 14185
181 Ga0097621_100012372 3300006237 Bacteria 6323
182 Ga0097621_100065605 3300006237 Unclassified 2988
183 Ga0097621_100195472 3300006237 Bacteria 1754
184 Ga0068871_100000071 3300006358 Bacteria 57255
185 Ga0068871_100000585 3300006358 Bacteria 25031
186 Ga0068871_100003890 3300006358 Bacteria 10290
187 Ga0068871_100023995 3300006358 Bacteria 4726
188 Ga0075431_100399977 3300006847 Unclassified 1375
189 Ga0075433_10000127 3300006852 Bacteria 38862
190 Ga0075433_10206350 3300006852 Bacteria 1747
191 Ga0075433_10249675 3300006852 Unclassified 1574
192 Ga0075434_100012727 3300006871 Bacteria 7984
193 Ga0075434_100218197 3300006871 Unclassified 1927
194 Ga0068865_100248692 3300006881 Bacteria 1402
195 Ga0068865_100473834 3300006881 Bacteria 1039
196 Ga0075436_100058457 3300006914 Unclassified 2663
197 Ga0075436_100083064 3300006914 Bacteria 2222
198 Ga0075436_100187412 3300006914 Bacteria 1463
199 Ga0075436_100226554 3300006914 Unclassified 1327
200 Ga0097620_100002087 3300006931 Bacteria 20362
201 Ga0097620_100359765 3300006931 Bacteria 1550
202 Ga0075435_100025257 3300007076 Bacteria 4623
203 Ga0075435_100031557 3300007076 Bacteria 4175
204 Ga0075435_100485620 3300007076 Unclassified 1067
205 Ga0099794_10022551 3300007265 Bacteria 2871
206 Ga0105250_10035006 3300009092 Bacteria 2014
207 Ga0105240_10013436 3300009093 Bacteria 11242
208 Ga0105240_10052938 3300009093 Bacteria 5099
209 Ga0105240_10130648 3300009093 Bacteria 3013
210 Ga0105245_10003303 3300009098 Bacteria 14477
211 Ga0105245_10016949 3300009098 Bacteria 6361
212 Ga0105245_10060706 3300009098 Bacteria 3406
213 Ga0105245_10306763 3300009098 Unclassified 1559
214 Ga0105247_10016766 3300009101 Bacteria 4392
215 Ga0105247_10281353 3300009101 Bacteria 1148
216 Ga0114129_10151681 3300009147 Bacteria 3171
217 Ga0105243_10017773 3300009148 Bacteria 5380
218 Ga0105241_10014684 3300009174 Bacteria 5731
219 Ga0105241_10160150 3300009174 Bacteria 1849
220 Ga0105242_10022075 3300009176 Bacteria 5002
221 Ga0105242_10060740 3300009176 Bacteria 3107
222 Ga0105242_10509094 3300009176 Unclassified 1146
223 Ga0105242_10813091 3300009176 Unclassified 926
224 Ga0105248_10023387 3300009177 Bacteria 6865
225 Ga0105248_10070055 3300009177 Unclassified 3938
226 Ga0105248_10089270 3300009177 Bacteria 3469
227 Ga0105248_10147309 3300009177 Unclassified 2656
228 Ga0105237_10019488 3300009545 Bacteria 7006
229 Ga0105237_10042061 3300009545 Bacteria 4608
230 Ga0105237_10075863 3300009545 Bacteria 3352
231 Ga0105237_10107596 3300009545 Unclassified 2780
232 Ga0105237_10247183 3300009545 Bacteria 1786
233 Ga0105238_10023564 3300009551 Bacteria 6273
234 Ga0105238_10230039 3300009551 Bacteria 1831
235 Ga0105238_10553770 3300009551 Bacteria 1154
236 Ga0105249_10009361 3300009553 Bacteria 8570
237 Ga0105249_10015312 3300009553 Bacteria 6788
238 Ga0105239_10014391 3300010375 Bacteria 8777
239 Ga0105239_10143491 3300010375 Unclassified 2662
240 Ga0105239_10187413 3300010375 Bacteria 2315
241 Ga0105239_10211800 3300010375 Bacteria 2172
242 Ga0105239_10349918 3300010375 Unclassified 1668
243 Ga0105239_10458747 3300010375 Bacteria 1446
244 Ga0105239_10824473 3300010375 Unclassified 1063
245 Ga0105246_10002874 3300011119 Bacteria 10422
246 Ga0105246_10135186 3300011119 Bacteria 1847
247 Ga0157327_1013810 3300012512 Bacteria 816
248 Ga0157373_10004095 3300013100 Bacteria 10983
249 Ga0157373_10022757 3300013100 Bacteria 4545
250 Ga0157371_10008143 3300013102 Bacteria 8377
251 Ga0157371_10025328 3300013102 Bacteria 4325
252 Ga0157370_10021428 3300013104 Bacteria 6440
253 Ga0157370_10460298 3300013104 Unclassified 1169
254 Ga0157369_10005194 3300013105 Bacteria 15216
255 Ga0157369_10008060 3300013105 Bacteria 12080
256 Ga0157369_10023247 3300013105 Bacteria 6906
257 Ga0157369_10035790 3300013105 Bacteria 5443
258 Ga0157369_10084394 3300013105 Bacteria 3395
259 Ga0157369_10176902 3300013105 Bacteria 2246
260 Ga0157374_10005372 3300013296 Bacteria 10762
261 Ga0157374_10092958 3300013296 Unclassified 2879
262 Ga0157374_10157490 3300013296 Bacteria 2211
263 Ga0157374_10694591 3300013296 Bacteria 1030
264 Ga0157378_10001634 3300013297 Bacteria 20274
265 Ga0163162_10012219 3300013306 Bacteria 8380
266 Ga0163162_10021539 3300013306 Bacteria 6349
267 Ga0163162_10061989 3300013306 Bacteria 3779
268 Ga0163162_10388574 3300013306 Bacteria 1528
269 Ga0157372_10002160 3300013307 Bacteria 21394
270 Ga0157372_10014358 3300013307 Bacteria 8469
271 Ga0157372_10015395 3300013307 Bacteria 8196
272 Ga0157372_10020186 3300013307 Bacteria 7184
273 Ga0157372_10236505 3300013307 Bacteria 2119
274 Ga0157372_10653785 3300013307 Bacteria 1224
275 Ga0157372_11185826 3300013307 Unclassified 882
276 Ga0157375_10029320 3300013308 Bacteria 5173
277 Ga0157375_10098948 3300013308 Unclassified 2995
278 Ga0163163_10016165 3300014325 Bacteria 6927
279 Ga0163163_10019901 3300014325 Bacteria 6312
280 Ga0163163_10023045 3300014325 Bacteria 5904
281 Ga0163163_10062922 3300014325 Unclassified 3678
282 Ga0157380_10042620 3300014326 Bacteria 3548
283 Ga0182008_10013280 3300014497 Bacteria 4330
284 Ga0157377_10000261 3300014745 Bacteria 25919
285 Ga0157379_10023173 3300014968 Bacteria 5506
286 Ga0157379_10069967 3300014968 Bacteria 3139
287 Ga0157379_10712760 3300014968 Bacteria 942
288 Ga0157376_10005335 3300014969 Bacteria 8975
289 Ga0157376_10067992 3300014969 Bacteria 3015
290 Ga0157376_10114586 3300014969 Unclassified 2379
291 Ga0157376_10118585 3300014969 Bacteria 2342
292 Ga0182006_1024873 3300015261 Bacteria 2465
293 Ga0163161_10288156 3300017792 Bacteria 1290
294 Ga0224570_100355 3300022730 Bacteria 3559
295 Ga0224571_102978 3300022734 Bacteria 1085
296 Ga0224572_1003222 3300024225 Unclassified 2734
297 Ga0224572_1004423 3300024225 Bacteria 2442
298 Ga0228598_1000300 3300024227 Bacteria 9612
299 Ga0207697_10002331 3300025315 Bacteria 9887
300 Ga0207697_10203149 3300025315 Unclassified 872
301 Ga0207692_10383202 3300025898 Bacteria 873
302 Ga0207642_10130626 3300025899 Bacteria 1310
303 Ga0207710_10166890 3300025900 Bacteria 1075
304 Ga0207688_10118229 3300025901 Bacteria 1545
305 Ga0207680_10018009 3300025903 Bacteria 3743
306 Ga0207647_10119953 3300025904 Bacteria 1551
307 Ga0207647_10203190 3300025904 Unclassified 1146
308 Ga0207647_10204364 3300025904 Bacteria 1142
309 Ga0207699_10013093 3300025906 Bacteria 4234
310 Ga0207699_10040415 3300025906 Bacteria 2687
311 Ga0207699_10350813 3300025906 Bacteria 1042
312 Ga0207699_10447539 3300025906 Bacteria 926
313 Ga0207645_10000371 3300025907 Bacteria 37175
314 Ga0207645_10007671 3300025907 Bacteria 7605
315 Ga0207645_10077986 3300025907 Unclassified 2123
316 Ga0207643_10001893 3300025908 Bacteria 11566
317 Ga0207684_10001445 3300025910 Bacteria 25710
318 Ga0207684_10001633 3300025910 Bacteria 23811
319 Ga0207684_10063157 3300025910 Unclassified 3144
320 Ga0207654_10011428 3300025911 Unclassified 4532
321 Ga0207654_10026648 3300025911 Bacteria 3133
322 Ga0207654_10091299 3300025911 Unclassified 1857
323 Ga0207654_10190114 3300025911 Bacteria 1345
324 Ga0207707_10000891 3300025912 Bacteria 29182
325 Ga0207707_10115550 3300025912 Bacteria 2345
326 Ga0207707_10148112 3300025912 Bacteria 2052
327 Ga0207695_10115209 3300025913 Bacteria 2662
328 Ga0207695_10144983 3300025913 Bacteria 2320
329 Ga0207695_10251120 3300025913 Bacteria 1668
330 Ga0207671_10210455 3300025914 Bacteria 1521
331 Ga0207671_10417637 3300025914 Bacteria 1067
332 Ga0207671_10503415 3300025914 Unclassified 966
333 Ga0207671_10686653 3300025914 Bacteria 814
334 Ga0207693_10068757 3300025915 Bacteria 2772
335 Ga0207693_10160812 3300025915 Unclassified 1767
336 Ga0207663_10003040 3300025916 Bacteria 8119
337 Ga0207663_10032755 3300025916 Bacteria 3088
338 Ga0207663_10194096 3300025916 Bacteria 1460
339 Ga0207660_10073951 3300025917 Bacteria 2486
340 Ga0207660_10086859 3300025917 Bacteria 2310
341 Ga0207660_10214962 3300025917 Bacteria 1507
342 Ga0207657_10001273 3300025919 Bacteria 26864
343 Ga0207649_10000697 3300025920 Bacteria 22131
344 Ga0207652_10268517 3300025921 Unclassified 1539
345 Ga0207652_10509253 3300025921 Unclassified 1083
346 Ga0207646_10002176 3300025922 Bacteria 23366
347 Ga0207646_10002443 3300025922 Bacteria 21928
348 Ga0207646_10188017 3300025922 Bacteria 1865
349 Ga0207646_10380357 3300025922 Bacteria 1275
350 Ga0207694_10002206 3300025924 Bacteria 15987
351 Ga0207694_10097061 3300025924 Bacteria 2331
352 Ga0207694_10709708 3300025924 Unclassified 848
353 Ga0207650_10000040 3300025925 Bacteria 204095
354 Ga0207650_10005212 3300025925 Bacteria 8865
355 Ga0207650_10108932 3300025925 Unclassified 2142
356 Ga0207659_10018811 3300025926 Unclassified 4534
357 Ga0207687_10006491 3300025927 Bacteria 7726
358 Ga0207687_10088770 3300025927 Bacteria 2250
359 Ga0207687_10437912 3300025927 Bacteria 1082
360 Ga0207687_10678073 3300025927 Bacteria 873
361 Ga0207700_10007046 3300025928 Bacteria 6839
362 Ga0207700_10180658 3300025928 Bacteria 1766
363 Ga0207700_10622162 3300025928 Unclassified 962
364 Ga0207700_10986993 3300025928 Bacteria 754
365 Ga0207664_10000369 3300025929 Bacteria 32894
366 Ga0207664_10002569 3300025929 Bacteria 11999
367 Ga0207664_10922298 3300025929 Bacteria 784
368 Ga0207690_10201361 3300025932 Unclassified 1512
369 Ga0207706_10000141 3300025933 Bacteria 78380
370 Ga0207706_10012156 3300025933 Bacteria 7842
371 Ga0207706_10017331 3300025933 Bacteria 6488
372 Ga0207686_10728598 3300025934 Bacteria 790
373 Ga0207670_10031072 3300025936 Unclassified 3417
374 Ga0207704_10397197 3300025938 Bacteria 1087
375 Ga0207665_10082150 3300025939 Bacteria 2220
376 Ga0207665_10172765 3300025939 Bacteria 1561
377 Ga0207665_10267376 3300025939 Bacteria 1269
378 Ga0207665_10338175 3300025939 Bacteria 1134
379 Ga0207691_10002237 3300025940 Bacteria 18957
380 Ga0207711_10007921 3300025941 Bacteria 8886
381 Ga0207711_10016324 3300025941 Bacteria 6169
382 Ga0207711_10071391 3300025941 Bacteria 3012
383 Ga0207711_10093472 3300025941 Bacteria 2649
384 Ga0207711_10388225 3300025941 Bacteria 1296
385 Ga0207689_10005382 3300025942 Bacteria 11457
386 Ga0207689_10021981 3300025942 Bacteria 5363
387 Ga0207689_10088662 3300025942 Unclassified 2541
388 Ga0207661_10001100 3300025944 Bacteria 17973
389 Ga0207661_10080422 3300025944 Unclassified 2689
390 Ga0207679_10001034 3300025945 Bacteria 17772
391 Ga0207679_10032896 3300025945 Unclassified 3645
392 Ga0207679_10035710 3300025945 Bacteria 3519
393 Ga0207679_10569754 3300025945 Unclassified 1018
394 Ga0207679_10704764 3300025945 Bacteria 916
395 Ga0207667_10000535 3300025949 Bacteria 50094
396 Ga0207667_10000827 3300025949 Bacteria 39994
397 Ga0207667_10016800 3300025949 Bacteria 8256
398 Ga0207667_10046289 3300025949 Bacteria 4606
399 Ga0207667_10058308 3300025949 Unclassified 4050
400 Ga0207667_10100655 3300025949 Bacteria 2981
401 Ga0207651_10049725 3300025960 Bacteria 2842
402 Ga0207668_10045138 3300025972 Bacteria 3003
403 Ga0207640_10026311 3300025981 Unclassified 3530
404 Ga0207640_10034677 3300025981 Bacteria 3151
405 Ga0207640_10150673 3300025981 Bacteria 1708
406 Ga0207640_10182780 3300025981 Bacteria 1574
407 Ga0207640_10239360 3300025981 Bacteria 1401
408 Ga0207658_10118835 3300025986 Unclassified 2103
409 Ga0207658_10167995 3300025986 Bacteria 1804
410 Ga0207677_10038541 3300026023 Unclassified 3134
411 Ga0207677_10056566 3300026023 Unclassified 2688
412 Ga0207677_10112082 3300026023 Bacteria 2033
413 Ga0207703_10053079 3300026035 Unclassified 3294
414 Ga0207703_10063632 3300026035 Unclassified 3025
415 Ga0207703_10091794 3300026035 Bacteria 2555
416 Ga0207639_10128615 3300026041 Bacteria 2093
417 Ga0207639_10179206 3300026041 Unclassified 1801
418 Ga0207678_10005178 3300026067 Bacteria 11684
419 Ga0207678_10005837 3300026067 Bacteria 10974
420 Ga0207708_10103129 3300026075 Unclassified 2209
421 Ga0207708_10183279 3300026075 Unclassified 1663
422 Ga0207702_10000612 3300026078 Bacteria 39396
423 Ga0207702_10000711 3300026078 Bacteria 35806
424 Ga0207702_10001271 3300026078 Bacteria 25346
425 Ga0207702_10008768 3300026078 Bacteria 8526
426 Ga0207702_10013145 3300026078 Bacteria 6882
427 Ga0207702_10016811 3300026078 Bacteria 6055
428 Ga0207702_10051864 3300026078 Bacteria 3469
429 Ga0207702_10095898 3300026078 Bacteria 2607
430 Ga0207702_10286797 3300026078 Bacteria 1558
431 Ga0207702_10325052 3300026078 Bacteria 1466
432 Ga0207641_10000009 3300026088 Bacteria 407901
433 Ga0207641_10005057 3300026088 Bacteria 11300
434 Ga0207641_10555034 3300026088 Bacteria 1120
435 Ga0207641_10685972 3300026088 Bacteria 1008
436 Ga0207648_10001357 3300026089 Bacteria 27066
437 Ga0207648_10003568 3300026089 Bacteria 16274
438 Ga0207648_10008523 3300026089 Bacteria 9924
439 Ga0207676_10000153 3300026095 Bacteria 60008
440 Ga0207676_10013127 3300026095 Bacteria 5947
441 Ga0207676_10400048 3300026095 Bacteria 1283
442 Ga0207674_10000010 3300026116 Bacteria 196710
443 Ga0207674_10011363 3300026116 Bacteria 10006
444 Ga0207674_10020214 3300026116 Bacteria 7200
445 Ga0207675_100118375 3300026118 Bacteria 2505
446 Ga0207683_10001748 3300026121 Bacteria 19253
447 Ga0207683_10103405 3300026121 Bacteria 2545
448 Ga0207698_10009943 3300026142 Bacteria 6085
449 Ga0207698_10090448 3300026142 Unclassified 2503
450 Ga0207698_10105167 3300026142 Bacteria 2351
451 Ga0207698_10277147 3300026142 Bacteria 1549
452 Ga0207698_10861974 3300026142 Bacteria 911
453 Ga0207698_10893326 3300026142 Bacteria 895
454 Ga0265356_1001776 3300028017 Bacteria 3056
455 Ga0268265_10077886 3300028380 Unclassified 2605
456 Ga0268264_10068654 3300028381 Unclassified 2996
457 Ga0268264_10103833 3300028381 Bacteria 2476
458 Ga0265338_10077469 3300028800 Unclassified 2810
459 Ga0265762_1005727 3300030760 Bacteria 2228
460 Ga0265762_1028413 3300030760 Bacteria 1053
461 Ga0265771_1003021 3300031010 Bacteria 941
462 Ga0265760_10001194 3300031090 Bacteria 7604
463 Ga0265760_10002427 3300031090 Bacteria 5444
464 Ga0265760_10015268 3300031090 Bacteria 2201
465 Ga0265339_10113914 3300031249 Bacteria 1396
466 Ga0265314_10109191 3300031711 Unclassified 1761
467 Ga0307406_10099777 3300031901 Bacteria 1975
468 Ga0307416_100038610 3300032002 Bacteria 3686
469 Ga0307411_10034992 3300032005 Unclassified 3131
470 Ga0307415_100522343 3300032126 Bacteria 1042
471 Ga0373958_0047443 3300034819 Bacteria 898
472 Ga0373923_0027052 3300035111 Bacteria 2285
473 Ga0373923_0057893 3300035111 Bacteria 1640
474 Ga0373936_0025677 3300035113 Bacteria 2304
475 Ga0373936_0206783 3300035113 Bacteria 868
476 Ga0373941_0021293 3300035115 Bacteria 1828
477 Ga0373945_0004610 3300035116 Unclassified 4388
478 Ga0373953_0065646 3300035117 Bacteria 1490
479 Ga0373954_0046873 3300035118 Bacteria 2021
480 Ga0373943_0000203 3300035170 Bacteria 24333
481 Ga0373946_0002368 3300035171 Bacteria 6670
482 Ga0373924_0009107 3300035410 Unclassified 3632
483 Ga0373924_0022144 3300035410 Bacteria 2483
484 Ga0373931_0015544 3300035691 Bacteria 3735
485 Ga0373935_0040115 3300035692 Bacteria 2937
486 Ga0373935_0139061 3300035692 Unclassified 1639
487 Ga0373927_0000021 3300035695 Bacteria 124647
488 Ga0373927_0040900 3300035695 Bacteria 3007
489 Ga0373927_0278887 3300035695 Bacteria 1099
490 Ga0373933_0039743 3300035724 Unclassified 2769
491 Ga0373947_0000191 3300035725 Bacteria 33805
492 Ga0373947_0028928 3300035725 Bacteria 3251
493 Ga0373937_0051596 3300036401 Bacteria 3770
494 Ga0373937_0171612 3300036401 Unclassified 2035
495 Ga0373937_0213583 3300036401 Bacteria 1815
496 Ga0373925_0000151 3300037068 Bacteria 74246
497 Ga0373925_0044292 3300037068 Bacteria 3304
498 Ga0436364_0090931 3300037853 Bacteria 2271
499 Ga0436364_0226462 3300037853 Bacteria 1374
500 Ga0242420_015032 3300038996 Unclassified 1335
501 Ga0436360_0892093 3300039438 Bacteria 1401
502 Ga0436363_0533530 3300039450 Bacteria 1835
503 Ga0436363_1324554 3300039450 Bacteria 2350
504 Ga0451577_0002378 3300042876 Bacteria 22551
505 Ga0451577_0338080 3300042876 Bacteria 1366
506 Ga0451577_0433653 3300042876 Bacteria 1193
507 Ga0453683_0351221 3300044673 Bacteria 947
508 Ga0466963_0172588 3300044694 Bacteria 1508
509 Ga0453684_0000324 3300044712 Bacteria 201431
510 Ga0466957_0151348 3300044842 Unclassified 1501
511 Ga0451576_0010837 3300045051 Bacteria 10433
512 Ga0451576_0031045 3300045051 Bacteria 5699
513 Ga0451576_0147369 3300045051 Bacteria 2454
514 Ga0495651_0266700 3300046462 Unclassified 1163
515 Ga0495653_0168044 3300046463 Bacteria 1517
516 Ga0495653_0457910 3300046463 Bacteria 801
517 Ga0495580_0075295 3300046472 Bacteria 2355
518 Ga0495580_0080331 3300046472 Bacteria 2273
519 Ga0495580_0286529 3300046472 Bacteria 1123
520 Ga0495664_0005999 3300046477 Bacteria 6696
521 Ga0495594_0096512 3300046499 Unclassified 1661
522 Ga0495628_0517509 3300046516 Bacteria 860
523 Ga0495666_0155505 3300046526 Bacteria 1062
524 Ga0495665_0220432 3300046531 Bacteria 981
525 Ga0495623_0037658 3300046679 Bacteria 3094
526 Ga0495658_0068521 3300046683 Bacteria 2055
527 Ga0495674_0052295 3300047319 Bacteria 3595
528 Ga0495675_0070212 3300047444 Bacteria 2211
529 Ga0495602_0288515 3300048088 Bacteria 1206
530 Ga0495602_0316993 3300048088 Bacteria 1136
531 Ga0495602_0421472 3300048088 Bacteria 948
532 Ga0496101_0411440 3300048904 Bacteria 1066
533 Ga0496102_0558279 3300048905 Bacteria 1068
534 Ga0496103_0412101 3300048906 Bacteria 868
535 Ga0496104_0160826 3300048907 Unclassified 2154
536 Ga0496106_0046506 3300048909 Unclassified 3263
537 Ga0496106_0115331 3300048909 Bacteria 2095
538 Ga0496107_0054432 3300048910 Bacteria 2888
539 Ga0496108_0000688 3300048911 Bacteria 26194
540 Ga0496109_0230551 3300048912 Bacteria 1742
541 Ga0496110_0000893 3300048913 Bacteria 21042
542 Ga0496111_0004882 3300048914 Bacteria 8516
543 Ga0496111_0329919 3300048914 Unclassified 1130
544 Ga0496112_0000512 3300048915 Bacteria 26317
545 Ga0496112_0750642 3300048915 Bacteria 902
546 Ga0496113_0017485 3300048916 Bacteria 4978
547 Ga0496114_0160182 3300048917 Unclassified 1956
548 Ga0496115_0325254 3300048918 Unclassified 1257
549 Ga0496115_0367213 3300048918 Bacteria 1172
550 Ga0501299_007742 3300049522 Bacteria 1724
551 nmdc:mga05p37_889207_c1 3300050507 Unclassified 962
552 nmdc:mga0n895_47648_c1 3300050512 Bacteria 4191
553 nmdc:mga0rr50_14666_c1 3300050513 Bacteria 2182
554 nmdc:mga0rr50_28888_c1 3300050513 Bacteria 3903
555 nmdc:mga0rr50_32358_c1 3300050513 Bacteria 3726
556 nmdc:mga0rr50_5952_c1 3300050513 Bacteria 7348
557 nmdc:mga0rr50_741647_c1 3300050513 Bacteria 838
558 nmdc:mga08x19_128881_c1 3300050514 Bacteria 1701
559 nmdc:mga08x19_158109_c1 3300050514 Bacteria 1538
560 nmdc:mga08x19_162535_c1 3300050514 Unclassified 1517
561 nmdc:mga0a205_149_c2 3300050515 Bacteria 33259
562 nmdc:mga0a205_372909_c1 3300050515 Unclassified 1293
563 nmdc:mga0a205_8334_c1 3300050515 Bacteria 9424
564 Ga0495619_0304517 3300053085 Bacteria 1104
565 Ga0501084_0181892 3300054114 Unclassified 1775
566 Ga0213875_10106459
567 MBSR1b_contig_6142972
568 LJNas_1001344
569 Ga0065715_10105172
570 Ga0070676_10010631
571 Ga0070683_100002268
572 Ga0070690_100015140
573 Ga0070690_100377539
574 Ga0070670_100007488
575 Ga0070670_100013807
576 Ga0070670_100293922
577 Ga0068869_100001031
578 Ga0068869_100017672
579 Ga0068869_100019468
580 Ga0070666_10015167
581 Ga0070666_10087256
582 Ga0070682_100143022
583 Ga0070682_100327947
584 Ga0068868_100001274
585 Ga0068868_100003525
586 Ga0068868_100032638
587 Ga0068868_100076478
588 Ga0070660_100001737
589 Ga0070687_100055230
590 Ga0070661_100003397
591 Ga0070661_100004901
592 Ga0070661_100113903
593 Ga0070692_10090102
594 Ga0070668_100074012
595 Ga0070669_100037233
596 Ga0070675_100051727
597 Ga0070675_100101059
598 Ga0070675_100739357
599 Ga0070673_100021679
600 Ga0070673_100070220
601 Ga0070673_100083659
602 Ga0070688_100028516
603 Ga0070659_100049675
604 Ga0070667_100320998
605 Ga0070667_100606840
606 Ga0070709_10361162
607 Ga0070714_100007677
608 Ga0070714_100019607
609 Ga0070714_100231260
610 Ga0070714_100525739
611 Ga0070714_100540470
612 Ga0070713_100005719
613 Ga0070713_100006013
614 Ga0070713_100015855
615 Ga0070713_100081334
616 Ga0070713_100236825
617 Ga0070713_100395721
618 Ga0070713_100417986
619 Ga0070713_100552774
620 Ga0070710_10026849
621 Ga0070710_10058936
622 Ga0070701_10054142
623 Ga0070711_100002184
624 Ga0070711_100115709
625 Ga0070711_100175263
626 Ga0070711_100654614
627 Ga0070700_100206894
628 Ga0070694_100168918
629 Ga0070708_100013653
630 Ga0070663_100006908
631 Ga0070663_100007702
632 Ga0070678_100057332
633 Ga0070662_100006729
634 Ga0070662_100017556
635 Ga0070681_10000034
636 Ga0070681_10003943
637 Ga0070681_10011290
638 Ga0070681_10044615
639 Ga0070681_10233131
640 Ga0070681_10335764
641 Ga0068867_100013178
642 Ga0068867_100029442
643 Ga0070685_10003473
644 Ga0070685_10083580
645 Ga0070706_100002114
646 Ga0070706_100047769
647 Ga0070707_100006263
648 Ga0070707_100403703
649 Ga0070698_100000216
650 Ga0070698_100033368
651 Ga0070698_100048952
652 Ga0070699_100022523
653 Ga0070699_100125193
654 Ga0070699_100670693
655 Ga0070699_100871715
656 Ga0070679_100000270
657 Ga0070679_100072008
658 Ga0070679_100095226
659 Ga0070684_100003168
660 Ga0070684_100036211
661 Ga0070684_100321919
662 Ga0070697_100000763
663 Ga0070697_100007580
664 Ga0070697_100022129
665 Ga0070697_100026351
666 Ga0070697_100324742
667 Ga0070697_100339705
668 Ga0070697_100360906
669 Ga0068853_100021860
670 Ga0068853_100035868
671 Ga0068853_100055054
672 Ga0070672_100002457
673 Ga0070672_100616609
674 Ga0070686_100011378
675 Ga0070695_100072975
676 Ga0070695_100118064
677 Ga0070696_100049944
678 Ga0070696_100466138
679 Ga0070693_100074321
680 Ga0070693_100169969
681 Ga0070665_100008025
682 Ga0068855_100000414
683 Ga0068855_100003902
684 Ga0068855_100006845
685 Ga0068855_100020846
686 Ga0068855_100190557
687 Ga0070664_100001867
688 Ga0070664_100009789
689 Ga0070664_100030441
690 Ga0070664_100048159
691 Ga0070664_100597538
692 Ga0068857_100000145
693 Ga0068857_100000834
694 Ga0068857_100007151
695 Ga0068854_100003316
696 Ga0068854_100018013
697 Ga0068854_100023295
698 Ga0068854_100191964
699 Ga0068854_100239095
700 Ga0068854_100239776
701 Ga0068856_100000240
702 Ga0068856_100000541
703 Ga0068856_100001202
704 Ga0068856_100001857
705 Ga0068856_100006280
706 Ga0068856_100009947
707 Ga0068856_100085458
708 Ga0068856_100448963
709 Ga0068856_100571119
710 Ga0070702_100015230
711 Ga0068852_100009567
712 Ga0068852_100030141
713 Ga0068859_100002087
714 Ga0068859_100359756
715 Ga0068864_100000293
716 Ga0068864_100033248
717 Ga0068864_100079355
718 Ga0068864_100087153
719 Ga0068866_10001118
720 Ga0068866_10007735
721 Ga0068861_100259135
722 Ga0068851_10003080
723 Ga0068851_10016663
724 Ga0068870_10005005
725 Ga0068863_100022639
726 Ga0068858_100001387
727 Ga0068858_100017995
728 Ga0068858_100020235
729 Ga0068858_100025114
730 Ga0068860_100028042
731 Ga0068860_100132780
732 Ga0068860_100370052
733 Ga0068862_100007154
734 Ga0068862_100012824
735 Ga0070717_10005017
736 Ga0070717_10032919
737 Ga0070717_10063272
738 Ga0070717_10331919
739 Ga0070717_10451909
740 Ga0070717_11001399
741 Ga0070715_10213222
742 Ga0070716_100087155
743 Ga0097621_100000770
744 Ga0097621_100000942
745 Ga0097621_100001923
746 Ga0097621_100012372
747 Ga0097621_100065605
748 Ga0097621_100195472
749 Ga0068871_100000071
750 Ga0068871_100000585
751 Ga0068871_100003890
752 Ga0068871_100023995
753 Ga0075431_100399977
754 Ga0075433_10000127
755 Ga0075433_10206350
756 Ga0075433_10249675
757 Ga0075434_100012727
758 Ga0075434_100218197
759 Ga0068865_100248692
760 Ga0068865_100473834
761 Ga0075436_100058457
762 Ga0075436_100083064
763 Ga0075436_100187412
764 Ga0075436_100226554
765 Ga0097620_100002087
766 Ga0097620_100359765
767 Ga0075435_100025257
768 Ga0075435_100031557
769 Ga0075435_100485620
770 Ga0099794_10022551
771 Ga0105250_10035006
772 Ga0105240_10013436
773 Ga0105240_10052938
774 Ga0105240_10130648
775 Ga0105245_10003303
776 Ga0105245_10016949
777 Ga0105245_10060706
778 Ga0105245_10306763
779 Ga0105247_10016766
780 Ga0105247_10281353
781 Ga0114129_10151681
782 Ga0105243_10017773
783 Ga0105241_10014684
784 Ga0105241_10160150
785 Ga0105242_10022075
786 Ga0105242_10060740
787 Ga0105242_10509094
788 Ga0105242_10813091
789 Ga0105248_10023387
790 Ga0105248_10070055
791 Ga0105248_10089270
792 Ga0105248_10147309
793 Ga0105237_10019488
794 Ga0105237_10042061
795 Ga0105237_10075863
796 Ga0105237_10107596
797 Ga0105237_10247183
798 Ga0105238_10023564
799 Ga0105238_10230039
800 Ga0105238_10553770
801 Ga0105249_10009361
802 Ga0105249_10015312
803 Ga0105239_10014391
804 Ga0105239_10143491
805 Ga0105239_10187413
806 Ga0105239_10211800
807 Ga0105239_10349918
808 Ga0105239_10458747
809 Ga0105239_10824473
810 Ga0105246_10002874
811 Ga0105246_10135186
812 Ga0157327_1013810
813 Ga0157373_10004095
814 Ga0157373_10022757
815 Ga0157371_10008143
816 Ga0157371_10025328
817 Ga0157370_10021428
818 Ga0157370_10460298
819 Ga0157369_10005194
820 Ga0157369_10008060
821 Ga0157369_10023247
822 Ga0157369_10035790
823 Ga0157369_10084394
824 Ga0157369_10176902
825 Ga0157374_10005372
826 Ga0157374_10092958
827 Ga0157374_10157490
828 Ga0157374_10694591
829 Ga0157378_10001634
830 Ga0163162_10012219
831 Ga0163162_10021539
832 Ga0163162_10061989
833 Ga0163162_10388574
834 Ga0157372_10002160
835 Ga0157372_10014358
836 Ga0157372_10015395
837 Ga0157372_10020186
838 Ga0157372_10236505
839 Ga0157372_10653785
840 Ga0157372_11185826
841 Ga0157375_10029320
842 Ga0157375_10098948
843 Ga0163163_10016165
844 Ga0163163_10019901
845 Ga0163163_10023045
846 Ga0163163_10062922
847 Ga0157380_10042620
848 Ga0182008_10013280
849 Ga0157377_10000261
850 Ga0157379_10023173
851 Ga0157379_10069967
852 Ga0157379_10712760
853 Ga0157376_10005335
854 Ga0157376_10067992
855 Ga0157376_10114586
856 Ga0157376_10118585
857 Ga0182006_1024873
858 Ga0163161_10288156
859 Ga0224570_100355
860 Ga0224571_102978
861 Ga0224572_1003222
862 Ga0224572_1004423
863 Ga0228598_1000300
864 Ga0207697_10002331
865 Ga0207697_10203149
866 Ga0207692_10383202
867 Ga0207642_10130626
868 Ga0207710_10166890
869 Ga0207688_10118229
870 Ga0207680_10018009
871 Ga0207647_10119953
872 Ga0207647_10203190
873 Ga0207647_10204364
874 Ga0207699_10013093
875 Ga0207699_10040415
876 Ga0207699_10350813
877 Ga0207699_10447539
878 Ga0207645_10000371
879 Ga0207645_10007671
880 Ga0207645_10077986
881 Ga0207643_10001893
882 Ga0207684_10001445
883 Ga0207684_10001633
884 Ga0207684_10063157
885 Ga0207654_10011428
886 Ga0207654_10026648
887 Ga0207654_10091299
888 Ga0207654_10190114
889 Ga0207707_10000891
890 Ga0207707_10115550
891 Ga0207707_10148112
892 Ga0207695_10115209
893 Ga0207695_10144983
894 Ga0207695_10251120
895 Ga0207671_10210455
896 Ga0207671_10417637
897 Ga0207671_10503415
898 Ga0207671_10686653
899 Ga0207693_10068757
900 Ga0207693_10160812
901 Ga0207663_10003040
902 Ga0207663_10032755
903 Ga0207663_10194096
904 Ga0207660_10073951
905 Ga0207660_10086859
906 Ga0207660_10214962
907 Ga0207657_10001273
908 Ga0207649_10000697
909 Ga0207652_10268517
910 Ga0207652_10509253
911 Ga0207646_10002176
912 Ga0207646_10002443
913 Ga0207646_10188017
914 Ga0207646_10380357
915 Ga0207694_10002206
916 Ga0207694_10097061
917 Ga0207694_10709708
918 Ga0207650_10000040
919 Ga0207650_10005212
920 Ga0207650_10108932
921 Ga0207659_10018811
922 Ga0207687_10006491
923 Ga0207687_10088770
924 Ga0207687_10437912
925 Ga0207687_10678073
926 Ga0207700_10007046
927 Ga0207700_10180658
928 Ga0207700_10622162
929 Ga0207700_10986993
930 Ga0207664_10000369
931 Ga0207664_10002569
932 Ga0207664_10922298
933 Ga0207690_10201361
934 Ga0207706_10000141
935 Ga0207706_10012156
936 Ga0207706_10017331
937 Ga0207686_10728598
938 Ga0207670_10031072
939 Ga0207704_10397197
940 Ga0207665_10082150
941 Ga0207665_10172765
942 Ga0207665_10267376
943 Ga0207665_10338175
944 Ga0207691_10002237
945 Ga0207711_10007921
946 Ga0207711_10016324
947 Ga0207711_10071391
948 Ga0207711_10093472
949 Ga0207711_10388225
950 Ga0207689_10005382
951 Ga0207689_10021981
952 Ga0207689_10088662
953 Ga0207661_10001100
954 Ga0207661_10080422
955 Ga0207679_10001034
956 Ga0207679_10032896
957 Ga0207679_10035710
958 Ga0207679_10569754
959 Ga0207679_10704764
960 Ga0207667_10000535
961 Ga0207667_10000827
962 Ga0207667_10016800
963 Ga0207667_10046289
964 Ga0207667_10058308
965 Ga0207667_10100655
966 Ga0207651_10049725
967 Ga0207668_10045138
968 Ga0207640_10026311
969 Ga0207640_10034677
970 Ga0207640_10150673
971 Ga0207640_10182780
972 Ga0207640_10239360
973 Ga0207658_10118835
974 Ga0207658_10167995
975 Ga0207677_10038541
976 Ga0207677_10056566
977 Ga0207677_10112082
978 Ga0207703_10053079
979 Ga0207703_10063632
980 Ga0207703_10091794
981 Ga0207639_10128615
982 Ga0207639_10179206
983 Ga0207678_10005178
984 Ga0207678_10005837
985 Ga0207708_10103129
986 Ga0207708_10183279
987 Ga0207702_10000612
988 Ga0207702_10000711
989 Ga0207702_10001271
990 Ga0207702_10008768
991 Ga0207702_10013145
992 Ga0207702_10016811
993 Ga0207702_10051864
994 Ga0207702_10095898
995 Ga0207702_10286797
996 Ga0207702_10325052
997 Ga0207641_10000009
998 Ga0207641_10005057
999 Ga0207641_10555034
1000 Ga0207641_10685972
1001 Ga0207648_10001357
1002 Ga0207648_10003568
1003 Ga0207648_10008523
1004 Ga0207676_10000153
1005 Ga0207676_10013127
1006 Ga0207676_10400048
1007 Ga0207674_10000010
1008 Ga0207674_10011363
1009 Ga0207674_10020214
1010 Ga0207675_100118375
1011 Ga0207683_10001748
1012 Ga0207683_10103405
1013 Ga0207698_10009943
1014 Ga0207698_10090448
1015 Ga0207698_10105167
1016 Ga0207698_10277147
1017 Ga0207698_10861974
1018 Ga0207698_10893326
1019 Ga0265356_1001776
1020 Ga0268265_10077886
1021 Ga0268264_10068654
1022 Ga0268264_10103833
1023 Ga0265338_10077469
1024 Ga0265762_1005727
1025 Ga0265762_1028413
1026 Ga0265771_1003021
1027 Ga0265760_10001194
1028 Ga0265760_10002427
1029 Ga0265760_10015268
1030 Ga0265339_10113914
1031 Ga0265314_10109191
1032 Ga0307406_10099777
1033 Ga0307416_100038610
1034 Ga0307411_10034992
1035 Ga0307415_100522343
1036 Ga0373958_0047443
1037 Ga0373923_0027052
1038 Ga0373923_0057893
1039 Ga0373936_0025677
1040 Ga0373936_0206783
1041 Ga0373941_0021293
1042 Ga0373945_0004610
1043 Ga0373953_0065646
1044 Ga0373954_0046873
1045 Ga0373943_0000203
1046 Ga0373946_0002368
1047 Ga0373924_0009107
1048 Ga0373924_0022144
1049 Ga0373931_0015544
1050 Ga0373935_0040115
1051 Ga0373935_0139061
1052 Ga0373927_0000021
1053 Ga0373927_0040900
1054 Ga0373927_0278887
1055 Ga0373933_0039743
1056 Ga0373947_0000191
1057 Ga0373947_0028928
1058 Ga0373937_0051596
1059 Ga0373937_0171612
1060 Ga0373937_0213583
1061 Ga0373925_0000151
1062 Ga0373925_0044292
1063 Ga0436364_0090931
1064 Ga0436364_0226462
1065 Ga0242420_015032
1066 Ga0436360_0892093
1067 Ga0436363_0533530
1068 Ga0436363_1324554
1069 Ga0451577_0002378
1070 Ga0451577_0338080
1071 Ga0451577_0433653
1072 Ga0453683_0351221
1073 Ga0466963_0172588
1074 Ga0453684_0000324
1075 Ga0466957_0151348
1076 Ga0451576_0010837
1077 Ga0451576_0031045
1078 Ga0451576_0147369
1079 Ga0495651_0266700
1080 Ga0495653_0168044
1081 Ga0495653_0457910
1082 Ga0495580_0075295
1083 Ga0495580_0080331
1084 Ga0495580_0286529
1085 Ga0495664_0005999
1086 Ga0495594_0096512
1087 Ga0495628_0517509
1088 Ga0495666_0155505
1089 Ga0495665_0220432
1090 Ga0495623_0037658
1091 Ga0495658_0068521
1092 Ga0495674_0052295
1093 Ga0495675_0070212
1094 Ga0495602_0288515
1095 Ga0495602_0316993
1096 Ga0495602_0421472
1097 Ga0496101_0411440
1098 Ga0496102_0558279
1099 Ga0496103_0412101
1100 Ga0496104_0160826
1101 Ga0496106_0046506
1102 Ga0496106_0115331
1103 Ga0496107_0054432
1104 Ga0496108_0000688
1105 Ga0496109_0230551
1106 Ga0496110_0000893
1107 Ga0496111_0004882
1108 Ga0496111_0329919
1109 Ga0496112_0000512
1110 Ga0496112_0750642
1111 Ga0496113_0017485
1112 Ga0496114_0160182
1113 Ga0496115_0325254
1114 Ga0496115_0367213
1115 Ga0501299_007742
1116 nmdc:mga05p37_889207_c1
1117 nmdc:mga0n895_47648_c1
1118 nmdc:mga0rr50_14666_c1
1119 nmdc:mga0rr50_28888_c1
1120 nmdc:mga0rr50_32358_c1
1121 nmdc:mga0rr50_5952_c1
1122 nmdc:mga0rr50_741647_c1
1123 nmdc:mga08x19_128881_c1
1124 nmdc:mga08x19_158109_c1
1125 nmdc:mga08x19_162535_c1
1126 nmdc:mga0a205_149_c2
1127 nmdc:mga0a205_372909_c1
1128 nmdc:mga0a205_8334_c1
1129 Ga0495619_0304517
1130 Ga0501084_0181892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10263

SprT-like

SprT-like family

128

233

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.7836 121 227
7vrc-assembly2.cif.gz_D structure of the yeast snf11/snf2 complex 0.7604 60 101
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.76 121 227
4qhg-assembly1.cif.gz_A-2 crystal structure of methanocaldococcus jannaschii dimeric selecase 0.758 121 227
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.7256 121 227
ID Description Score Start End Superfamily
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7836 121 227 3.30.2010.10
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7256 121 227 3.30.2010.10
4jixB00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7035 119 226 3.30.2010.10
af_A0A1D6LI78_20_121_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6995 5 75 3.30.2010.10
af_A0A1D6FHQ3_2_88_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6918 5 73 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A3M1Q8X3-F1-model_v4 M48 family peptidase 0.95 112 228 GO:0033554
AF-A0A2V9KT68-F1-model_v4 SprT-like domain-containing protein 0.9494 106 226 GO:0033554
AF-A0A2V8RHF1-F1-model_v4 SprT-like domain-containing protein 0.9487 114 227 GO:0033554
AF-A0A2H9MEU1-F1-model_v4 SprT-like family protein 0.946 116 228
AF-A0A3M1Q8X3-F1-model_v4 M48 family peptidase 0.9418 112 228 GO:0033554

Map