F464276

General Info

Members Datasets Scaffolds Average Seq Length
565 252 1130 358

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10088462|Ga0207648_100884622
Length 400
Sequence MDYVYAAFRGEASPGRRSARMPELRAFAAATKRIARLLHCGIMTAEPQEMRVSRGYNFSAGPAALPDEVLRQAQAELLEWDGARASVMEISHRGKDFIALAEESERDLRDLLAIPANYKVLFLQGGATQHFAQIPMNIARRDQSADYVRTGDWSEKAVKEAQPLVNVRIVADSSATNYDRIPPRDSWDLDPNAAYLHYTPNETIRGVEFHEIPDTGNVPLVADMSSTILSRPLDVSRFGLIYAGAQKNIGASGLVVLIVRDDLLARCPKDLPKIFNYAEQAAQGSMLNTPNTYGWYLSALVFKWLKKQGGLAAMAERNRAKAELLYGYIDASGYYKNPVEKSARSWMNWTTRRASSVSSGVSTKRRAAPASRSHHRRLPLRSRLFSITALAAARMLPVER

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
145 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
228 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
236 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
237 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
238 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
239 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
240 2738543009 Luteibacter sp. OK325 Isolate Unclassified
241 2739367700 Dyella sp. YR388 Isolate Unclassified
242 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
243 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
244 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
245 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
246 2884411467 Dyella sp. AD56 Isolate Rhizosphere
247 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
248 2919085039 Luteibacter sp. 1214 Isolate Unclassified
249 2919404418 Luteibacter sp. 3190 Isolate Unclassified
250 2928963466 Dyella japonica 1073 Isolate Unclassified
251 2941471342 Luteibacter sp. 621 Isolate Unclassified
252 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 0.18
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.96
Nodule 0
Rhizoplane 1.59
Rhizosphere 77.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10088462 3300026089 Bacteria 2704
2 JGI24740J21852_10011760 3300001979 Bacteria 3321
3 JGI24738J21930_10002434 3300002075 Bacteria 4878
4 JGI25162J39368_1002553 3300002737 Bacteria 6925
5 JGI25164J39214_1000040 3300002772 Bacteria 127780
6 JGI25165J46597_1000009 3300003214 Bacteria 467965
7 rootH2_10005772 3300003320 Bacteria 29295
8 Ga0006562J51391_1004986 3300003578 Bacteria 8150
9 Ga0055535_1000016 3300003761 Bacteria 252398
10 Ga0055535_1000048 3300003761 Bacteria 139301
11 Ga0055542_1001683 3300003762 Bacteria 9775
12 Ga0065165_1000028 3300005262 Bacteria 224430
13 Ga0070670_100115625 3300005331 Bacteria 2313
14 Ga0070666_10008572 3300005335 Bacteria 6353
15 Ga0070666_10073544 3300005335 Bacteria 2328
16 Ga0070661_100228523 3300005344 Bacteria 1429
17 Ga0070688_100025935 3300005365 Bacteria 3476
18 Ga0070659_100189916 3300005366 Bacteria 1688
19 Ga0070667_100000173 3300005367 Bacteria 79829
20 Ga0070667_100008807 3300005367 Bacteria 8361
21 Ga0070667_100017470 3300005367 Bacteria 5945
22 Ga0070667_100047402 3300005367 Bacteria 3615
23 Ga0070667_100078450 3300005367 Bacteria 2821
24 Ga0070667_100224524 3300005367 Bacteria 1673
25 Ga0070710_10025354 3300005437 Bacteria 3140
26 Ga0070711_100120797 3300005439 Bacteria 1937
27 Ga0070708_100479799 3300005445 Bacteria 1173
28 Ga0070663_100000433 3300005455 Bacteria 22073
29 Ga0070678_100108020 3300005456 Bacteria 2171
30 Ga0070662_100017994 3300005457 Bacteria 4773
31 Ga0070662_100099283 3300005457 Bacteria 2200
32 Ga0070681_10000007 3300005458 Bacteria 159821
33 Ga0070681_10003054 3300005458 Bacteria 15517
34 Ga0070681_10043663 3300005458 Bacteria 4489
35 Ga0070685_10000515 3300005466 Bacteria 22275
36 Ga0070679_100390710 3300005530 Bacteria 1337
37 Ga0070684_100010032 3300005535 Bacteria 7487
38 Ga0068853_100000439 3300005539 Bacteria 28384
39 Ga0068853_100013373 3300005539 Bacteria 6699
40 Ga0068853_100028182 3300005539 Bacteria 4722
41 Ga0068853_100030054 3300005539 Bacteria 4586
42 Ga0068853_100034355 3300005539 Bacteria 4304
43 Ga0068853_100181571 3300005539 Bacteria 1908
44 Ga0070693_100017740 3300005547 Bacteria 3706
45 Ga0070665_100000227 3300005548 Bacteria 93439
46 Ga0070665_100023207 3300005548 Bacteria 6248
47 Ga0068855_100001280 3300005563 Bacteria 31168
48 Ga0068855_100035350 3300005563 Bacteria 5952
49 Ga0068855_100051677 3300005563 Bacteria 4841
50 Ga0068855_100400719 3300005563 Bacteria 1504
51 Ga0070664_100060010 3300005564 Bacteria 3238
52 Ga0068857_100056888 3300005577 Bacteria 3471
53 Ga0068857_100076327 3300005577 Bacteria 2988
54 Ga0068857_100112156 3300005577 Bacteria 2452
55 Ga0068854_100005461 3300005578 Bacteria 8028
56 Ga0068854_100010222 3300005578 Bacteria 6081
57 Ga0068854_100010384 3300005578 Bacteria 6036
58 Ga0068854_100097475 3300005578 Bacteria 2198
59 Ga0068856_100015367 3300005614 Bacteria 7398
60 Ga0068856_100022889 3300005614 Bacteria 6077
61 Ga0068856_100036939 3300005614 Bacteria 4791
62 Ga0068852_100081253 3300005616 Bacteria 2876
63 Ga0068852_100126299 3300005616 Bacteria 2349
64 Ga0068852_100127671 3300005616 Bacteria 2337
65 Ga0068859_100000208 3300005617 Bacteria 58155
66 Ga0068859_100007900 3300005617 Bacteria 10796
67 Ga0068864_100073327 3300005618 Bacteria 2984
68 Ga0068861_100203526 3300005719 Bacteria 1663
69 Ga0068851_10002998 3300005834 Bacteria 7457
70 Ga0068851_10024596 3300005834 Bacteria 2949
71 Ga0068851_10046488 3300005834 Bacteria 2196
72 Ga0068851_10126104 3300005834 Bacteria 1380
73 Ga0068863_100012788 3300005841 Bacteria 8094
74 Ga0068863_100066067 3300005841 Bacteria 3422
75 Ga0068863_100066370 3300005841 Bacteria 3413
76 Ga0068863_100201378 3300005841 Bacteria 1915
77 Ga0068863_100316293 3300005841 Bacteria 1516
78 Ga0068858_100004910 3300005842 Bacteria 13098
79 Ga0068858_100010974 3300005842 Bacteria 8561
80 Ga0068858_100041080 3300005842 Bacteria 4290
81 Ga0068860_100010648 3300005843 Bacteria 9080
82 Ga0068860_100092308 3300005843 Bacteria 2885
83 Ga0068862_100000707 3300005844 Bacteria 34098
84 Ga0068862_100094751 3300005844 Bacteria 2604
85 Ga0081540_1007060 3300005983 Bacteria 8072
86 Ga0075369_10047500 3300006186 Bacteria 1851
87 Ga0097621_100017131 3300006237 Bacteria 5497
88 Ga0097621_100034184 3300006237 Bacteria 4053
89 Ga0097621_100134832 3300006237 Bacteria 2105
90 Ga0097621_100135731 3300006237 Bacteria 2098
91 Ga0068871_100023135 3300006358 Bacteria 4801
92 Ga0068871_100053478 3300006358 Bacteria 3273
93 Ga0068871_100065306 3300006358 Bacteria 2980
94 Ga0068871_100082460 3300006358 Bacteria 2666
95 Ga0068871_100134623 3300006358 Bacteria 2098
96 Ga0068871_100182223 3300006358 Bacteria 1805
97 Ga0068871_100297631 3300006358 Bacteria 1415
98 Ga0068865_100011953 3300006881 Bacteria 5452
99 Ga0068865_100056549 3300006881 Bacteria 2734
100 Ga0097620_100000208 3300006931 Bacteria 58155
101 Ga0097620_100007900 3300006931 Bacteria 10796
102 Ga0105240_10001318 3300009093 Bacteria 42836
103 Ga0105240_10019942 3300009093 Bacteria 8953
104 Ga0105240_10019997 3300009093 Bacteria 8938
105 Ga0105240_10069134 3300009093 Bacteria 4372
106 Ga0105240_10099311 3300009093 Bacteria 3543
107 Ga0105240_10184843 3300009093 Bacteria 2456
108 Ga0105240_10216379 3300009093 Bacteria 2235
109 Ga0105240_10274862 3300009093 Bacteria 1938
110 Ga0105240_10500969 3300009093 Bacteria 1350
111 Ga0105245_10077853 3300009098 Bacteria 3024
112 Ga0105247_10005381 3300009101 Bacteria 8067
113 Ga0105247_10013972 3300009101 Bacteria 4814
114 Ga0105241_10004304 3300009174 Bacteria 10528
115 Ga0105241_10067244 3300009174 Bacteria 2773
116 Ga0105241_10216357 3300009174 Bacteria 1608
117 Ga0105248_10004348 3300009177 Bacteria 15668
118 Ga0105248_10026152 3300009177 Bacteria 6493
119 Ga0105248_10101162 3300009177 Bacteria 3248
120 Ga0105248_10383073 3300009177 Bacteria 1583
121 Ga0105237_10000345 3300009545 Bacteria 65477
122 Ga0105237_10000701 3300009545 Bacteria 46447
123 Ga0105237_10009096 3300009545 Bacteria 10675
124 Ga0105237_10026363 3300009545 Bacteria 5940
125 Ga0105237_10159927 3300009545 Bacteria 2251
126 Ga0105238_10004916 3300009551 Bacteria 13227
127 Ga0105238_10007187 3300009551 Bacteria 11140
128 Ga0105238_10015088 3300009551 Bacteria 7824
129 Ga0105238_10056411 3300009551 Bacteria 3941
130 Ga0105238_10144244 3300009551 Bacteria 2358
131 Ga0105238_10297369 3300009551 Bacteria 1597
132 Ga0105238_10381908 3300009551 Bacteria 1400
133 Ga0105238_10527848 3300009551 Bacteria 1183
134 Ga0105249_10000175 3300009553 Bacteria 74934
135 Ga0105249_10005249 3300009553 Bacteria 11183
136 Ga0105249_10016630 3300009553 Bacteria 6530
137 Ga0105239_10000041 3300010375 Bacteria 200922
138 Ga0105239_10027130 3300010375 Bacteria 6305
139 Ga0105239_10040341 3300010375 Bacteria 5115
140 Ga0105239_10057803 3300010375 Bacteria 4255
141 Ga0105239_10086724 3300010375 Bacteria 3451
142 Ga0105239_10184358 3300010375 Bacteria 2335
143 Ga0105239_10265601 3300010375 Bacteria 1929
144 Ga0105239_10364473 3300010375 Bacteria 1632
145 Ga0105246_10140221 3300011119 Bacteria 1817
146 Ga0157370_10000124 3300013104 Bacteria 91398
147 Ga0157370_10007635 3300013104 Bacteria 11740
148 Ga0157370_10036239 3300013104 Bacteria 4788
149 Ga0157370_10050913 3300013104 Bacteria 3957
150 Ga0157370_10114875 3300013104 Bacteria 2515
151 Ga0157370_10315640 3300013104 Bacteria 1442
152 Ga0157369_10000028 3300013105 Bacteria 213910
153 Ga0157369_10000406 3300013105 Bacteria 57192
154 Ga0157369_10107436 3300013105 Bacteria 2969
155 Ga0157369_10337730 3300013105 Bacteria 1565
156 Ga0157374_10016097 3300013296 Bacteria 6571
157 Ga0157374_10224539 3300013296 Bacteria 1844
158 Ga0157374_10266165 3300013296 Bacteria 1690
159 Ga0157378_10000006 3300013297 Bacteria 192683
160 Ga0157378_10073729 3300013297 Bacteria 3069
161 Ga0163162_10157401 3300013306 Bacteria 2392
162 Ga0157372_10001879 3300013307 Bacteria 22756
163 Ga0157372_10012045 3300013307 Bacteria 9210
164 Ga0157372_10034901 3300013307 Bacteria 5534
165 Ga0157372_10209282 3300013307 Bacteria 2260
166 Ga0157375_10089542 3300013308 Bacteria 3134
167 Ga0163163_10001216 3300014325 Bacteria 21766
168 Ga0163163_10009320 3300014325 Bacteria 8757
169 Ga0163163_10023731 3300014325 Bacteria 5826
170 Ga0163163_10301755 3300014325 Bacteria 1654
171 Ga0182008_10002192 3300014497 Bacteria 12398
172 Ga0182008_10047133 3300014497 Bacteria 2142
173 Ga0182008_10067120 3300014497 Bacteria 1765
174 Ga0157379_10004969 3300014968 Bacteria 11411
175 Ga0157379_10090791 3300014968 Bacteria 2740
176 Ga0157379_10279324 3300014968 Bacteria 1519
177 Ga0157379_10446154 3300014968 Bacteria 1194
178 Ga0157376_10000471 3300014969 Bacteria 25943
179 Ga0157376_10252975 3300014969 Bacteria 1646
180 Ga0157376_10364555 3300014969 Bacteria 1387
181 Ga0182006_1000367 3300015261 Bacteria 37426
182 Ga0182006_1000510 3300015261 Bacteria 29601
183 Ga0182006_1010892 3300015261 Bacteria 4023
184 Ga0182007_10007807 3300015262 Bacteria 4449
185 Ga0182005_1000129 3300015265 Bacteria 53573
186 Ga0182005_1002462 3300015265 Bacteria 6597
187 Ga0183369_1008 3300015685 Bacteria 346514
188 Ga0163161_10024376 3300017792 Bacteria 4273
189 Ga0209760_100485 3300025207 Bacteria 8474
190 Ga0209784_100013 3300025224 Bacteria 518664
191 Ga0209674_100300 3300025226 Bacteria 34463
192 Ga0209672_101710 3300025228 Bacteria 7048
193 Ga0207427_100030 3300025231 Bacteria 358045
194 Ga0207427_100201 3300025231 Bacteria 56684
195 Ga0207427_102613 3300025231 Bacteria 4612
196 Ga0209437_100012 3300025233 Bacteria 792625
197 Ga0209437_100151 3300025233 Bacteria 156418
198 Ga0209437_103919 3300025233 Bacteria 2647
199 Ga0209258_100019 3300025242 Bacteria 566728
200 Ga0209646_1000408 3300025246 Bacteria 24943
201 Ga0209026_1000015 3300025250 Bacteria 395555
202 Ga0209026_1004656 3300025250 Bacteria 3982
203 Ga0209148_1000001 3300025254 Bacteria 2545271
204 Ga0209148_1000005 3300025254 Bacteria 1806504
205 Ga0209148_1001705 3300025254 Bacteria 9702
206 Ga0209759_1000144 3300025256 Bacteria 121828
207 Ga0209759_1010630 3300025256 Bacteria 2685
208 Ga0209129_1000194 3300025258 Bacteria 80824
209 Ga0209129_1001221 3300025258 Bacteria 14725
210 Ga0209233_1000002 3300025261 Bacteria 2501366
211 Ga0209233_1000020 3300025261 Bacteria 798224
212 Ga0209233_1011937 3300025261 Bacteria 2540
213 Ga0209455_1000027 3300025272 Bacteria 566710
214 Ga0209455_1005579 3300025272 Bacteria 3862
215 Ga0209758_1000980 3300025297 Bacteria 38371
216 Ga0209256_1014339 3300025299 Bacteria 2859
217 Ga0207426_1008219 3300025302 Bacteria 4247
218 Ga0209051_1009110 3300025303 Bacteria 5154
219 Ga0207656_10002475 3300025321 Bacteria 6233
220 Ga0207656_10018904 3300025321 Bacteria 2719
221 Ga0207656_10090799 3300025321 Bacteria 1386
222 Ga0207680_10000616 3300025903 Bacteria 16825
223 Ga0207680_10023050 3300025903 Bacteria 3394
224 Ga0207680_10032227 3300025903 Bacteria 2977
225 Ga0207680_10163521 3300025903 Bacteria 1494
226 Ga0207647_10000006 3300025904 Bacteria 214791
227 Ga0207647_10000213 3300025904 Bacteria 47297
228 Ga0207647_10001220 3300025904 Bacteria 19782
229 Ga0207647_10013889 3300025904 Bacteria 5574
230 Ga0207654_10000128 3300025911 Bacteria 49057
231 Ga0207654_10025993 3300025911 Bacteria 3165
232 Ga0207654_10051388 3300025911 Bacteria 2372
233 Ga0207654_10172991 3300025911 Bacteria 1404
234 Ga0207707_10001116 3300025912 Bacteria 25500
235 Ga0207707_10056058 3300025912 Bacteria 3428
236 Ga0207695_10000007 3300025913 Bacteria 1092551
237 Ga0207695_10000311 3300025913 Bacteria 117484
238 Ga0207695_10001506 3300025913 Bacteria 38709
239 Ga0207695_10002811 3300025913 Bacteria 25308
240 Ga0207695_10005092 3300025913 Bacteria 17615
241 Ga0207695_10029378 3300025913 Bacteria 6077
242 Ga0207695_10051841 3300025913 Bacteria 4305
243 Ga0207695_10054159 3300025913 Bacteria 4191
244 Ga0207695_10113421 3300025913 Bacteria 2687
245 Ga0207671_10000050 3300025914 Bacteria 190479
246 Ga0207671_10001138 3300025914 Bacteria 31946
247 Ga0207671_10001184 3300025914 Bacteria 31016
248 Ga0207671_10023696 3300025914 Bacteria 4626
249 Ga0207671_10037847 3300025914 Bacteria 3577
250 Ga0207671_10039982 3300025914 Bacteria 3472
251 Ga0207657_10023590 3300025919 Bacteria 5725
252 Ga0207649_10174815 3300025920 Bacteria 1499
253 Ga0207694_10002986 3300025924 Bacteria 13563
254 Ga0207694_10005785 3300025924 Bacteria 9470
255 Ga0207694_10035034 3300025924 Bacteria 3850
256 Ga0207694_10055965 3300025924 Bacteria 3063
257 Ga0207694_10150626 3300025924 Bacteria 1874
258 Ga0207694_10343683 3300025924 Bacteria 1234
259 Ga0207650_10124558 3300025925 Bacteria 2010
260 Ga0207659_10018487 3300025926 Bacteria 4570
261 Ga0207687_10108769 3300025927 Bacteria 2053
262 Ga0207706_10011704 3300025933 Bacteria 7999
263 Ga0207706_10021569 3300025933 Bacteria 5783
264 Ga0207706_10340063 3300025933 Bacteria 1306
265 Ga0207704_10051861 3300025938 Bacteria 2484
266 Ga0207704_10060953 3300025938 Bacteria 2337
267 Ga0207711_10003763 3300025941 Bacteria 13059
268 Ga0207711_10144797 3300025941 Bacteria 2140
269 Ga0207661_10288409 3300025944 Bacteria 1468
270 Ga0207679_10180763 3300025945 Bacteria 1745
271 Ga0207667_10000031 3300025949 Bacteria 323587
272 Ga0207667_10000125 3300025949 Bacteria 118155
273 Ga0207667_10002512 3300025949 Bacteria 22872
274 Ga0207667_10058545 3300025949 Bacteria 4040
275 Ga0207667_10064893 3300025949 Bacteria 3810
276 Ga0207667_10164611 3300025949 Bacteria 2280
277 Ga0207712_10000169 3300025961 Bacteria 67461
278 Ga0207712_10000600 3300025961 Bacteria 28673
279 Ga0207668_10061427 3300025972 Bacteria 2643
280 Ga0207668_10306466 3300025972 Bacteria 1312
281 Ga0207640_10000188 3300025981 Bacteria 44053
282 Ga0207640_10001407 3300025981 Bacteria 13002
283 Ga0207640_10002862 3300025981 Bacteria 9255
284 Ga0207640_10080560 3300025981 Bacteria 2223
285 Ga0207640_10112983 3300025981 Bacteria 1930
286 Ga0207658_10000111 3300025986 Bacteria 89180
287 Ga0207658_10116044 3300025986 Bacteria 2126
288 Ga0207677_10058396 3300026023 Bacteria 2656
289 Ga0207703_10009159 3300026035 Bacteria 7793
290 Ga0207703_10030731 3300026035 Bacteria 4244
291 Ga0207639_10000800 3300026041 Bacteria 21366
292 Ga0207639_10001755 3300026041 Bacteria 14589
293 Ga0207639_10008119 3300026041 Bacteria 7177
294 Ga0207639_10009912 3300026041 Bacteria 6581
295 Ga0207639_10021645 3300026041 Bacteria 4621
296 Ga0207639_10029521 3300026041 Bacteria 4015
297 Ga0207639_10397950 3300026041 Bacteria 1240
298 Ga0207678_10001607 3300026067 Bacteria 20786
299 Ga0207678_10063712 3300026067 Bacteria 3168
300 Ga0207702_10006397 3300026078 Bacteria 10161
301 Ga0207702_10210800 3300026078 Bacteria 1806
302 Ga0207702_10435740 3300026078 Bacteria 1269
303 Ga0207641_10039464 3300026088 Bacteria 3949
304 Ga0207641_10077091 3300026088 Bacteria 2883
305 Ga0207648_10023413 3300026089 Bacteria 5532
306 Ga0207676_10202151 3300026095 Bacteria 1756
307 Ga0207674_10004088 3300026116 Bacteria 17675
308 Ga0207674_10012210 3300026116 Bacteria 9608
309 Ga0207674_10021098 3300026116 Bacteria 7023
310 Ga0207674_10168121 3300026116 Bacteria 2146
311 Ga0207674_10473534 3300026116 Bacteria 1210
312 Ga0207683_10005565 3300026121 Bacteria 10793
313 Ga0207698_10002097 3300026142 Bacteria 11768
314 Ga0207698_10015460 3300026142 Bacteria 5109
315 Ga0207698_10015979 3300026142 Bacteria 5048
316 Ga0207698_10103293 3300026142 Bacteria 2368
317 Ga0207698_10184185 3300026142 Bacteria 1853
318 Ga0207698_10199332 3300026142 Bacteria 1791
319 Ga0268266_10000001 3300028379 Bacteria 4040580
320 Ga0268266_10000006 3300028379 Bacteria 1410021
321 Ga0268265_10001803 3300028380 Bacteria 17141
322 Ga0268264_10010437 3300028381 Bacteria 7679
323 Ga0307516_10057653 3300031730 Bacteria 3782
324 Ga0307405_10104628 3300031731 Bacteria 1905
325 Ga0307412_10000686 3300031911 Bacteria 19583
326 Ga0307510_10000001 3300033180 Bacteria 1172244
327 Ga0373937_0133395 3300036401 Bacteria 2321
328 Ga0395899_0003898 3300037312 Bacteria 11758
329 Ga0395899_0070586 3300037312 Bacteria 2556
330 Ga0395899_0140534 3300037312 Bacteria 1718
331 Ga0395900_0000033 3300037418 Bacteria 260271
332 Ga0395900_0003368 3300037418 Bacteria 17260
333 Ga0395900_0015038 3300037418 Bacteria 7888
334 Ga0395900_0035777 3300037418 Bacteria 5116
335 Ga0395900_0074255 3300037418 Bacteria 3496
336 Ga0395898_0014501 3300037466 Bacteria 8094
337 Ga0395898_0037712 3300037466 Bacteria 4792
338 Ga0395901_0037502 3300038443 Bacteria 5012
339 Ga0395901_0274883 3300038443 Bacteria 1751
340 Ga0439436_0000059 3300041404 Bacteria 30728
341 Ga0439465_0000593 3300041413 Bacteria 10952
342 Ga0451791_0533498 3300041451 Bacteria 1504
343 Ga0451793_1819395 3300041452 Bacteria 2454
344 Ga0451802_0140142 3300041460 Bacteria 6076
345 Ga0451833_1273290 3300041491 Bacteria 1508
346 Ga0451843_0454197 3300041509 Bacteria 2585
347 Ga0451853_0515992 3300041512 Bacteria 3547
348 Ga0439448_0036398 3300042005 Bacteria 1579
349 Ga0466982_0000311 3300044672 Bacteria 13456
350 Ga0466965_0045109 3300044683 Bacteria 2179
351 Ga0466966_0006454 3300044684 Bacteria 7759
352 Ga0466964_0005605 3300044706 Bacteria 4665
353 Ga0466971_0007544 3300044719 Bacteria 4741
354 Ga0466960_0004264 3300044901 Bacteria 5568
355 Ga0495617_000374 3300046452 Bacteria 24806
356 Ga0495617_003254 3300046452 Bacteria 6164
357 Ga0495638_0000075 3300046460 Bacteria 161068
358 Ga0495638_0000509 3300046460 Bacteria 45817
359 Ga0495605_0087966 3300046474 Bacteria 1444
360 Ga0495585_0000028 3300046492 Bacteria 146662
361 Ga0495607_0000275 3300046501 Bacteria 55331
362 Ga0495607_0002977 3300046501 Bacteria 13280
363 Ga0495607_0033968 3300046501 Bacteria 3099
364 Ga0495583_0009474 3300046506 Bacteria 5812
365 Ga0495606_0000173 3300046507 Bacteria 114285
366 Ga0495606_0003290 3300046507 Bacteria 17288
367 Ga0495606_0042852 3300046507 Bacteria 3024
368 Ga0495610_0004198 3300046512 Bacteria 10759
369 Ga0495616_0012808 3300046513 Bacteria 4745
370 Ga0495620_0000381 3300046515 Bacteria 30173
371 Ga0495631_0000732 3300046518 Bacteria 21100
372 Ga0495631_0019373 3300046518 Bacteria 3191
373 Ga0495632_0000020 3300046519 Bacteria 210606
374 Ga0495648_0002515 3300046524 Bacteria 16829
375 Ga0495609_0003428 3300046538 Bacteria 9087
376 Ga0495611_0000001 3300046648 Bacteria 2628469
377 Ga0495611_0000114 3300046648 Bacteria 56705
378 Ga0495625_0000001 3300046660 Bacteria 1641829
379 Ga0495625_0023937 3300046660 Bacteria 4657
380 Ga0495625_0043561 3300046660 Bacteria 3254
381 Ga0495661_0002622 3300046665 Bacteria 13777
382 Ga0495670_0000718 3300046691 Bacteria 15794
383 Ga0495670_0019717 3300046691 Bacteria 3323
384 Ga0495671_0000683 3300046692 Bacteria 24539
385 Ga0495589_0000120 3300046794 Bacteria 73521
386 Ga0495660_0000395 3300046810 Bacteria 37740
387 Ga0495660_0000667 3300046810 Bacteria 26462
388 Ga0495679_000001 3300047446 Bacteria 1607568
389 Ga0495673_0000001 3300047469 Bacteria 1630730
390 Ga0495673_0000010 3300047469 Bacteria 709599
391 Ga0495673_0042859 3300047469 Bacteria 2028
392 Ga0495686_0000085 3300047472 Bacteria 198128
393 Ga0495686_0002593 3300047472 Bacteria 16796
394 Ga0495686_0008351 3300047472 Bacteria 7609
395 Ga0495686_0114886 3300047472 Bacteria 1610
396 Ga0496101_0009856 3300048904 Bacteria 6293
397 Ga0496102_0008412 3300048905 Bacteria 8842
398 Ga0496103_0039329 3300048906 Bacteria 2906
399 Ga0496105_0005928 3300048908 Bacteria 9325
400 Ga0496115_0000084 3300048918 Bacteria 86953
401 Ga0496115_0065281 3300048918 Bacteria 2939
402 Ga0496116_0009900 3300048919 Bacteria 8061
403 Ga0496116_0043724 3300048919 Bacteria 3049
404 Ga0496116_0096080 3300048919 Bacteria 1786
405 Ga0496117_0000155 3300048920 Bacteria 146091
406 Ga0496117_0018674 3300048920 Bacteria 5732
407 Ga0496118_0000066 3300048921 Bacteria 207678
408 Ga0496118_0001524 3300048921 Bacteria 34491
409 Ga0496118_0003240 3300048921 Bacteria 20759
410 Ga0496118_0009239 3300048921 Bacteria 10008
411 Ga0496118_0021592 3300048921 Bacteria 5660
412 Ga0496118_0022813 3300048921 Bacteria 5457
413 Ga0496118_0070328 3300048921 Bacteria 2527
414 Ga0496119_0000377 3300048922 Bacteria 61561
415 Ga0496119_0001760 3300048922 Bacteria 25245
416 Ga0496119_0014406 3300048922 Bacteria 6192
417 Ga0496119_0028233 3300048922 Bacteria 3834
418 Ga0496119_0028895 3300048922 Bacteria 3773
419 Ga0496120_0001239 3300048923 Bacteria 32260
420 Ga0496120_0002008 3300048923 Bacteria 22137
421 Ga0496120_0007223 3300048923 Bacteria 8316
422 Ga0496120_0045636 3300048923 Bacteria 2537
423 Ga0496121_0000129 3300048924 Bacteria 168148
424 Ga0496121_0008944 3300048924 Bacteria 11623
425 Ga0496121_0010489 3300048924 Bacteria 10444
426 Ga0496121_0011846 3300048924 Bacteria 9603
427 Ga0496122_0000129 3300048925 Bacteria 173688
428 Ga0496122_0101460 3300048925 Bacteria 1922
429 Ga0496123_0000113 3300048926 Bacteria 163689
430 Ga0496123_0035049 3300048926 Bacteria 3584
431 Ga0496123_0058614 3300048926 Bacteria 2496
432 Ga0496123_0105428 3300048926 Bacteria 1627
433 Ga0496124_0002625 3300048927 Bacteria 23145
434 Ga0496124_0003138 3300048927 Bacteria 20478
435 Ga0496124_0059816 3300048927 Bacteria 3198
436 Ga0496125_0001074 3300048928 Bacteria 42088
437 Ga0496125_0001953 3300048928 Bacteria 28140
438 Ga0496125_0011258 3300048928 Bacteria 8965
439 Ga0496125_0016544 3300048928 Bacteria 7076
440 Ga0496126_0000169 3300048929 Bacteria 150322
441 Ga0496126_0011004 3300048929 Bacteria 9411
442 Ga0496126_0021311 3300048929 Bacteria 6331
443 Ga0496126_0026265 3300048929 Bacteria 5586
444 Ga0496126_0089213 3300048929 Bacteria 2714
445 Ga0496126_0184509 3300048929 Bacteria 1770
446 Ga0495678_000180 3300049459 Bacteria 72870
447 Ga0495682_0018562 3300049460 Bacteria 2619
448 Ga0501031_0042108 3300049568 Bacteria 2981
449 Ga0501031_0191232 3300049568 Bacteria 1336
450 Ga0501032_0005690 3300049569 Bacteria 9230
451 Ga0501032_0014382 3300049569 Bacteria 5605
452 Ga0501032_0204424 3300049569 Bacteria 1288
453 Ga0501033_0000545 3300049570 Bacteria 35019
454 Ga0501033_0001261 3300049570 Bacteria 22597
455 Ga0501033_0053145 3300049570 Bacteria 3000
456 Ga0501033_0093193 3300049570 Bacteria 2202
457 Ga0501034_0000996 3300049571 Bacteria 40586
458 Ga0501034_0004225 3300049571 Bacteria 16037
459 Ga0501034_0005946 3300049571 Bacteria 13215
460 Ga0501034_0006908 3300049571 Bacteria 12130
461 Ga0501034_0018984 3300049571 Bacteria 7042
462 Ga0501034_0021958 3300049571 Bacteria 6503
463 Ga0501036_0003471 3300049572 Bacteria 12599
464 Ga0501036_0006824 3300049572 Bacteria 9275
465 Ga0501036_0039307 3300049572 Bacteria 4004
466 Ga0501037_0004013 3300049573 Bacteria 10672
467 Ga0501037_0012129 3300049573 Bacteria 6345
468 Ga0501038_0003919 3300049574 Bacteria 13840
469 Ga0501038_0011224 3300049574 Bacteria 8178
470 Ga0501039_0001920 3300049575 Bacteria 15395
471 Ga0501042_0007082 3300049578 Bacteria 7327
472 Ga0501042_0091641 3300049578 Bacteria 2182
473 Ga0501043_0003663 3300049579 Bacteria 12617
474 Ga0501043_0050456 3300049579 Bacteria 3270
475 Ga0501043_0069447 3300049579 Bacteria 2767
476 Ga0501043_0086442 3300049579 Bacteria 2464
477 Ga0501043_0236065 3300049579 Bacteria 1411
478 Ga0501046_0000760 3300049580 Bacteria 31143
479 Ga0501046_0003806 3300049580 Bacteria 13803
480 Ga0501046_0008835 3300049580 Bacteria 8751
481 Ga0501046_0122099 3300049580 Bacteria 1981
482 Ga0501047_0000653 3300049581 Bacteria 36334
483 Ga0501047_0010809 3300049581 Bacteria 8627
484 Ga0501047_0011177 3300049581 Bacteria 8495
485 Ga0501047_0035222 3300049581 Bacteria 4835
486 Ga0501047_0104792 3300049581 Bacteria 2708
487 Ga0501047_0189686 3300049581 Bacteria 1919
488 Ga0501048_0005255 3300049582 Bacteria 9860
489 Ga0501048_0071874 3300049582 Bacteria 2442
490 Ga0501067_0000699 3300049583 Bacteria 18081
491 Ga0501067_0011938 3300049583 Bacteria 4812
492 Ga0501067_0033437 3300049583 Bacteria 2853
493 Ga0501068_0002476 3300049584 Bacteria 9808
494 Ga0501068_0021959 3300049584 Bacteria 3730
495 Ga0501068_0103313 3300049584 Bacteria 1767
496 Ga0501069_0003276 3300049585 Bacteria 8308
497 Ga0501069_0005727 3300049585 Bacteria 6477
498 Ga0501070_0022866 3300049586 Bacteria 5232
499 Ga0501070_0049889 3300049586 Bacteria 3474
500 Ga0501070_0064951 3300049586 Bacteria 3022
501 Ga0501070_0351345 3300049586 Bacteria 1196
502 Ga0501071_0002527 3300049587 Bacteria 11137
503 Ga0501072_0018825 3300049588 Bacteria 5326
504 Ga0501073_0016163 3300049589 Bacteria 5407
505 Ga0501073_0023298 3300049589 Bacteria 4446
506 Ga0501073_0026853 3300049589 Bacteria 4122
507 Ga0501073_0112984 3300049589 Bacteria 1884
508 Ga0501074_0010109 3300049590 Bacteria 6850
509 Ga0501074_0013182 3300049590 Bacteria 6011
510 Ga0501074_0045854 3300049590 Bacteria 3161
511 Ga0501079_0007809 3300049741 Bacteria 8099
512 Ga0501079_0059768 3300049741 Bacteria 2940
513 Ga0501079_0316189 3300049741 Bacteria 1222
514 Ga0501080_0003935 3300049742 Bacteria 13149
515 Ga0501080_0012270 3300049742 Bacteria 7849
516 Ga0501080_0027848 3300049742 Bacteria 5254
517 Ga0501080_0054382 3300049742 Bacteria 3727
518 Ga0501083_0053605 3300049744 Bacteria 2707
519 Ga0501035_0003276 3300049822 Bacteria 15521
520 Ga0501035_0017031 3300049822 Bacteria 6697
521 Ga0501035_0021668 3300049822 Bacteria 5909
522 Ga0501035_0022419 3300049822 Bacteria 5799
523 Ga0501035_0071707 3300049822 Bacteria 3066
524 Ga0501044_0002495 3300049823 Bacteria 20993
525 Ga0501044_0006525 3300049823 Bacteria 12885
526 Ga0501044_0011297 3300049823 Bacteria 9678
527 Ga0501044_0042591 3300049823 Bacteria 4721
528 Ga0501044_0086907 3300049823 Bacteria 3158
529 Ga0501044_0091764 3300049823 Bacteria 3063
530 Ga0501044_0105779 3300049823 Bacteria 2826
531 nmdc:mga0sz30_22963_c1 3300050516 Bacteria 2534
532 Ga0500610_0003179 3300053079 Bacteria 6250
533 Ga0500643_000080 3300053087 Bacteria 103235
534 Ga0500643_002342 3300053087 Bacteria 9906
535 Ga0500651_0000066 3300053093 Bacteria 69313
536 Ga0500651_0003049 3300053093 Bacteria 9059
537 Ga0500651_0099854 3300053093 Bacteria 1780
538 Ga0500555_001068 3300053103 Bacteria 9212
539 Ga0500597_000072 3300053120 Bacteria 20645
540 Ga0500568_0001880 3300053139 Bacteria 12928
541 Ga0500633_0043858 3300053160 Bacteria 1515
542 Ga0500645_003771 3300053730 Bacteria 6036
543 Ga0501084_0004418 3300054114 Bacteria 11473
544 Ga0501084_0080351 3300054114 Bacteria 2734
545 Ga0501082_0002936 3300060353 Bacteria 14882
546 Ga0501082_0007664 3300060353 Bacteria 9317
547 Ga0466962_0001039 3300061719 Bacteria 12733
548 2595448398 2593339238 Bacteria 4182970
549 2595451699 2593339239 Bacteria 4124669
550 2643894945 2643221577 Bacteria 3710843
551 2644477103 2643221685 Bacteria 3673288
552 2687582772 2687453130 Bacteria 4227172
553 2739227657 2738543009 Bacteria 4944499
554 2739731442 2739367700 Bacteria 4747630
555 2819563514 2818991440 Bacteria 4774720
556 2842915383 2842914999 Bacteria 4419378
557 2842921704 2842918807 Bacteria 4289178
558 2884339955 2884338543 Bacteria 4610696
559 2884414717 2884411467 Bacteria 5246714
560 2904464176 2904463128 Bacteria 4775606
561 2919085970 2919085039 Bacteria 4532964
562 2919404776 2919404418 Bacteria 4232372
563 2928963542 2928963466 Bacteria 5165703
564 2941472330 2941471342 Bacteria 5018624
565 2953997718 2953994433 Bacteria 4303959
566 Ga0207648_10088462
567 JGI24740J21852_10011760
568 JGI24738J21930_10002434
569 JGI25162J39368_1002553
570 JGI25164J39214_1000040
571 JGI25165J46597_1000009
572 rootH2_10005772
573 Ga0006562J51391_1004986
574 Ga0055535_1000016
575 Ga0055535_1000048
576 Ga0055542_1001683
577 Ga0065165_1000028
578 Ga0070670_100115625
579 Ga0070666_10008572
580 Ga0070666_10073544
581 Ga0070661_100228523
582 Ga0070688_100025935
583 Ga0070659_100189916
584 Ga0070667_100000173
585 Ga0070667_100008807
586 Ga0070667_100017470
587 Ga0070667_100047402
588 Ga0070667_100078450
589 Ga0070667_100224524
590 Ga0070710_10025354
591 Ga0070711_100120797
592 Ga0070708_100479799
593 Ga0070663_100000433
594 Ga0070678_100108020
595 Ga0070662_100017994
596 Ga0070662_100099283
597 Ga0070681_10000007
598 Ga0070681_10003054
599 Ga0070681_10043663
600 Ga0070685_10000515
601 Ga0070679_100390710
602 Ga0070684_100010032
603 Ga0068853_100000439
604 Ga0068853_100013373
605 Ga0068853_100028182
606 Ga0068853_100030054
607 Ga0068853_100034355
608 Ga0068853_100181571
609 Ga0070693_100017740
610 Ga0070665_100000227
611 Ga0070665_100023207
612 Ga0068855_100001280
613 Ga0068855_100035350
614 Ga0068855_100051677
615 Ga0068855_100400719
616 Ga0070664_100060010
617 Ga0068857_100056888
618 Ga0068857_100076327
619 Ga0068857_100112156
620 Ga0068854_100005461
621 Ga0068854_100010222
622 Ga0068854_100010384
623 Ga0068854_100097475
624 Ga0068856_100015367
625 Ga0068856_100022889
626 Ga0068856_100036939
627 Ga0068852_100081253
628 Ga0068852_100126299
629 Ga0068852_100127671
630 Ga0068859_100000208
631 Ga0068859_100007900
632 Ga0068864_100073327
633 Ga0068861_100203526
634 Ga0068851_10002998
635 Ga0068851_10024596
636 Ga0068851_10046488
637 Ga0068851_10126104
638 Ga0068863_100012788
639 Ga0068863_100066067
640 Ga0068863_100066370
641 Ga0068863_100201378
642 Ga0068863_100316293
643 Ga0068858_100004910
644 Ga0068858_100010974
645 Ga0068858_100041080
646 Ga0068860_100010648
647 Ga0068860_100092308
648 Ga0068862_100000707
649 Ga0068862_100094751
650 Ga0081540_1007060
651 Ga0075369_10047500
652 Ga0097621_100017131
653 Ga0097621_100034184
654 Ga0097621_100134832
655 Ga0097621_100135731
656 Ga0068871_100023135
657 Ga0068871_100053478
658 Ga0068871_100065306
659 Ga0068871_100082460
660 Ga0068871_100134623
661 Ga0068871_100182223
662 Ga0068871_100297631
663 Ga0068865_100011953
664 Ga0068865_100056549
665 Ga0097620_100000208
666 Ga0097620_100007900
667 Ga0105240_10001318
668 Ga0105240_10019942
669 Ga0105240_10019997
670 Ga0105240_10069134
671 Ga0105240_10099311
672 Ga0105240_10184843
673 Ga0105240_10216379
674 Ga0105240_10274862
675 Ga0105240_10500969
676 Ga0105245_10077853
677 Ga0105247_10005381
678 Ga0105247_10013972
679 Ga0105241_10004304
680 Ga0105241_10067244
681 Ga0105241_10216357
682 Ga0105248_10004348
683 Ga0105248_10026152
684 Ga0105248_10101162
685 Ga0105248_10383073
686 Ga0105237_10000345
687 Ga0105237_10000701
688 Ga0105237_10009096
689 Ga0105237_10026363
690 Ga0105237_10159927
691 Ga0105238_10004916
692 Ga0105238_10007187
693 Ga0105238_10015088
694 Ga0105238_10056411
695 Ga0105238_10144244
696 Ga0105238_10297369
697 Ga0105238_10381908
698 Ga0105238_10527848
699 Ga0105249_10000175
700 Ga0105249_10005249
701 Ga0105249_10016630
702 Ga0105239_10000041
703 Ga0105239_10027130
704 Ga0105239_10040341
705 Ga0105239_10057803
706 Ga0105239_10086724
707 Ga0105239_10184358
708 Ga0105239_10265601
709 Ga0105239_10364473
710 Ga0105246_10140221
711 Ga0157370_10000124
712 Ga0157370_10007635
713 Ga0157370_10036239
714 Ga0157370_10050913
715 Ga0157370_10114875
716 Ga0157370_10315640
717 Ga0157369_10000028
718 Ga0157369_10000406
719 Ga0157369_10107436
720 Ga0157369_10337730
721 Ga0157374_10016097
722 Ga0157374_10224539
723 Ga0157374_10266165
724 Ga0157378_10000006
725 Ga0157378_10073729
726 Ga0163162_10157401
727 Ga0157372_10001879
728 Ga0157372_10012045
729 Ga0157372_10034901
730 Ga0157372_10209282
731 Ga0157375_10089542
732 Ga0163163_10001216
733 Ga0163163_10009320
734 Ga0163163_10023731
735 Ga0163163_10301755
736 Ga0182008_10002192
737 Ga0182008_10047133
738 Ga0182008_10067120
739 Ga0157379_10004969
740 Ga0157379_10090791
741 Ga0157379_10279324
742 Ga0157379_10446154
743 Ga0157376_10000471
744 Ga0157376_10252975
745 Ga0157376_10364555
746 Ga0182006_1000367
747 Ga0182006_1000510
748 Ga0182006_1010892
749 Ga0182007_10007807
750 Ga0182005_1000129
751 Ga0182005_1002462
752 Ga0183369_1008
753 Ga0163161_10024376
754 Ga0209760_100485
755 Ga0209784_100013
756 Ga0209674_100300
757 Ga0209672_101710
758 Ga0207427_100030
759 Ga0207427_100201
760 Ga0207427_102613
761 Ga0209437_100012
762 Ga0209437_100151
763 Ga0209437_103919
764 Ga0209258_100019
765 Ga0209646_1000408
766 Ga0209026_1000015
767 Ga0209026_1004656
768 Ga0209148_1000001
769 Ga0209148_1000005
770 Ga0209148_1001705
771 Ga0209759_1000144
772 Ga0209759_1010630
773 Ga0209129_1000194
774 Ga0209129_1001221
775 Ga0209233_1000002
776 Ga0209233_1000020
777 Ga0209233_1011937
778 Ga0209455_1000027
779 Ga0209455_1005579
780 Ga0209758_1000980
781 Ga0209256_1014339
782 Ga0207426_1008219
783 Ga0209051_1009110
784 Ga0207656_10002475
785 Ga0207656_10018904
786 Ga0207656_10090799
787 Ga0207680_10000616
788 Ga0207680_10023050
789 Ga0207680_10032227
790 Ga0207680_10163521
791 Ga0207647_10000006
792 Ga0207647_10000213
793 Ga0207647_10001220
794 Ga0207647_10013889
795 Ga0207654_10000128
796 Ga0207654_10025993
797 Ga0207654_10051388
798 Ga0207654_10172991
799 Ga0207707_10001116
800 Ga0207707_10056058
801 Ga0207695_10000007
802 Ga0207695_10000311
803 Ga0207695_10001506
804 Ga0207695_10002811
805 Ga0207695_10005092
806 Ga0207695_10029378
807 Ga0207695_10051841
808 Ga0207695_10054159
809 Ga0207695_10113421
810 Ga0207671_10000050
811 Ga0207671_10001138
812 Ga0207671_10001184
813 Ga0207671_10023696
814 Ga0207671_10037847
815 Ga0207671_10039982
816 Ga0207657_10023590
817 Ga0207649_10174815
818 Ga0207694_10002986
819 Ga0207694_10005785
820 Ga0207694_10035034
821 Ga0207694_10055965
822 Ga0207694_10150626
823 Ga0207694_10343683
824 Ga0207650_10124558
825 Ga0207659_10018487
826 Ga0207687_10108769
827 Ga0207706_10011704
828 Ga0207706_10021569
829 Ga0207706_10340063
830 Ga0207704_10051861
831 Ga0207704_10060953
832 Ga0207711_10003763
833 Ga0207711_10144797
834 Ga0207661_10288409
835 Ga0207679_10180763
836 Ga0207667_10000031
837 Ga0207667_10000125
838 Ga0207667_10002512
839 Ga0207667_10058545
840 Ga0207667_10064893
841 Ga0207667_10164611
842 Ga0207712_10000169
843 Ga0207712_10000600
844 Ga0207668_10061427
845 Ga0207668_10306466
846 Ga0207640_10000188
847 Ga0207640_10001407
848 Ga0207640_10002862
849 Ga0207640_10080560
850 Ga0207640_10112983
851 Ga0207658_10000111
852 Ga0207658_10116044
853 Ga0207677_10058396
854 Ga0207703_10009159
855 Ga0207703_10030731
856 Ga0207639_10000800
857 Ga0207639_10001755
858 Ga0207639_10008119
859 Ga0207639_10009912
860 Ga0207639_10021645
861 Ga0207639_10029521
862 Ga0207639_10397950
863 Ga0207678_10001607
864 Ga0207678_10063712
865 Ga0207702_10006397
866 Ga0207702_10210800
867 Ga0207702_10435740
868 Ga0207641_10039464
869 Ga0207641_10077091
870 Ga0207648_10023413
871 Ga0207676_10202151
872 Ga0207674_10004088
873 Ga0207674_10012210
874 Ga0207674_10021098
875 Ga0207674_10168121
876 Ga0207674_10473534
877 Ga0207683_10005565
878 Ga0207698_10002097
879 Ga0207698_10015460
880 Ga0207698_10015979
881 Ga0207698_10103293
882 Ga0207698_10184185
883 Ga0207698_10199332
884 Ga0268266_10000001
885 Ga0268266_10000006
886 Ga0268265_10001803
887 Ga0268264_10010437
888 Ga0307516_10057653
889 Ga0307405_10104628
890 Ga0307412_10000686
891 Ga0307510_10000001
892 Ga0373937_0133395
893 Ga0395899_0003898
894 Ga0395899_0070586
895 Ga0395899_0140534
896 Ga0395900_0000033
897 Ga0395900_0003368
898 Ga0395900_0015038
899 Ga0395900_0035777
900 Ga0395900_0074255
901 Ga0395898_0014501
902 Ga0395898_0037712
903 Ga0395901_0037502
904 Ga0395901_0274883
905 Ga0439436_0000059
906 Ga0439465_0000593
907 Ga0451791_0533498
908 Ga0451793_1819395
909 Ga0451802_0140142
910 Ga0451833_1273290
911 Ga0451843_0454197
912 Ga0451853_0515992
913 Ga0439448_0036398
914 Ga0466982_0000311
915 Ga0466965_0045109
916 Ga0466966_0006454
917 Ga0466964_0005605
918 Ga0466971_0007544
919 Ga0466960_0004264
920 Ga0495617_000374
921 Ga0495617_003254
922 Ga0495638_0000075
923 Ga0495638_0000509
924 Ga0495605_0087966
925 Ga0495585_0000028
926 Ga0495607_0000275
927 Ga0495607_0002977
928 Ga0495607_0033968
929 Ga0495583_0009474
930 Ga0495606_0000173
931 Ga0495606_0003290
932 Ga0495606_0042852
933 Ga0495610_0004198
934 Ga0495616_0012808
935 Ga0495620_0000381
936 Ga0495631_0000732
937 Ga0495631_0019373
938 Ga0495632_0000020
939 Ga0495648_0002515
940 Ga0495609_0003428
941 Ga0495611_0000001
942 Ga0495611_0000114
943 Ga0495625_0000001
944 Ga0495625_0023937
945 Ga0495625_0043561
946 Ga0495661_0002622
947 Ga0495670_0000718
948 Ga0495670_0019717
949 Ga0495671_0000683
950 Ga0495589_0000120
951 Ga0495660_0000395
952 Ga0495660_0000667
953 Ga0495679_000001
954 Ga0495673_0000001
955 Ga0495673_0000010
956 Ga0495673_0042859
957 Ga0495686_0000085
958 Ga0495686_0002593
959 Ga0495686_0008351
960 Ga0495686_0114886
961 Ga0496101_0009856
962 Ga0496102_0008412
963 Ga0496103_0039329
964 Ga0496105_0005928
965 Ga0496115_0000084
966 Ga0496115_0065281
967 Ga0496116_0009900
968 Ga0496116_0043724
969 Ga0496116_0096080
970 Ga0496117_0000155
971 Ga0496117_0018674
972 Ga0496118_0000066
973 Ga0496118_0001524
974 Ga0496118_0003240
975 Ga0496118_0009239
976 Ga0496118_0021592
977 Ga0496118_0022813
978 Ga0496118_0070328
979 Ga0496119_0000377
980 Ga0496119_0001760
981 Ga0496119_0014406
982 Ga0496119_0028233
983 Ga0496119_0028895
984 Ga0496120_0001239
985 Ga0496120_0002008
986 Ga0496120_0007223
987 Ga0496120_0045636
988 Ga0496121_0000129
989 Ga0496121_0008944
990 Ga0496121_0010489
991 Ga0496121_0011846
992 Ga0496122_0000129
993 Ga0496122_0101460
994 Ga0496123_0000113
995 Ga0496123_0035049
996 Ga0496123_0058614
997 Ga0496123_0105428
998 Ga0496124_0002625
999 Ga0496124_0003138
1000 Ga0496124_0059816
1001 Ga0496125_0001074
1002 Ga0496125_0001953
1003 Ga0496125_0011258
1004 Ga0496125_0016544
1005 Ga0496126_0000169
1006 Ga0496126_0011004
1007 Ga0496126_0021311
1008 Ga0496126_0026265
1009 Ga0496126_0089213
1010 Ga0496126_0184509
1011 Ga0495678_000180
1012 Ga0495682_0018562
1013 Ga0501031_0042108
1014 Ga0501031_0191232
1015 Ga0501032_0005690
1016 Ga0501032_0014382
1017 Ga0501032_0204424
1018 Ga0501033_0000545
1019 Ga0501033_0001261
1020 Ga0501033_0053145
1021 Ga0501033_0093193
1022 Ga0501034_0000996
1023 Ga0501034_0004225
1024 Ga0501034_0005946
1025 Ga0501034_0006908
1026 Ga0501034_0018984
1027 Ga0501034_0021958
1028 Ga0501036_0003471
1029 Ga0501036_0006824
1030 Ga0501036_0039307
1031 Ga0501037_0004013
1032 Ga0501037_0012129
1033 Ga0501038_0003919
1034 Ga0501038_0011224
1035 Ga0501039_0001920
1036 Ga0501042_0007082
1037 Ga0501042_0091641
1038 Ga0501043_0003663
1039 Ga0501043_0050456
1040 Ga0501043_0069447
1041 Ga0501043_0086442
1042 Ga0501043_0236065
1043 Ga0501046_0000760
1044 Ga0501046_0003806
1045 Ga0501046_0008835
1046 Ga0501046_0122099
1047 Ga0501047_0000653
1048 Ga0501047_0010809
1049 Ga0501047_0011177
1050 Ga0501047_0035222
1051 Ga0501047_0104792
1052 Ga0501047_0189686
1053 Ga0501048_0005255
1054 Ga0501048_0071874
1055 Ga0501067_0000699
1056 Ga0501067_0011938
1057 Ga0501067_0033437
1058 Ga0501068_0002476
1059 Ga0501068_0021959
1060 Ga0501068_0103313
1061 Ga0501069_0003276
1062 Ga0501069_0005727
1063 Ga0501070_0022866
1064 Ga0501070_0049889
1065 Ga0501070_0064951
1066 Ga0501070_0351345
1067 Ga0501071_0002527
1068 Ga0501072_0018825
1069 Ga0501073_0016163
1070 Ga0501073_0023298
1071 Ga0501073_0026853
1072 Ga0501073_0112984
1073 Ga0501074_0010109
1074 Ga0501074_0013182
1075 Ga0501074_0045854
1076 Ga0501079_0007809
1077 Ga0501079_0059768
1078 Ga0501079_0316189
1079 Ga0501080_0003935
1080 Ga0501080_0012270
1081 Ga0501080_0027848
1082 Ga0501080_0054382
1083 Ga0501083_0053605
1084 Ga0501035_0003276
1085 Ga0501035_0017031
1086 Ga0501035_0021668
1087 Ga0501035_0022419
1088 Ga0501035_0071707
1089 Ga0501044_0002495
1090 Ga0501044_0006525
1091 Ga0501044_0011297
1092 Ga0501044_0042591
1093 Ga0501044_0086907
1094 Ga0501044_0091764
1095 Ga0501044_0105779
1096 nmdc:mga0sz30_22963_c1
1097 Ga0500610_0003179
1098 Ga0500643_000080
1099 Ga0500643_002342
1100 Ga0500651_0000066
1101 Ga0500651_0003049
1102 Ga0500651_0099854
1103 Ga0500555_001068
1104 Ga0500597_000072
1105 Ga0500568_0001880
1106 Ga0500633_0043858
1107 Ga0500645_003771
1108 Ga0501084_0004418
1109 Ga0501084_0080351
1110 Ga0501082_0002936
1111 Ga0501082_0007664
1112 Ga0466962_0001039
1113 2595448398
1114 2595451699
1115 2643894945
1116 2644477103
1117 2687582772
1118 2739227657
1119 2739731442
1120 2819563514
1121 2842915383
1122 2842921704
1123 2884339955
1124 2884414717
1125 2904464176
1126 2919085970
1127 2919404776
1128 2928963542
1129 2941472330
1130 2953997718

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

55

375

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yb0-assembly6.cif.gz_L crystal structure of wild type phosphoserine aminotransferase (psat) from e. histolytica 0.9733 35 254
4xk1-assembly1.cif.gz_B crystal structure of a phosphoserine/phosphohydroxythreonine aminotransferase (psat) from pseudomonas aeruginosa with cofactor pyridoxal phosphate and bound glutamate 0.9669 5 351
5yb0-assembly5.cif.gz_J crystal structure of wild type phosphoserine aminotransferase (psat) from e. histolytica 0.966 7 265
2bi5-assembly1.cif.gz_B radiation damage of the schiff base in phosphoserine aminotransferase (structure e) 0.965 3 359
6xdk-assembly1.cif.gz_A crystal structure of phosphoserine aminotransferase (serc) from stenotrophomonas maltophilia k279a 0.964 5 361
ID Description Score Start End Superfamily
2bi2B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9797 18 256 3.40.640.10
af_I1J8D7_67_308_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9763 17 255 3.40.640.10
2bi2B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9636 18 256 3.40.640.10
af_I1J8D7_67_308_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9605 17 255 3.40.640.10
af_Q55CQ6_22_267_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.96 17 255 3.40.640.10
ID Description Score Start End GO Terms
AF-K9MY05-F1-model_v4 Phosphoserine aminotransferase (Phosphohydroxythreonine aminotransferase) 0.9836 65 270 GO:0004648
GO:0005737
GO:0006564
GO:0008615
GO:0030170
AF-A0A658JAD1-F1-model_v4 deleted 0.981 74 299
AF-A0A2N1YZ66-F1-model_v4 deleted 0.9804 37 282
AF-A0A382MXN5-F1-model_v4 Aminotransferase class V domain-containing protein 0.9803 4 193 GO:0004648
GO:0005737
GO:0006564
GO:0030170
AF-A0A2N2TGM9-F1-model_v4 Phosphoserine aminotransferase (EC 2.6.1.52) 0.9802 4 322 GO:0004648
GO:0005737
GO:0006564
GO:0008615
GO:0030170

Map