F464276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 565 | 252 | 1130 | 358 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10088462|Ga0207648_100884622 |
| Length | 400 |
| Sequence | MDYVYAAFRGEASPGRRSARMPELRAFAAATKRIARLLHCGIMTAEPQEMRVSRGYNFSAGPAALPDEVLRQAQAELLEWDGARASVMEISHRGKDFIALAEESERDLRDLLAIPANYKVLFLQGGATQHFAQIPMNIARRDQSADYVRTGDWSEKAVKEAQPLVNVRIVADSSATNYDRIPPRDSWDLDPNAAYLHYTPNETIRGVEFHEIPDTGNVPLVADMSSTILSRPLDVSRFGLIYAGAQKNIGASGLVVLIVRDDLLARCPKDLPKIFNYAEQAAQGSMLNTPNTYGWYLSALVFKWLKKQGGLAAMAERNRAKAELLYGYIDASGYYKNPVEKSARSWMNWTTRRASSVSSGVSTKRRAAPASRSHHRRLPLRSRLFSITALAAARMLPVER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 141 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 142 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 146 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 149 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 154 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 155 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 184 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 185 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 186 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 187 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 188 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 189 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 190 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 191 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 192 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 193 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 224 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 225 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 226 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 227 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 228 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 229 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 230 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 231 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 232 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 235 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 236 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 237 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 238 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 239 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 240 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 241 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 242 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 243 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 244 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 245 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 246 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 247 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 248 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 249 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 250 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 251 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 252 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.64 |
| Metatranscriptomes | 0.18 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.96 |
| Nodule | 0 |
| Rhizoplane | 1.59 |
| Rhizosphere | 77.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207648_10088462 | 3300026089 | Bacteria | 2704 |
| 2 | JGI24740J21852_10011760 | 3300001979 | Bacteria | 3321 |
| 3 | JGI24738J21930_10002434 | 3300002075 | Bacteria | 4878 |
| 4 | JGI25162J39368_1002553 | 3300002737 | Bacteria | 6925 |
| 5 | JGI25164J39214_1000040 | 3300002772 | Bacteria | 127780 |
| 6 | JGI25165J46597_1000009 | 3300003214 | Bacteria | 467965 |
| 7 | rootH2_10005772 | 3300003320 | Bacteria | 29295 |
| 8 | Ga0006562J51391_1004986 | 3300003578 | Bacteria | 8150 |
| 9 | Ga0055535_1000016 | 3300003761 | Bacteria | 252398 |
| 10 | Ga0055535_1000048 | 3300003761 | Bacteria | 139301 |
| 11 | Ga0055542_1001683 | 3300003762 | Bacteria | 9775 |
| 12 | Ga0065165_1000028 | 3300005262 | Bacteria | 224430 |
| 13 | Ga0070670_100115625 | 3300005331 | Bacteria | 2313 |
| 14 | Ga0070666_10008572 | 3300005335 | Bacteria | 6353 |
| 15 | Ga0070666_10073544 | 3300005335 | Bacteria | 2328 |
| 16 | Ga0070661_100228523 | 3300005344 | Bacteria | 1429 |
| 17 | Ga0070688_100025935 | 3300005365 | Bacteria | 3476 |
| 18 | Ga0070659_100189916 | 3300005366 | Bacteria | 1688 |
| 19 | Ga0070667_100000173 | 3300005367 | Bacteria | 79829 |
| 20 | Ga0070667_100008807 | 3300005367 | Bacteria | 8361 |
| 21 | Ga0070667_100017470 | 3300005367 | Bacteria | 5945 |
| 22 | Ga0070667_100047402 | 3300005367 | Bacteria | 3615 |
| 23 | Ga0070667_100078450 | 3300005367 | Bacteria | 2821 |
| 24 | Ga0070667_100224524 | 3300005367 | Bacteria | 1673 |
| 25 | Ga0070710_10025354 | 3300005437 | Bacteria | 3140 |
| 26 | Ga0070711_100120797 | 3300005439 | Bacteria | 1937 |
| 27 | Ga0070708_100479799 | 3300005445 | Bacteria | 1173 |
| 28 | Ga0070663_100000433 | 3300005455 | Bacteria | 22073 |
| 29 | Ga0070678_100108020 | 3300005456 | Bacteria | 2171 |
| 30 | Ga0070662_100017994 | 3300005457 | Bacteria | 4773 |
| 31 | Ga0070662_100099283 | 3300005457 | Bacteria | 2200 |
| 32 | Ga0070681_10000007 | 3300005458 | Bacteria | 159821 |
| 33 | Ga0070681_10003054 | 3300005458 | Bacteria | 15517 |
| 34 | Ga0070681_10043663 | 3300005458 | Bacteria | 4489 |
| 35 | Ga0070685_10000515 | 3300005466 | Bacteria | 22275 |
| 36 | Ga0070679_100390710 | 3300005530 | Bacteria | 1337 |
| 37 | Ga0070684_100010032 | 3300005535 | Bacteria | 7487 |
| 38 | Ga0068853_100000439 | 3300005539 | Bacteria | 28384 |
| 39 | Ga0068853_100013373 | 3300005539 | Bacteria | 6699 |
| 40 | Ga0068853_100028182 | 3300005539 | Bacteria | 4722 |
| 41 | Ga0068853_100030054 | 3300005539 | Bacteria | 4586 |
| 42 | Ga0068853_100034355 | 3300005539 | Bacteria | 4304 |
| 43 | Ga0068853_100181571 | 3300005539 | Bacteria | 1908 |
| 44 | Ga0070693_100017740 | 3300005547 | Bacteria | 3706 |
| 45 | Ga0070665_100000227 | 3300005548 | Bacteria | 93439 |
| 46 | Ga0070665_100023207 | 3300005548 | Bacteria | 6248 |
| 47 | Ga0068855_100001280 | 3300005563 | Bacteria | 31168 |
| 48 | Ga0068855_100035350 | 3300005563 | Bacteria | 5952 |
| 49 | Ga0068855_100051677 | 3300005563 | Bacteria | 4841 |
| 50 | Ga0068855_100400719 | 3300005563 | Bacteria | 1504 |
| 51 | Ga0070664_100060010 | 3300005564 | Bacteria | 3238 |
| 52 | Ga0068857_100056888 | 3300005577 | Bacteria | 3471 |
| 53 | Ga0068857_100076327 | 3300005577 | Bacteria | 2988 |
| 54 | Ga0068857_100112156 | 3300005577 | Bacteria | 2452 |
| 55 | Ga0068854_100005461 | 3300005578 | Bacteria | 8028 |
| 56 | Ga0068854_100010222 | 3300005578 | Bacteria | 6081 |
| 57 | Ga0068854_100010384 | 3300005578 | Bacteria | 6036 |
| 58 | Ga0068854_100097475 | 3300005578 | Bacteria | 2198 |
| 59 | Ga0068856_100015367 | 3300005614 | Bacteria | 7398 |
| 60 | Ga0068856_100022889 | 3300005614 | Bacteria | 6077 |
| 61 | Ga0068856_100036939 | 3300005614 | Bacteria | 4791 |
| 62 | Ga0068852_100081253 | 3300005616 | Bacteria | 2876 |
| 63 | Ga0068852_100126299 | 3300005616 | Bacteria | 2349 |
| 64 | Ga0068852_100127671 | 3300005616 | Bacteria | 2337 |
| 65 | Ga0068859_100000208 | 3300005617 | Bacteria | 58155 |
| 66 | Ga0068859_100007900 | 3300005617 | Bacteria | 10796 |
| 67 | Ga0068864_100073327 | 3300005618 | Bacteria | 2984 |
| 68 | Ga0068861_100203526 | 3300005719 | Bacteria | 1663 |
| 69 | Ga0068851_10002998 | 3300005834 | Bacteria | 7457 |
| 70 | Ga0068851_10024596 | 3300005834 | Bacteria | 2949 |
| 71 | Ga0068851_10046488 | 3300005834 | Bacteria | 2196 |
| 72 | Ga0068851_10126104 | 3300005834 | Bacteria | 1380 |
| 73 | Ga0068863_100012788 | 3300005841 | Bacteria | 8094 |
| 74 | Ga0068863_100066067 | 3300005841 | Bacteria | 3422 |
| 75 | Ga0068863_100066370 | 3300005841 | Bacteria | 3413 |
| 76 | Ga0068863_100201378 | 3300005841 | Bacteria | 1915 |
| 77 | Ga0068863_100316293 | 3300005841 | Bacteria | 1516 |
| 78 | Ga0068858_100004910 | 3300005842 | Bacteria | 13098 |
| 79 | Ga0068858_100010974 | 3300005842 | Bacteria | 8561 |
| 80 | Ga0068858_100041080 | 3300005842 | Bacteria | 4290 |
| 81 | Ga0068860_100010648 | 3300005843 | Bacteria | 9080 |
| 82 | Ga0068860_100092308 | 3300005843 | Bacteria | 2885 |
| 83 | Ga0068862_100000707 | 3300005844 | Bacteria | 34098 |
| 84 | Ga0068862_100094751 | 3300005844 | Bacteria | 2604 |
| 85 | Ga0081540_1007060 | 3300005983 | Bacteria | 8072 |
| 86 | Ga0075369_10047500 | 3300006186 | Bacteria | 1851 |
| 87 | Ga0097621_100017131 | 3300006237 | Bacteria | 5497 |
| 88 | Ga0097621_100034184 | 3300006237 | Bacteria | 4053 |
| 89 | Ga0097621_100134832 | 3300006237 | Bacteria | 2105 |
| 90 | Ga0097621_100135731 | 3300006237 | Bacteria | 2098 |
| 91 | Ga0068871_100023135 | 3300006358 | Bacteria | 4801 |
| 92 | Ga0068871_100053478 | 3300006358 | Bacteria | 3273 |
| 93 | Ga0068871_100065306 | 3300006358 | Bacteria | 2980 |
| 94 | Ga0068871_100082460 | 3300006358 | Bacteria | 2666 |
| 95 | Ga0068871_100134623 | 3300006358 | Bacteria | 2098 |
| 96 | Ga0068871_100182223 | 3300006358 | Bacteria | 1805 |
| 97 | Ga0068871_100297631 | 3300006358 | Bacteria | 1415 |
| 98 | Ga0068865_100011953 | 3300006881 | Bacteria | 5452 |
| 99 | Ga0068865_100056549 | 3300006881 | Bacteria | 2734 |
| 100 | Ga0097620_100000208 | 3300006931 | Bacteria | 58155 |
| 101 | Ga0097620_100007900 | 3300006931 | Bacteria | 10796 |
| 102 | Ga0105240_10001318 | 3300009093 | Bacteria | 42836 |
| 103 | Ga0105240_10019942 | 3300009093 | Bacteria | 8953 |
| 104 | Ga0105240_10019997 | 3300009093 | Bacteria | 8938 |
| 105 | Ga0105240_10069134 | 3300009093 | Bacteria | 4372 |
| 106 | Ga0105240_10099311 | 3300009093 | Bacteria | 3543 |
| 107 | Ga0105240_10184843 | 3300009093 | Bacteria | 2456 |
| 108 | Ga0105240_10216379 | 3300009093 | Bacteria | 2235 |
| 109 | Ga0105240_10274862 | 3300009093 | Bacteria | 1938 |
| 110 | Ga0105240_10500969 | 3300009093 | Bacteria | 1350 |
| 111 | Ga0105245_10077853 | 3300009098 | Bacteria | 3024 |
| 112 | Ga0105247_10005381 | 3300009101 | Bacteria | 8067 |
| 113 | Ga0105247_10013972 | 3300009101 | Bacteria | 4814 |
| 114 | Ga0105241_10004304 | 3300009174 | Bacteria | 10528 |
| 115 | Ga0105241_10067244 | 3300009174 | Bacteria | 2773 |
| 116 | Ga0105241_10216357 | 3300009174 | Bacteria | 1608 |
| 117 | Ga0105248_10004348 | 3300009177 | Bacteria | 15668 |
| 118 | Ga0105248_10026152 | 3300009177 | Bacteria | 6493 |
| 119 | Ga0105248_10101162 | 3300009177 | Bacteria | 3248 |
| 120 | Ga0105248_10383073 | 3300009177 | Bacteria | 1583 |
| 121 | Ga0105237_10000345 | 3300009545 | Bacteria | 65477 |
| 122 | Ga0105237_10000701 | 3300009545 | Bacteria | 46447 |
| 123 | Ga0105237_10009096 | 3300009545 | Bacteria | 10675 |
| 124 | Ga0105237_10026363 | 3300009545 | Bacteria | 5940 |
| 125 | Ga0105237_10159927 | 3300009545 | Bacteria | 2251 |
| 126 | Ga0105238_10004916 | 3300009551 | Bacteria | 13227 |
| 127 | Ga0105238_10007187 | 3300009551 | Bacteria | 11140 |
| 128 | Ga0105238_10015088 | 3300009551 | Bacteria | 7824 |
| 129 | Ga0105238_10056411 | 3300009551 | Bacteria | 3941 |
| 130 | Ga0105238_10144244 | 3300009551 | Bacteria | 2358 |
| 131 | Ga0105238_10297369 | 3300009551 | Bacteria | 1597 |
| 132 | Ga0105238_10381908 | 3300009551 | Bacteria | 1400 |
| 133 | Ga0105238_10527848 | 3300009551 | Bacteria | 1183 |
| 134 | Ga0105249_10000175 | 3300009553 | Bacteria | 74934 |
| 135 | Ga0105249_10005249 | 3300009553 | Bacteria | 11183 |
| 136 | Ga0105249_10016630 | 3300009553 | Bacteria | 6530 |
| 137 | Ga0105239_10000041 | 3300010375 | Bacteria | 200922 |
| 138 | Ga0105239_10027130 | 3300010375 | Bacteria | 6305 |
| 139 | Ga0105239_10040341 | 3300010375 | Bacteria | 5115 |
| 140 | Ga0105239_10057803 | 3300010375 | Bacteria | 4255 |
| 141 | Ga0105239_10086724 | 3300010375 | Bacteria | 3451 |
| 142 | Ga0105239_10184358 | 3300010375 | Bacteria | 2335 |
| 143 | Ga0105239_10265601 | 3300010375 | Bacteria | 1929 |
| 144 | Ga0105239_10364473 | 3300010375 | Bacteria | 1632 |
| 145 | Ga0105246_10140221 | 3300011119 | Bacteria | 1817 |
| 146 | Ga0157370_10000124 | 3300013104 | Bacteria | 91398 |
| 147 | Ga0157370_10007635 | 3300013104 | Bacteria | 11740 |
| 148 | Ga0157370_10036239 | 3300013104 | Bacteria | 4788 |
| 149 | Ga0157370_10050913 | 3300013104 | Bacteria | 3957 |
| 150 | Ga0157370_10114875 | 3300013104 | Bacteria | 2515 |
| 151 | Ga0157370_10315640 | 3300013104 | Bacteria | 1442 |
| 152 | Ga0157369_10000028 | 3300013105 | Bacteria | 213910 |
| 153 | Ga0157369_10000406 | 3300013105 | Bacteria | 57192 |
| 154 | Ga0157369_10107436 | 3300013105 | Bacteria | 2969 |
| 155 | Ga0157369_10337730 | 3300013105 | Bacteria | 1565 |
| 156 | Ga0157374_10016097 | 3300013296 | Bacteria | 6571 |
| 157 | Ga0157374_10224539 | 3300013296 | Bacteria | 1844 |
| 158 | Ga0157374_10266165 | 3300013296 | Bacteria | 1690 |
| 159 | Ga0157378_10000006 | 3300013297 | Bacteria | 192683 |
| 160 | Ga0157378_10073729 | 3300013297 | Bacteria | 3069 |
| 161 | Ga0163162_10157401 | 3300013306 | Bacteria | 2392 |
| 162 | Ga0157372_10001879 | 3300013307 | Bacteria | 22756 |
| 163 | Ga0157372_10012045 | 3300013307 | Bacteria | 9210 |
| 164 | Ga0157372_10034901 | 3300013307 | Bacteria | 5534 |
| 165 | Ga0157372_10209282 | 3300013307 | Bacteria | 2260 |
| 166 | Ga0157375_10089542 | 3300013308 | Bacteria | 3134 |
| 167 | Ga0163163_10001216 | 3300014325 | Bacteria | 21766 |
| 168 | Ga0163163_10009320 | 3300014325 | Bacteria | 8757 |
| 169 | Ga0163163_10023731 | 3300014325 | Bacteria | 5826 |
| 170 | Ga0163163_10301755 | 3300014325 | Bacteria | 1654 |
| 171 | Ga0182008_10002192 | 3300014497 | Bacteria | 12398 |
| 172 | Ga0182008_10047133 | 3300014497 | Bacteria | 2142 |
| 173 | Ga0182008_10067120 | 3300014497 | Bacteria | 1765 |
| 174 | Ga0157379_10004969 | 3300014968 | Bacteria | 11411 |
| 175 | Ga0157379_10090791 | 3300014968 | Bacteria | 2740 |
| 176 | Ga0157379_10279324 | 3300014968 | Bacteria | 1519 |
| 177 | Ga0157379_10446154 | 3300014968 | Bacteria | 1194 |
| 178 | Ga0157376_10000471 | 3300014969 | Bacteria | 25943 |
| 179 | Ga0157376_10252975 | 3300014969 | Bacteria | 1646 |
| 180 | Ga0157376_10364555 | 3300014969 | Bacteria | 1387 |
| 181 | Ga0182006_1000367 | 3300015261 | Bacteria | 37426 |
| 182 | Ga0182006_1000510 | 3300015261 | Bacteria | 29601 |
| 183 | Ga0182006_1010892 | 3300015261 | Bacteria | 4023 |
| 184 | Ga0182007_10007807 | 3300015262 | Bacteria | 4449 |
| 185 | Ga0182005_1000129 | 3300015265 | Bacteria | 53573 |
| 186 | Ga0182005_1002462 | 3300015265 | Bacteria | 6597 |
| 187 | Ga0183369_1008 | 3300015685 | Bacteria | 346514 |
| 188 | Ga0163161_10024376 | 3300017792 | Bacteria | 4273 |
| 189 | Ga0209760_100485 | 3300025207 | Bacteria | 8474 |
| 190 | Ga0209784_100013 | 3300025224 | Bacteria | 518664 |
| 191 | Ga0209674_100300 | 3300025226 | Bacteria | 34463 |
| 192 | Ga0209672_101710 | 3300025228 | Bacteria | 7048 |
| 193 | Ga0207427_100030 | 3300025231 | Bacteria | 358045 |
| 194 | Ga0207427_100201 | 3300025231 | Bacteria | 56684 |
| 195 | Ga0207427_102613 | 3300025231 | Bacteria | 4612 |
| 196 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 197 | Ga0209437_100151 | 3300025233 | Bacteria | 156418 |
| 198 | Ga0209437_103919 | 3300025233 | Bacteria | 2647 |
| 199 | Ga0209258_100019 | 3300025242 | Bacteria | 566728 |
| 200 | Ga0209646_1000408 | 3300025246 | Bacteria | 24943 |
| 201 | Ga0209026_1000015 | 3300025250 | Bacteria | 395555 |
| 202 | Ga0209026_1004656 | 3300025250 | Bacteria | 3982 |
| 203 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 204 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 205 | Ga0209148_1001705 | 3300025254 | Bacteria | 9702 |
| 206 | Ga0209759_1000144 | 3300025256 | Bacteria | 121828 |
| 207 | Ga0209759_1010630 | 3300025256 | Bacteria | 2685 |
| 208 | Ga0209129_1000194 | 3300025258 | Bacteria | 80824 |
| 209 | Ga0209129_1001221 | 3300025258 | Bacteria | 14725 |
| 210 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 211 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 212 | Ga0209233_1011937 | 3300025261 | Bacteria | 2540 |
| 213 | Ga0209455_1000027 | 3300025272 | Bacteria | 566710 |
| 214 | Ga0209455_1005579 | 3300025272 | Bacteria | 3862 |
| 215 | Ga0209758_1000980 | 3300025297 | Bacteria | 38371 |
| 216 | Ga0209256_1014339 | 3300025299 | Bacteria | 2859 |
| 217 | Ga0207426_1008219 | 3300025302 | Bacteria | 4247 |
| 218 | Ga0209051_1009110 | 3300025303 | Bacteria | 5154 |
| 219 | Ga0207656_10002475 | 3300025321 | Bacteria | 6233 |
| 220 | Ga0207656_10018904 | 3300025321 | Bacteria | 2719 |
| 221 | Ga0207656_10090799 | 3300025321 | Bacteria | 1386 |
| 222 | Ga0207680_10000616 | 3300025903 | Bacteria | 16825 |
| 223 | Ga0207680_10023050 | 3300025903 | Bacteria | 3394 |
| 224 | Ga0207680_10032227 | 3300025903 | Bacteria | 2977 |
| 225 | Ga0207680_10163521 | 3300025903 | Bacteria | 1494 |
| 226 | Ga0207647_10000006 | 3300025904 | Bacteria | 214791 |
| 227 | Ga0207647_10000213 | 3300025904 | Bacteria | 47297 |
| 228 | Ga0207647_10001220 | 3300025904 | Bacteria | 19782 |
| 229 | Ga0207647_10013889 | 3300025904 | Bacteria | 5574 |
| 230 | Ga0207654_10000128 | 3300025911 | Bacteria | 49057 |
| 231 | Ga0207654_10025993 | 3300025911 | Bacteria | 3165 |
| 232 | Ga0207654_10051388 | 3300025911 | Bacteria | 2372 |
| 233 | Ga0207654_10172991 | 3300025911 | Bacteria | 1404 |
| 234 | Ga0207707_10001116 | 3300025912 | Bacteria | 25500 |
| 235 | Ga0207707_10056058 | 3300025912 | Bacteria | 3428 |
| 236 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 237 | Ga0207695_10000311 | 3300025913 | Bacteria | 117484 |
| 238 | Ga0207695_10001506 | 3300025913 | Bacteria | 38709 |
| 239 | Ga0207695_10002811 | 3300025913 | Bacteria | 25308 |
| 240 | Ga0207695_10005092 | 3300025913 | Bacteria | 17615 |
| 241 | Ga0207695_10029378 | 3300025913 | Bacteria | 6077 |
| 242 | Ga0207695_10051841 | 3300025913 | Bacteria | 4305 |
| 243 | Ga0207695_10054159 | 3300025913 | Bacteria | 4191 |
| 244 | Ga0207695_10113421 | 3300025913 | Bacteria | 2687 |
| 245 | Ga0207671_10000050 | 3300025914 | Bacteria | 190479 |
| 246 | Ga0207671_10001138 | 3300025914 | Bacteria | 31946 |
| 247 | Ga0207671_10001184 | 3300025914 | Bacteria | 31016 |
| 248 | Ga0207671_10023696 | 3300025914 | Bacteria | 4626 |
| 249 | Ga0207671_10037847 | 3300025914 | Bacteria | 3577 |
| 250 | Ga0207671_10039982 | 3300025914 | Bacteria | 3472 |
| 251 | Ga0207657_10023590 | 3300025919 | Bacteria | 5725 |
| 252 | Ga0207649_10174815 | 3300025920 | Bacteria | 1499 |
| 253 | Ga0207694_10002986 | 3300025924 | Bacteria | 13563 |
| 254 | Ga0207694_10005785 | 3300025924 | Bacteria | 9470 |
| 255 | Ga0207694_10035034 | 3300025924 | Bacteria | 3850 |
| 256 | Ga0207694_10055965 | 3300025924 | Bacteria | 3063 |
| 257 | Ga0207694_10150626 | 3300025924 | Bacteria | 1874 |
| 258 | Ga0207694_10343683 | 3300025924 | Bacteria | 1234 |
| 259 | Ga0207650_10124558 | 3300025925 | Bacteria | 2010 |
| 260 | Ga0207659_10018487 | 3300025926 | Bacteria | 4570 |
| 261 | Ga0207687_10108769 | 3300025927 | Bacteria | 2053 |
| 262 | Ga0207706_10011704 | 3300025933 | Bacteria | 7999 |
| 263 | Ga0207706_10021569 | 3300025933 | Bacteria | 5783 |
| 264 | Ga0207706_10340063 | 3300025933 | Bacteria | 1306 |
| 265 | Ga0207704_10051861 | 3300025938 | Bacteria | 2484 |
| 266 | Ga0207704_10060953 | 3300025938 | Bacteria | 2337 |
| 267 | Ga0207711_10003763 | 3300025941 | Bacteria | 13059 |
| 268 | Ga0207711_10144797 | 3300025941 | Bacteria | 2140 |
| 269 | Ga0207661_10288409 | 3300025944 | Bacteria | 1468 |
| 270 | Ga0207679_10180763 | 3300025945 | Bacteria | 1745 |
| 271 | Ga0207667_10000031 | 3300025949 | Bacteria | 323587 |
| 272 | Ga0207667_10000125 | 3300025949 | Bacteria | 118155 |
| 273 | Ga0207667_10002512 | 3300025949 | Bacteria | 22872 |
| 274 | Ga0207667_10058545 | 3300025949 | Bacteria | 4040 |
| 275 | Ga0207667_10064893 | 3300025949 | Bacteria | 3810 |
| 276 | Ga0207667_10164611 | 3300025949 | Bacteria | 2280 |
| 277 | Ga0207712_10000169 | 3300025961 | Bacteria | 67461 |
| 278 | Ga0207712_10000600 | 3300025961 | Bacteria | 28673 |
| 279 | Ga0207668_10061427 | 3300025972 | Bacteria | 2643 |
| 280 | Ga0207668_10306466 | 3300025972 | Bacteria | 1312 |
| 281 | Ga0207640_10000188 | 3300025981 | Bacteria | 44053 |
| 282 | Ga0207640_10001407 | 3300025981 | Bacteria | 13002 |
| 283 | Ga0207640_10002862 | 3300025981 | Bacteria | 9255 |
| 284 | Ga0207640_10080560 | 3300025981 | Bacteria | 2223 |
| 285 | Ga0207640_10112983 | 3300025981 | Bacteria | 1930 |
| 286 | Ga0207658_10000111 | 3300025986 | Bacteria | 89180 |
| 287 | Ga0207658_10116044 | 3300025986 | Bacteria | 2126 |
| 288 | Ga0207677_10058396 | 3300026023 | Bacteria | 2656 |
| 289 | Ga0207703_10009159 | 3300026035 | Bacteria | 7793 |
| 290 | Ga0207703_10030731 | 3300026035 | Bacteria | 4244 |
| 291 | Ga0207639_10000800 | 3300026041 | Bacteria | 21366 |
| 292 | Ga0207639_10001755 | 3300026041 | Bacteria | 14589 |
| 293 | Ga0207639_10008119 | 3300026041 | Bacteria | 7177 |
| 294 | Ga0207639_10009912 | 3300026041 | Bacteria | 6581 |
| 295 | Ga0207639_10021645 | 3300026041 | Bacteria | 4621 |
| 296 | Ga0207639_10029521 | 3300026041 | Bacteria | 4015 |
| 297 | Ga0207639_10397950 | 3300026041 | Bacteria | 1240 |
| 298 | Ga0207678_10001607 | 3300026067 | Bacteria | 20786 |
| 299 | Ga0207678_10063712 | 3300026067 | Bacteria | 3168 |
| 300 | Ga0207702_10006397 | 3300026078 | Bacteria | 10161 |
| 301 | Ga0207702_10210800 | 3300026078 | Bacteria | 1806 |
| 302 | Ga0207702_10435740 | 3300026078 | Bacteria | 1269 |
| 303 | Ga0207641_10039464 | 3300026088 | Bacteria | 3949 |
| 304 | Ga0207641_10077091 | 3300026088 | Bacteria | 2883 |
| 305 | Ga0207648_10023413 | 3300026089 | Bacteria | 5532 |
| 306 | Ga0207676_10202151 | 3300026095 | Bacteria | 1756 |
| 307 | Ga0207674_10004088 | 3300026116 | Bacteria | 17675 |
| 308 | Ga0207674_10012210 | 3300026116 | Bacteria | 9608 |
| 309 | Ga0207674_10021098 | 3300026116 | Bacteria | 7023 |
| 310 | Ga0207674_10168121 | 3300026116 | Bacteria | 2146 |
| 311 | Ga0207674_10473534 | 3300026116 | Bacteria | 1210 |
| 312 | Ga0207683_10005565 | 3300026121 | Bacteria | 10793 |
| 313 | Ga0207698_10002097 | 3300026142 | Bacteria | 11768 |
| 314 | Ga0207698_10015460 | 3300026142 | Bacteria | 5109 |
| 315 | Ga0207698_10015979 | 3300026142 | Bacteria | 5048 |
| 316 | Ga0207698_10103293 | 3300026142 | Bacteria | 2368 |
| 317 | Ga0207698_10184185 | 3300026142 | Bacteria | 1853 |
| 318 | Ga0207698_10199332 | 3300026142 | Bacteria | 1791 |
| 319 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 320 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 321 | Ga0268265_10001803 | 3300028380 | Bacteria | 17141 |
| 322 | Ga0268264_10010437 | 3300028381 | Bacteria | 7679 |
| 323 | Ga0307516_10057653 | 3300031730 | Bacteria | 3782 |
| 324 | Ga0307405_10104628 | 3300031731 | Bacteria | 1905 |
| 325 | Ga0307412_10000686 | 3300031911 | Bacteria | 19583 |
| 326 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 327 | Ga0373937_0133395 | 3300036401 | Bacteria | 2321 |
| 328 | Ga0395899_0003898 | 3300037312 | Bacteria | 11758 |
| 329 | Ga0395899_0070586 | 3300037312 | Bacteria | 2556 |
| 330 | Ga0395899_0140534 | 3300037312 | Bacteria | 1718 |
| 331 | Ga0395900_0000033 | 3300037418 | Bacteria | 260271 |
| 332 | Ga0395900_0003368 | 3300037418 | Bacteria | 17260 |
| 333 | Ga0395900_0015038 | 3300037418 | Bacteria | 7888 |
| 334 | Ga0395900_0035777 | 3300037418 | Bacteria | 5116 |
| 335 | Ga0395900_0074255 | 3300037418 | Bacteria | 3496 |
| 336 | Ga0395898_0014501 | 3300037466 | Bacteria | 8094 |
| 337 | Ga0395898_0037712 | 3300037466 | Bacteria | 4792 |
| 338 | Ga0395901_0037502 | 3300038443 | Bacteria | 5012 |
| 339 | Ga0395901_0274883 | 3300038443 | Bacteria | 1751 |
| 340 | Ga0439436_0000059 | 3300041404 | Bacteria | 30728 |
| 341 | Ga0439465_0000593 | 3300041413 | Bacteria | 10952 |
| 342 | Ga0451791_0533498 | 3300041451 | Bacteria | 1504 |
| 343 | Ga0451793_1819395 | 3300041452 | Bacteria | 2454 |
| 344 | Ga0451802_0140142 | 3300041460 | Bacteria | 6076 |
| 345 | Ga0451833_1273290 | 3300041491 | Bacteria | 1508 |
| 346 | Ga0451843_0454197 | 3300041509 | Bacteria | 2585 |
| 347 | Ga0451853_0515992 | 3300041512 | Bacteria | 3547 |
| 348 | Ga0439448_0036398 | 3300042005 | Bacteria | 1579 |
| 349 | Ga0466982_0000311 | 3300044672 | Bacteria | 13456 |
| 350 | Ga0466965_0045109 | 3300044683 | Bacteria | 2179 |
| 351 | Ga0466966_0006454 | 3300044684 | Bacteria | 7759 |
| 352 | Ga0466964_0005605 | 3300044706 | Bacteria | 4665 |
| 353 | Ga0466971_0007544 | 3300044719 | Bacteria | 4741 |
| 354 | Ga0466960_0004264 | 3300044901 | Bacteria | 5568 |
| 355 | Ga0495617_000374 | 3300046452 | Bacteria | 24806 |
| 356 | Ga0495617_003254 | 3300046452 | Bacteria | 6164 |
| 357 | Ga0495638_0000075 | 3300046460 | Bacteria | 161068 |
| 358 | Ga0495638_0000509 | 3300046460 | Bacteria | 45817 |
| 359 | Ga0495605_0087966 | 3300046474 | Bacteria | 1444 |
| 360 | Ga0495585_0000028 | 3300046492 | Bacteria | 146662 |
| 361 | Ga0495607_0000275 | 3300046501 | Bacteria | 55331 |
| 362 | Ga0495607_0002977 | 3300046501 | Bacteria | 13280 |
| 363 | Ga0495607_0033968 | 3300046501 | Bacteria | 3099 |
| 364 | Ga0495583_0009474 | 3300046506 | Bacteria | 5812 |
| 365 | Ga0495606_0000173 | 3300046507 | Bacteria | 114285 |
| 366 | Ga0495606_0003290 | 3300046507 | Bacteria | 17288 |
| 367 | Ga0495606_0042852 | 3300046507 | Bacteria | 3024 |
| 368 | Ga0495610_0004198 | 3300046512 | Bacteria | 10759 |
| 369 | Ga0495616_0012808 | 3300046513 | Bacteria | 4745 |
| 370 | Ga0495620_0000381 | 3300046515 | Bacteria | 30173 |
| 371 | Ga0495631_0000732 | 3300046518 | Bacteria | 21100 |
| 372 | Ga0495631_0019373 | 3300046518 | Bacteria | 3191 |
| 373 | Ga0495632_0000020 | 3300046519 | Bacteria | 210606 |
| 374 | Ga0495648_0002515 | 3300046524 | Bacteria | 16829 |
| 375 | Ga0495609_0003428 | 3300046538 | Bacteria | 9087 |
| 376 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 377 | Ga0495611_0000114 | 3300046648 | Bacteria | 56705 |
| 378 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 379 | Ga0495625_0023937 | 3300046660 | Bacteria | 4657 |
| 380 | Ga0495625_0043561 | 3300046660 | Bacteria | 3254 |
| 381 | Ga0495661_0002622 | 3300046665 | Bacteria | 13777 |
| 382 | Ga0495670_0000718 | 3300046691 | Bacteria | 15794 |
| 383 | Ga0495670_0019717 | 3300046691 | Bacteria | 3323 |
| 384 | Ga0495671_0000683 | 3300046692 | Bacteria | 24539 |
| 385 | Ga0495589_0000120 | 3300046794 | Bacteria | 73521 |
| 386 | Ga0495660_0000395 | 3300046810 | Bacteria | 37740 |
| 387 | Ga0495660_0000667 | 3300046810 | Bacteria | 26462 |
| 388 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 389 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 390 | Ga0495673_0000010 | 3300047469 | Bacteria | 709599 |
| 391 | Ga0495673_0042859 | 3300047469 | Bacteria | 2028 |
| 392 | Ga0495686_0000085 | 3300047472 | Bacteria | 198128 |
| 393 | Ga0495686_0002593 | 3300047472 | Bacteria | 16796 |
| 394 | Ga0495686_0008351 | 3300047472 | Bacteria | 7609 |
| 395 | Ga0495686_0114886 | 3300047472 | Bacteria | 1610 |
| 396 | Ga0496101_0009856 | 3300048904 | Bacteria | 6293 |
| 397 | Ga0496102_0008412 | 3300048905 | Bacteria | 8842 |
| 398 | Ga0496103_0039329 | 3300048906 | Bacteria | 2906 |
| 399 | Ga0496105_0005928 | 3300048908 | Bacteria | 9325 |
| 400 | Ga0496115_0000084 | 3300048918 | Bacteria | 86953 |
| 401 | Ga0496115_0065281 | 3300048918 | Bacteria | 2939 |
| 402 | Ga0496116_0009900 | 3300048919 | Bacteria | 8061 |
| 403 | Ga0496116_0043724 | 3300048919 | Bacteria | 3049 |
| 404 | Ga0496116_0096080 | 3300048919 | Bacteria | 1786 |
| 405 | Ga0496117_0000155 | 3300048920 | Bacteria | 146091 |
| 406 | Ga0496117_0018674 | 3300048920 | Bacteria | 5732 |
| 407 | Ga0496118_0000066 | 3300048921 | Bacteria | 207678 |
| 408 | Ga0496118_0001524 | 3300048921 | Bacteria | 34491 |
| 409 | Ga0496118_0003240 | 3300048921 | Bacteria | 20759 |
| 410 | Ga0496118_0009239 | 3300048921 | Bacteria | 10008 |
| 411 | Ga0496118_0021592 | 3300048921 | Bacteria | 5660 |
| 412 | Ga0496118_0022813 | 3300048921 | Bacteria | 5457 |
| 413 | Ga0496118_0070328 | 3300048921 | Bacteria | 2527 |
| 414 | Ga0496119_0000377 | 3300048922 | Bacteria | 61561 |
| 415 | Ga0496119_0001760 | 3300048922 | Bacteria | 25245 |
| 416 | Ga0496119_0014406 | 3300048922 | Bacteria | 6192 |
| 417 | Ga0496119_0028233 | 3300048922 | Bacteria | 3834 |
| 418 | Ga0496119_0028895 | 3300048922 | Bacteria | 3773 |
| 419 | Ga0496120_0001239 | 3300048923 | Bacteria | 32260 |
| 420 | Ga0496120_0002008 | 3300048923 | Bacteria | 22137 |
| 421 | Ga0496120_0007223 | 3300048923 | Bacteria | 8316 |
| 422 | Ga0496120_0045636 | 3300048923 | Bacteria | 2537 |
| 423 | Ga0496121_0000129 | 3300048924 | Bacteria | 168148 |
| 424 | Ga0496121_0008944 | 3300048924 | Bacteria | 11623 |
| 425 | Ga0496121_0010489 | 3300048924 | Bacteria | 10444 |
| 426 | Ga0496121_0011846 | 3300048924 | Bacteria | 9603 |
| 427 | Ga0496122_0000129 | 3300048925 | Bacteria | 173688 |
| 428 | Ga0496122_0101460 | 3300048925 | Bacteria | 1922 |
| 429 | Ga0496123_0000113 | 3300048926 | Bacteria | 163689 |
| 430 | Ga0496123_0035049 | 3300048926 | Bacteria | 3584 |
| 431 | Ga0496123_0058614 | 3300048926 | Bacteria | 2496 |
| 432 | Ga0496123_0105428 | 3300048926 | Bacteria | 1627 |
| 433 | Ga0496124_0002625 | 3300048927 | Bacteria | 23145 |
| 434 | Ga0496124_0003138 | 3300048927 | Bacteria | 20478 |
| 435 | Ga0496124_0059816 | 3300048927 | Bacteria | 3198 |
| 436 | Ga0496125_0001074 | 3300048928 | Bacteria | 42088 |
| 437 | Ga0496125_0001953 | 3300048928 | Bacteria | 28140 |
| 438 | Ga0496125_0011258 | 3300048928 | Bacteria | 8965 |
| 439 | Ga0496125_0016544 | 3300048928 | Bacteria | 7076 |
| 440 | Ga0496126_0000169 | 3300048929 | Bacteria | 150322 |
| 441 | Ga0496126_0011004 | 3300048929 | Bacteria | 9411 |
| 442 | Ga0496126_0021311 | 3300048929 | Bacteria | 6331 |
| 443 | Ga0496126_0026265 | 3300048929 | Bacteria | 5586 |
| 444 | Ga0496126_0089213 | 3300048929 | Bacteria | 2714 |
| 445 | Ga0496126_0184509 | 3300048929 | Bacteria | 1770 |
| 446 | Ga0495678_000180 | 3300049459 | Bacteria | 72870 |
| 447 | Ga0495682_0018562 | 3300049460 | Bacteria | 2619 |
| 448 | Ga0501031_0042108 | 3300049568 | Bacteria | 2981 |
| 449 | Ga0501031_0191232 | 3300049568 | Bacteria | 1336 |
| 450 | Ga0501032_0005690 | 3300049569 | Bacteria | 9230 |
| 451 | Ga0501032_0014382 | 3300049569 | Bacteria | 5605 |
| 452 | Ga0501032_0204424 | 3300049569 | Bacteria | 1288 |
| 453 | Ga0501033_0000545 | 3300049570 | Bacteria | 35019 |
| 454 | Ga0501033_0001261 | 3300049570 | Bacteria | 22597 |
| 455 | Ga0501033_0053145 | 3300049570 | Bacteria | 3000 |
| 456 | Ga0501033_0093193 | 3300049570 | Bacteria | 2202 |
| 457 | Ga0501034_0000996 | 3300049571 | Bacteria | 40586 |
| 458 | Ga0501034_0004225 | 3300049571 | Bacteria | 16037 |
| 459 | Ga0501034_0005946 | 3300049571 | Bacteria | 13215 |
| 460 | Ga0501034_0006908 | 3300049571 | Bacteria | 12130 |
| 461 | Ga0501034_0018984 | 3300049571 | Bacteria | 7042 |
| 462 | Ga0501034_0021958 | 3300049571 | Bacteria | 6503 |
| 463 | Ga0501036_0003471 | 3300049572 | Bacteria | 12599 |
| 464 | Ga0501036_0006824 | 3300049572 | Bacteria | 9275 |
| 465 | Ga0501036_0039307 | 3300049572 | Bacteria | 4004 |
| 466 | Ga0501037_0004013 | 3300049573 | Bacteria | 10672 |
| 467 | Ga0501037_0012129 | 3300049573 | Bacteria | 6345 |
| 468 | Ga0501038_0003919 | 3300049574 | Bacteria | 13840 |
| 469 | Ga0501038_0011224 | 3300049574 | Bacteria | 8178 |
| 470 | Ga0501039_0001920 | 3300049575 | Bacteria | 15395 |
| 471 | Ga0501042_0007082 | 3300049578 | Bacteria | 7327 |
| 472 | Ga0501042_0091641 | 3300049578 | Bacteria | 2182 |
| 473 | Ga0501043_0003663 | 3300049579 | Bacteria | 12617 |
| 474 | Ga0501043_0050456 | 3300049579 | Bacteria | 3270 |
| 475 | Ga0501043_0069447 | 3300049579 | Bacteria | 2767 |
| 476 | Ga0501043_0086442 | 3300049579 | Bacteria | 2464 |
| 477 | Ga0501043_0236065 | 3300049579 | Bacteria | 1411 |
| 478 | Ga0501046_0000760 | 3300049580 | Bacteria | 31143 |
| 479 | Ga0501046_0003806 | 3300049580 | Bacteria | 13803 |
| 480 | Ga0501046_0008835 | 3300049580 | Bacteria | 8751 |
| 481 | Ga0501046_0122099 | 3300049580 | Bacteria | 1981 |
| 482 | Ga0501047_0000653 | 3300049581 | Bacteria | 36334 |
| 483 | Ga0501047_0010809 | 3300049581 | Bacteria | 8627 |
| 484 | Ga0501047_0011177 | 3300049581 | Bacteria | 8495 |
| 485 | Ga0501047_0035222 | 3300049581 | Bacteria | 4835 |
| 486 | Ga0501047_0104792 | 3300049581 | Bacteria | 2708 |
| 487 | Ga0501047_0189686 | 3300049581 | Bacteria | 1919 |
| 488 | Ga0501048_0005255 | 3300049582 | Bacteria | 9860 |
| 489 | Ga0501048_0071874 | 3300049582 | Bacteria | 2442 |
| 490 | Ga0501067_0000699 | 3300049583 | Bacteria | 18081 |
| 491 | Ga0501067_0011938 | 3300049583 | Bacteria | 4812 |
| 492 | Ga0501067_0033437 | 3300049583 | Bacteria | 2853 |
| 493 | Ga0501068_0002476 | 3300049584 | Bacteria | 9808 |
| 494 | Ga0501068_0021959 | 3300049584 | Bacteria | 3730 |
| 495 | Ga0501068_0103313 | 3300049584 | Bacteria | 1767 |
| 496 | Ga0501069_0003276 | 3300049585 | Bacteria | 8308 |
| 497 | Ga0501069_0005727 | 3300049585 | Bacteria | 6477 |
| 498 | Ga0501070_0022866 | 3300049586 | Bacteria | 5232 |
| 499 | Ga0501070_0049889 | 3300049586 | Bacteria | 3474 |
| 500 | Ga0501070_0064951 | 3300049586 | Bacteria | 3022 |
| 501 | Ga0501070_0351345 | 3300049586 | Bacteria | 1196 |
| 502 | Ga0501071_0002527 | 3300049587 | Bacteria | 11137 |
| 503 | Ga0501072_0018825 | 3300049588 | Bacteria | 5326 |
| 504 | Ga0501073_0016163 | 3300049589 | Bacteria | 5407 |
| 505 | Ga0501073_0023298 | 3300049589 | Bacteria | 4446 |
| 506 | Ga0501073_0026853 | 3300049589 | Bacteria | 4122 |
| 507 | Ga0501073_0112984 | 3300049589 | Bacteria | 1884 |
| 508 | Ga0501074_0010109 | 3300049590 | Bacteria | 6850 |
| 509 | Ga0501074_0013182 | 3300049590 | Bacteria | 6011 |
| 510 | Ga0501074_0045854 | 3300049590 | Bacteria | 3161 |
| 511 | Ga0501079_0007809 | 3300049741 | Bacteria | 8099 |
| 512 | Ga0501079_0059768 | 3300049741 | Bacteria | 2940 |
| 513 | Ga0501079_0316189 | 3300049741 | Bacteria | 1222 |
| 514 | Ga0501080_0003935 | 3300049742 | Bacteria | 13149 |
| 515 | Ga0501080_0012270 | 3300049742 | Bacteria | 7849 |
| 516 | Ga0501080_0027848 | 3300049742 | Bacteria | 5254 |
| 517 | Ga0501080_0054382 | 3300049742 | Bacteria | 3727 |
| 518 | Ga0501083_0053605 | 3300049744 | Bacteria | 2707 |
| 519 | Ga0501035_0003276 | 3300049822 | Bacteria | 15521 |
| 520 | Ga0501035_0017031 | 3300049822 | Bacteria | 6697 |
| 521 | Ga0501035_0021668 | 3300049822 | Bacteria | 5909 |
| 522 | Ga0501035_0022419 | 3300049822 | Bacteria | 5799 |
| 523 | Ga0501035_0071707 | 3300049822 | Bacteria | 3066 |
| 524 | Ga0501044_0002495 | 3300049823 | Bacteria | 20993 |
| 525 | Ga0501044_0006525 | 3300049823 | Bacteria | 12885 |
| 526 | Ga0501044_0011297 | 3300049823 | Bacteria | 9678 |
| 527 | Ga0501044_0042591 | 3300049823 | Bacteria | 4721 |
| 528 | Ga0501044_0086907 | 3300049823 | Bacteria | 3158 |
| 529 | Ga0501044_0091764 | 3300049823 | Bacteria | 3063 |
| 530 | Ga0501044_0105779 | 3300049823 | Bacteria | 2826 |
| 531 | nmdc:mga0sz30_22963_c1 | 3300050516 | Bacteria | 2534 |
| 532 | Ga0500610_0003179 | 3300053079 | Bacteria | 6250 |
| 533 | Ga0500643_000080 | 3300053087 | Bacteria | 103235 |
| 534 | Ga0500643_002342 | 3300053087 | Bacteria | 9906 |
| 535 | Ga0500651_0000066 | 3300053093 | Bacteria | 69313 |
| 536 | Ga0500651_0003049 | 3300053093 | Bacteria | 9059 |
| 537 | Ga0500651_0099854 | 3300053093 | Bacteria | 1780 |
| 538 | Ga0500555_001068 | 3300053103 | Bacteria | 9212 |
| 539 | Ga0500597_000072 | 3300053120 | Bacteria | 20645 |
| 540 | Ga0500568_0001880 | 3300053139 | Bacteria | 12928 |
| 541 | Ga0500633_0043858 | 3300053160 | Bacteria | 1515 |
| 542 | Ga0500645_003771 | 3300053730 | Bacteria | 6036 |
| 543 | Ga0501084_0004418 | 3300054114 | Bacteria | 11473 |
| 544 | Ga0501084_0080351 | 3300054114 | Bacteria | 2734 |
| 545 | Ga0501082_0002936 | 3300060353 | Bacteria | 14882 |
| 546 | Ga0501082_0007664 | 3300060353 | Bacteria | 9317 |
| 547 | Ga0466962_0001039 | 3300061719 | Bacteria | 12733 |
| 548 | 2595448398 | 2593339238 | Bacteria | 4182970 |
| 549 | 2595451699 | 2593339239 | Bacteria | 4124669 |
| 550 | 2643894945 | 2643221577 | Bacteria | 3710843 |
| 551 | 2644477103 | 2643221685 | Bacteria | 3673288 |
| 552 | 2687582772 | 2687453130 | Bacteria | 4227172 |
| 553 | 2739227657 | 2738543009 | Bacteria | 4944499 |
| 554 | 2739731442 | 2739367700 | Bacteria | 4747630 |
| 555 | 2819563514 | 2818991440 | Bacteria | 4774720 |
| 556 | 2842915383 | 2842914999 | Bacteria | 4419378 |
| 557 | 2842921704 | 2842918807 | Bacteria | 4289178 |
| 558 | 2884339955 | 2884338543 | Bacteria | 4610696 |
| 559 | 2884414717 | 2884411467 | Bacteria | 5246714 |
| 560 | 2904464176 | 2904463128 | Bacteria | 4775606 |
| 561 | 2919085970 | 2919085039 | Bacteria | 4532964 |
| 562 | 2919404776 | 2919404418 | Bacteria | 4232372 |
| 563 | 2928963542 | 2928963466 | Bacteria | 5165703 |
| 564 | 2941472330 | 2941471342 | Bacteria | 5018624 |
| 565 | 2953997718 | 2953994433 | Bacteria | 4303959 |
| 566 | Ga0207648_10088462 | |||
| 567 | JGI24740J21852_10011760 | |||
| 568 | JGI24738J21930_10002434 | |||
| 569 | JGI25162J39368_1002553 | |||
| 570 | JGI25164J39214_1000040 | |||
| 571 | JGI25165J46597_1000009 | |||
| 572 | rootH2_10005772 | |||
| 573 | Ga0006562J51391_1004986 | |||
| 574 | Ga0055535_1000016 | |||
| 575 | Ga0055535_1000048 | |||
| 576 | Ga0055542_1001683 | |||
| 577 | Ga0065165_1000028 | |||
| 578 | Ga0070670_100115625 | |||
| 579 | Ga0070666_10008572 | |||
| 580 | Ga0070666_10073544 | |||
| 581 | Ga0070661_100228523 | |||
| 582 | Ga0070688_100025935 | |||
| 583 | Ga0070659_100189916 | |||
| 584 | Ga0070667_100000173 | |||
| 585 | Ga0070667_100008807 | |||
| 586 | Ga0070667_100017470 | |||
| 587 | Ga0070667_100047402 | |||
| 588 | Ga0070667_100078450 | |||
| 589 | Ga0070667_100224524 | |||
| 590 | Ga0070710_10025354 | |||
| 591 | Ga0070711_100120797 | |||
| 592 | Ga0070708_100479799 | |||
| 593 | Ga0070663_100000433 | |||
| 594 | Ga0070678_100108020 | |||
| 595 | Ga0070662_100017994 | |||
| 596 | Ga0070662_100099283 | |||
| 597 | Ga0070681_10000007 | |||
| 598 | Ga0070681_10003054 | |||
| 599 | Ga0070681_10043663 | |||
| 600 | Ga0070685_10000515 | |||
| 601 | Ga0070679_100390710 | |||
| 602 | Ga0070684_100010032 | |||
| 603 | Ga0068853_100000439 | |||
| 604 | Ga0068853_100013373 | |||
| 605 | Ga0068853_100028182 | |||
| 606 | Ga0068853_100030054 | |||
| 607 | Ga0068853_100034355 | |||
| 608 | Ga0068853_100181571 | |||
| 609 | Ga0070693_100017740 | |||
| 610 | Ga0070665_100000227 | |||
| 611 | Ga0070665_100023207 | |||
| 612 | Ga0068855_100001280 | |||
| 613 | Ga0068855_100035350 | |||
| 614 | Ga0068855_100051677 | |||
| 615 | Ga0068855_100400719 | |||
| 616 | Ga0070664_100060010 | |||
| 617 | Ga0068857_100056888 | |||
| 618 | Ga0068857_100076327 | |||
| 619 | Ga0068857_100112156 | |||
| 620 | Ga0068854_100005461 | |||
| 621 | Ga0068854_100010222 | |||
| 622 | Ga0068854_100010384 | |||
| 623 | Ga0068854_100097475 | |||
| 624 | Ga0068856_100015367 | |||
| 625 | Ga0068856_100022889 | |||
| 626 | Ga0068856_100036939 | |||
| 627 | Ga0068852_100081253 | |||
| 628 | Ga0068852_100126299 | |||
| 629 | Ga0068852_100127671 | |||
| 630 | Ga0068859_100000208 | |||
| 631 | Ga0068859_100007900 | |||
| 632 | Ga0068864_100073327 | |||
| 633 | Ga0068861_100203526 | |||
| 634 | Ga0068851_10002998 | |||
| 635 | Ga0068851_10024596 | |||
| 636 | Ga0068851_10046488 | |||
| 637 | Ga0068851_10126104 | |||
| 638 | Ga0068863_100012788 | |||
| 639 | Ga0068863_100066067 | |||
| 640 | Ga0068863_100066370 | |||
| 641 | Ga0068863_100201378 | |||
| 642 | Ga0068863_100316293 | |||
| 643 | Ga0068858_100004910 | |||
| 644 | Ga0068858_100010974 | |||
| 645 | Ga0068858_100041080 | |||
| 646 | Ga0068860_100010648 | |||
| 647 | Ga0068860_100092308 | |||
| 648 | Ga0068862_100000707 | |||
| 649 | Ga0068862_100094751 | |||
| 650 | Ga0081540_1007060 | |||
| 651 | Ga0075369_10047500 | |||
| 652 | Ga0097621_100017131 | |||
| 653 | Ga0097621_100034184 | |||
| 654 | Ga0097621_100134832 | |||
| 655 | Ga0097621_100135731 | |||
| 656 | Ga0068871_100023135 | |||
| 657 | Ga0068871_100053478 | |||
| 658 | Ga0068871_100065306 | |||
| 659 | Ga0068871_100082460 | |||
| 660 | Ga0068871_100134623 | |||
| 661 | Ga0068871_100182223 | |||
| 662 | Ga0068871_100297631 | |||
| 663 | Ga0068865_100011953 | |||
| 664 | Ga0068865_100056549 | |||
| 665 | Ga0097620_100000208 | |||
| 666 | Ga0097620_100007900 | |||
| 667 | Ga0105240_10001318 | |||
| 668 | Ga0105240_10019942 | |||
| 669 | Ga0105240_10019997 | |||
| 670 | Ga0105240_10069134 | |||
| 671 | Ga0105240_10099311 | |||
| 672 | Ga0105240_10184843 | |||
| 673 | Ga0105240_10216379 | |||
| 674 | Ga0105240_10274862 | |||
| 675 | Ga0105240_10500969 | |||
| 676 | Ga0105245_10077853 | |||
| 677 | Ga0105247_10005381 | |||
| 678 | Ga0105247_10013972 | |||
| 679 | Ga0105241_10004304 | |||
| 680 | Ga0105241_10067244 | |||
| 681 | Ga0105241_10216357 | |||
| 682 | Ga0105248_10004348 | |||
| 683 | Ga0105248_10026152 | |||
| 684 | Ga0105248_10101162 | |||
| 685 | Ga0105248_10383073 | |||
| 686 | Ga0105237_10000345 | |||
| 687 | Ga0105237_10000701 | |||
| 688 | Ga0105237_10009096 | |||
| 689 | Ga0105237_10026363 | |||
| 690 | Ga0105237_10159927 | |||
| 691 | Ga0105238_10004916 | |||
| 692 | Ga0105238_10007187 | |||
| 693 | Ga0105238_10015088 | |||
| 694 | Ga0105238_10056411 | |||
| 695 | Ga0105238_10144244 | |||
| 696 | Ga0105238_10297369 | |||
| 697 | Ga0105238_10381908 | |||
| 698 | Ga0105238_10527848 | |||
| 699 | Ga0105249_10000175 | |||
| 700 | Ga0105249_10005249 | |||
| 701 | Ga0105249_10016630 | |||
| 702 | Ga0105239_10000041 | |||
| 703 | Ga0105239_10027130 | |||
| 704 | Ga0105239_10040341 | |||
| 705 | Ga0105239_10057803 | |||
| 706 | Ga0105239_10086724 | |||
| 707 | Ga0105239_10184358 | |||
| 708 | Ga0105239_10265601 | |||
| 709 | Ga0105239_10364473 | |||
| 710 | Ga0105246_10140221 | |||
| 711 | Ga0157370_10000124 | |||
| 712 | Ga0157370_10007635 | |||
| 713 | Ga0157370_10036239 | |||
| 714 | Ga0157370_10050913 | |||
| 715 | Ga0157370_10114875 | |||
| 716 | Ga0157370_10315640 | |||
| 717 | Ga0157369_10000028 | |||
| 718 | Ga0157369_10000406 | |||
| 719 | Ga0157369_10107436 | |||
| 720 | Ga0157369_10337730 | |||
| 721 | Ga0157374_10016097 | |||
| 722 | Ga0157374_10224539 | |||
| 723 | Ga0157374_10266165 | |||
| 724 | Ga0157378_10000006 | |||
| 725 | Ga0157378_10073729 | |||
| 726 | Ga0163162_10157401 | |||
| 727 | Ga0157372_10001879 | |||
| 728 | Ga0157372_10012045 | |||
| 729 | Ga0157372_10034901 | |||
| 730 | Ga0157372_10209282 | |||
| 731 | Ga0157375_10089542 | |||
| 732 | Ga0163163_10001216 | |||
| 733 | Ga0163163_10009320 | |||
| 734 | Ga0163163_10023731 | |||
| 735 | Ga0163163_10301755 | |||
| 736 | Ga0182008_10002192 | |||
| 737 | Ga0182008_10047133 | |||
| 738 | Ga0182008_10067120 | |||
| 739 | Ga0157379_10004969 | |||
| 740 | Ga0157379_10090791 | |||
| 741 | Ga0157379_10279324 | |||
| 742 | Ga0157379_10446154 | |||
| 743 | Ga0157376_10000471 | |||
| 744 | Ga0157376_10252975 | |||
| 745 | Ga0157376_10364555 | |||
| 746 | Ga0182006_1000367 | |||
| 747 | Ga0182006_1000510 | |||
| 748 | Ga0182006_1010892 | |||
| 749 | Ga0182007_10007807 | |||
| 750 | Ga0182005_1000129 | |||
| 751 | Ga0182005_1002462 | |||
| 752 | Ga0183369_1008 | |||
| 753 | Ga0163161_10024376 | |||
| 754 | Ga0209760_100485 | |||
| 755 | Ga0209784_100013 | |||
| 756 | Ga0209674_100300 | |||
| 757 | Ga0209672_101710 | |||
| 758 | Ga0207427_100030 | |||
| 759 | Ga0207427_100201 | |||
| 760 | Ga0207427_102613 | |||
| 761 | Ga0209437_100012 | |||
| 762 | Ga0209437_100151 | |||
| 763 | Ga0209437_103919 | |||
| 764 | Ga0209258_100019 | |||
| 765 | Ga0209646_1000408 | |||
| 766 | Ga0209026_1000015 | |||
| 767 | Ga0209026_1004656 | |||
| 768 | Ga0209148_1000001 | |||
| 769 | Ga0209148_1000005 | |||
| 770 | Ga0209148_1001705 | |||
| 771 | Ga0209759_1000144 | |||
| 772 | Ga0209759_1010630 | |||
| 773 | Ga0209129_1000194 | |||
| 774 | Ga0209129_1001221 | |||
| 775 | Ga0209233_1000002 | |||
| 776 | Ga0209233_1000020 | |||
| 777 | Ga0209233_1011937 | |||
| 778 | Ga0209455_1000027 | |||
| 779 | Ga0209455_1005579 | |||
| 780 | Ga0209758_1000980 | |||
| 781 | Ga0209256_1014339 | |||
| 782 | Ga0207426_1008219 | |||
| 783 | Ga0209051_1009110 | |||
| 784 | Ga0207656_10002475 | |||
| 785 | Ga0207656_10018904 | |||
| 786 | Ga0207656_10090799 | |||
| 787 | Ga0207680_10000616 | |||
| 788 | Ga0207680_10023050 | |||
| 789 | Ga0207680_10032227 | |||
| 790 | Ga0207680_10163521 | |||
| 791 | Ga0207647_10000006 | |||
| 792 | Ga0207647_10000213 | |||
| 793 | Ga0207647_10001220 | |||
| 794 | Ga0207647_10013889 | |||
| 795 | Ga0207654_10000128 | |||
| 796 | Ga0207654_10025993 | |||
| 797 | Ga0207654_10051388 | |||
| 798 | Ga0207654_10172991 | |||
| 799 | Ga0207707_10001116 | |||
| 800 | Ga0207707_10056058 | |||
| 801 | Ga0207695_10000007 | |||
| 802 | Ga0207695_10000311 | |||
| 803 | Ga0207695_10001506 | |||
| 804 | Ga0207695_10002811 | |||
| 805 | Ga0207695_10005092 | |||
| 806 | Ga0207695_10029378 | |||
| 807 | Ga0207695_10051841 | |||
| 808 | Ga0207695_10054159 | |||
| 809 | Ga0207695_10113421 | |||
| 810 | Ga0207671_10000050 | |||
| 811 | Ga0207671_10001138 | |||
| 812 | Ga0207671_10001184 | |||
| 813 | Ga0207671_10023696 | |||
| 814 | Ga0207671_10037847 | |||
| 815 | Ga0207671_10039982 | |||
| 816 | Ga0207657_10023590 | |||
| 817 | Ga0207649_10174815 | |||
| 818 | Ga0207694_10002986 | |||
| 819 | Ga0207694_10005785 | |||
| 820 | Ga0207694_10035034 | |||
| 821 | Ga0207694_10055965 | |||
| 822 | Ga0207694_10150626 | |||
| 823 | Ga0207694_10343683 | |||
| 824 | Ga0207650_10124558 | |||
| 825 | Ga0207659_10018487 | |||
| 826 | Ga0207687_10108769 | |||
| 827 | Ga0207706_10011704 | |||
| 828 | Ga0207706_10021569 | |||
| 829 | Ga0207706_10340063 | |||
| 830 | Ga0207704_10051861 | |||
| 831 | Ga0207704_10060953 | |||
| 832 | Ga0207711_10003763 | |||
| 833 | Ga0207711_10144797 | |||
| 834 | Ga0207661_10288409 | |||
| 835 | Ga0207679_10180763 | |||
| 836 | Ga0207667_10000031 | |||
| 837 | Ga0207667_10000125 | |||
| 838 | Ga0207667_10002512 | |||
| 839 | Ga0207667_10058545 | |||
| 840 | Ga0207667_10064893 | |||
| 841 | Ga0207667_10164611 | |||
| 842 | Ga0207712_10000169 | |||
| 843 | Ga0207712_10000600 | |||
| 844 | Ga0207668_10061427 | |||
| 845 | Ga0207668_10306466 | |||
| 846 | Ga0207640_10000188 | |||
| 847 | Ga0207640_10001407 | |||
| 848 | Ga0207640_10002862 | |||
| 849 | Ga0207640_10080560 | |||
| 850 | Ga0207640_10112983 | |||
| 851 | Ga0207658_10000111 | |||
| 852 | Ga0207658_10116044 | |||
| 853 | Ga0207677_10058396 | |||
| 854 | Ga0207703_10009159 | |||
| 855 | Ga0207703_10030731 | |||
| 856 | Ga0207639_10000800 | |||
| 857 | Ga0207639_10001755 | |||
| 858 | Ga0207639_10008119 | |||
| 859 | Ga0207639_10009912 | |||
| 860 | Ga0207639_10021645 | |||
| 861 | Ga0207639_10029521 | |||
| 862 | Ga0207639_10397950 | |||
| 863 | Ga0207678_10001607 | |||
| 864 | Ga0207678_10063712 | |||
| 865 | Ga0207702_10006397 | |||
| 866 | Ga0207702_10210800 | |||
| 867 | Ga0207702_10435740 | |||
| 868 | Ga0207641_10039464 | |||
| 869 | Ga0207641_10077091 | |||
| 870 | Ga0207648_10023413 | |||
| 871 | Ga0207676_10202151 | |||
| 872 | Ga0207674_10004088 | |||
| 873 | Ga0207674_10012210 | |||
| 874 | Ga0207674_10021098 | |||
| 875 | Ga0207674_10168121 | |||
| 876 | Ga0207674_10473534 | |||
| 877 | Ga0207683_10005565 | |||
| 878 | Ga0207698_10002097 | |||
| 879 | Ga0207698_10015460 | |||
| 880 | Ga0207698_10015979 | |||
| 881 | Ga0207698_10103293 | |||
| 882 | Ga0207698_10184185 | |||
| 883 | Ga0207698_10199332 | |||
| 884 | Ga0268266_10000001 | |||
| 885 | Ga0268266_10000006 | |||
| 886 | Ga0268265_10001803 | |||
| 887 | Ga0268264_10010437 | |||
| 888 | Ga0307516_10057653 | |||
| 889 | Ga0307405_10104628 | |||
| 890 | Ga0307412_10000686 | |||
| 891 | Ga0307510_10000001 | |||
| 892 | Ga0373937_0133395 | |||
| 893 | Ga0395899_0003898 | |||
| 894 | Ga0395899_0070586 | |||
| 895 | Ga0395899_0140534 | |||
| 896 | Ga0395900_0000033 | |||
| 897 | Ga0395900_0003368 | |||
| 898 | Ga0395900_0015038 | |||
| 899 | Ga0395900_0035777 | |||
| 900 | Ga0395900_0074255 | |||
| 901 | Ga0395898_0014501 | |||
| 902 | Ga0395898_0037712 | |||
| 903 | Ga0395901_0037502 | |||
| 904 | Ga0395901_0274883 | |||
| 905 | Ga0439436_0000059 | |||
| 906 | Ga0439465_0000593 | |||
| 907 | Ga0451791_0533498 | |||
| 908 | Ga0451793_1819395 | |||
| 909 | Ga0451802_0140142 | |||
| 910 | Ga0451833_1273290 | |||
| 911 | Ga0451843_0454197 | |||
| 912 | Ga0451853_0515992 | |||
| 913 | Ga0439448_0036398 | |||
| 914 | Ga0466982_0000311 | |||
| 915 | Ga0466965_0045109 | |||
| 916 | Ga0466966_0006454 | |||
| 917 | Ga0466964_0005605 | |||
| 918 | Ga0466971_0007544 | |||
| 919 | Ga0466960_0004264 | |||
| 920 | Ga0495617_000374 | |||
| 921 | Ga0495617_003254 | |||
| 922 | Ga0495638_0000075 | |||
| 923 | Ga0495638_0000509 | |||
| 924 | Ga0495605_0087966 | |||
| 925 | Ga0495585_0000028 | |||
| 926 | Ga0495607_0000275 | |||
| 927 | Ga0495607_0002977 | |||
| 928 | Ga0495607_0033968 | |||
| 929 | Ga0495583_0009474 | |||
| 930 | Ga0495606_0000173 | |||
| 931 | Ga0495606_0003290 | |||
| 932 | Ga0495606_0042852 | |||
| 933 | Ga0495610_0004198 | |||
| 934 | Ga0495616_0012808 | |||
| 935 | Ga0495620_0000381 | |||
| 936 | Ga0495631_0000732 | |||
| 937 | Ga0495631_0019373 | |||
| 938 | Ga0495632_0000020 | |||
| 939 | Ga0495648_0002515 | |||
| 940 | Ga0495609_0003428 | |||
| 941 | Ga0495611_0000001 | |||
| 942 | Ga0495611_0000114 | |||
| 943 | Ga0495625_0000001 | |||
| 944 | Ga0495625_0023937 | |||
| 945 | Ga0495625_0043561 | |||
| 946 | Ga0495661_0002622 | |||
| 947 | Ga0495670_0000718 | |||
| 948 | Ga0495670_0019717 | |||
| 949 | Ga0495671_0000683 | |||
| 950 | Ga0495589_0000120 | |||
| 951 | Ga0495660_0000395 | |||
| 952 | Ga0495660_0000667 | |||
| 953 | Ga0495679_000001 | |||
| 954 | Ga0495673_0000001 | |||
| 955 | Ga0495673_0000010 | |||
| 956 | Ga0495673_0042859 | |||
| 957 | Ga0495686_0000085 | |||
| 958 | Ga0495686_0002593 | |||
| 959 | Ga0495686_0008351 | |||
| 960 | Ga0495686_0114886 | |||
| 961 | Ga0496101_0009856 | |||
| 962 | Ga0496102_0008412 | |||
| 963 | Ga0496103_0039329 | |||
| 964 | Ga0496105_0005928 | |||
| 965 | Ga0496115_0000084 | |||
| 966 | Ga0496115_0065281 | |||
| 967 | Ga0496116_0009900 | |||
| 968 | Ga0496116_0043724 | |||
| 969 | Ga0496116_0096080 | |||
| 970 | Ga0496117_0000155 | |||
| 971 | Ga0496117_0018674 | |||
| 972 | Ga0496118_0000066 | |||
| 973 | Ga0496118_0001524 | |||
| 974 | Ga0496118_0003240 | |||
| 975 | Ga0496118_0009239 | |||
| 976 | Ga0496118_0021592 | |||
| 977 | Ga0496118_0022813 | |||
| 978 | Ga0496118_0070328 | |||
| 979 | Ga0496119_0000377 | |||
| 980 | Ga0496119_0001760 | |||
| 981 | Ga0496119_0014406 | |||
| 982 | Ga0496119_0028233 | |||
| 983 | Ga0496119_0028895 | |||
| 984 | Ga0496120_0001239 | |||
| 985 | Ga0496120_0002008 | |||
| 986 | Ga0496120_0007223 | |||
| 987 | Ga0496120_0045636 | |||
| 988 | Ga0496121_0000129 | |||
| 989 | Ga0496121_0008944 | |||
| 990 | Ga0496121_0010489 | |||
| 991 | Ga0496121_0011846 | |||
| 992 | Ga0496122_0000129 | |||
| 993 | Ga0496122_0101460 | |||
| 994 | Ga0496123_0000113 | |||
| 995 | Ga0496123_0035049 | |||
| 996 | Ga0496123_0058614 | |||
| 997 | Ga0496123_0105428 | |||
| 998 | Ga0496124_0002625 | |||
| 999 | Ga0496124_0003138 | |||
| 1000 | Ga0496124_0059816 | |||
| 1001 | Ga0496125_0001074 | |||
| 1002 | Ga0496125_0001953 | |||
| 1003 | Ga0496125_0011258 | |||
| 1004 | Ga0496125_0016544 | |||
| 1005 | Ga0496126_0000169 | |||
| 1006 | Ga0496126_0011004 | |||
| 1007 | Ga0496126_0021311 | |||
| 1008 | Ga0496126_0026265 | |||
| 1009 | Ga0496126_0089213 | |||
| 1010 | Ga0496126_0184509 | |||
| 1011 | Ga0495678_000180 | |||
| 1012 | Ga0495682_0018562 | |||
| 1013 | Ga0501031_0042108 | |||
| 1014 | Ga0501031_0191232 | |||
| 1015 | Ga0501032_0005690 | |||
| 1016 | Ga0501032_0014382 | |||
| 1017 | Ga0501032_0204424 | |||
| 1018 | Ga0501033_0000545 | |||
| 1019 | Ga0501033_0001261 | |||
| 1020 | Ga0501033_0053145 | |||
| 1021 | Ga0501033_0093193 | |||
| 1022 | Ga0501034_0000996 | |||
| 1023 | Ga0501034_0004225 | |||
| 1024 | Ga0501034_0005946 | |||
| 1025 | Ga0501034_0006908 | |||
| 1026 | Ga0501034_0018984 | |||
| 1027 | Ga0501034_0021958 | |||
| 1028 | Ga0501036_0003471 | |||
| 1029 | Ga0501036_0006824 | |||
| 1030 | Ga0501036_0039307 | |||
| 1031 | Ga0501037_0004013 | |||
| 1032 | Ga0501037_0012129 | |||
| 1033 | Ga0501038_0003919 | |||
| 1034 | Ga0501038_0011224 | |||
| 1035 | Ga0501039_0001920 | |||
| 1036 | Ga0501042_0007082 | |||
| 1037 | Ga0501042_0091641 | |||
| 1038 | Ga0501043_0003663 | |||
| 1039 | Ga0501043_0050456 | |||
| 1040 | Ga0501043_0069447 | |||
| 1041 | Ga0501043_0086442 | |||
| 1042 | Ga0501043_0236065 | |||
| 1043 | Ga0501046_0000760 | |||
| 1044 | Ga0501046_0003806 | |||
| 1045 | Ga0501046_0008835 | |||
| 1046 | Ga0501046_0122099 | |||
| 1047 | Ga0501047_0000653 | |||
| 1048 | Ga0501047_0010809 | |||
| 1049 | Ga0501047_0011177 | |||
| 1050 | Ga0501047_0035222 | |||
| 1051 | Ga0501047_0104792 | |||
| 1052 | Ga0501047_0189686 | |||
| 1053 | Ga0501048_0005255 | |||
| 1054 | Ga0501048_0071874 | |||
| 1055 | Ga0501067_0000699 | |||
| 1056 | Ga0501067_0011938 | |||
| 1057 | Ga0501067_0033437 | |||
| 1058 | Ga0501068_0002476 | |||
| 1059 | Ga0501068_0021959 | |||
| 1060 | Ga0501068_0103313 | |||
| 1061 | Ga0501069_0003276 | |||
| 1062 | Ga0501069_0005727 | |||
| 1063 | Ga0501070_0022866 | |||
| 1064 | Ga0501070_0049889 | |||
| 1065 | Ga0501070_0064951 | |||
| 1066 | Ga0501070_0351345 | |||
| 1067 | Ga0501071_0002527 | |||
| 1068 | Ga0501072_0018825 | |||
| 1069 | Ga0501073_0016163 | |||
| 1070 | Ga0501073_0023298 | |||
| 1071 | Ga0501073_0026853 | |||
| 1072 | Ga0501073_0112984 | |||
| 1073 | Ga0501074_0010109 | |||
| 1074 | Ga0501074_0013182 | |||
| 1075 | Ga0501074_0045854 | |||
| 1076 | Ga0501079_0007809 | |||
| 1077 | Ga0501079_0059768 | |||
| 1078 | Ga0501079_0316189 | |||
| 1079 | Ga0501080_0003935 | |||
| 1080 | Ga0501080_0012270 | |||
| 1081 | Ga0501080_0027848 | |||
| 1082 | Ga0501080_0054382 | |||
| 1083 | Ga0501083_0053605 | |||
| 1084 | Ga0501035_0003276 | |||
| 1085 | Ga0501035_0017031 | |||
| 1086 | Ga0501035_0021668 | |||
| 1087 | Ga0501035_0022419 | |||
| 1088 | Ga0501035_0071707 | |||
| 1089 | Ga0501044_0002495 | |||
| 1090 | Ga0501044_0006525 | |||
| 1091 | Ga0501044_0011297 | |||
| 1092 | Ga0501044_0042591 | |||
| 1093 | Ga0501044_0086907 | |||
| 1094 | Ga0501044_0091764 | |||
| 1095 | Ga0501044_0105779 | |||
| 1096 | nmdc:mga0sz30_22963_c1 | |||
| 1097 | Ga0500610_0003179 | |||
| 1098 | Ga0500643_000080 | |||
| 1099 | Ga0500643_002342 | |||
| 1100 | Ga0500651_0000066 | |||
| 1101 | Ga0500651_0003049 | |||
| 1102 | Ga0500651_0099854 | |||
| 1103 | Ga0500555_001068 | |||
| 1104 | Ga0500597_000072 | |||
| 1105 | Ga0500568_0001880 | |||
| 1106 | Ga0500633_0043858 | |||
| 1107 | Ga0500645_003771 | |||
| 1108 | Ga0501084_0004418 | |||
| 1109 | Ga0501084_0080351 | |||
| 1110 | Ga0501082_0002936 | |||
| 1111 | Ga0501082_0007664 | |||
| 1112 | Ga0466962_0001039 | |||
| 1113 | 2595448398 | |||
| 1114 | 2595451699 | |||
| 1115 | 2643894945 | |||
| 1116 | 2644477103 | |||
| 1117 | 2687582772 | |||
| 1118 | 2739227657 | |||
| 1119 | 2739731442 | |||
| 1120 | 2819563514 | |||
| 1121 | 2842915383 | |||
| 1122 | 2842921704 | |||
| 1123 | 2884339955 | |||
| 1124 | 2884414717 | |||
| 1125 | 2904464176 | |||
| 1126 | 2919085970 | |||
| 1127 | 2919404776 | |||
| 1128 | 2928963542 | |||
| 1129 | 2941472330 | |||
| 1130 | 2953997718 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5yb0-assembly6.cif.gz_L | crystal structure of wild type phosphoserine aminotransferase (psat) from e. histolytica | 0.9733 | 35 | 254 |
| 4xk1-assembly1.cif.gz_B | crystal structure of a phosphoserine/phosphohydroxythreonine aminotransferase (psat) from pseudomonas aeruginosa with cofactor pyridoxal phosphate and bound glutamate | 0.9669 | 5 | 351 |
| 5yb0-assembly5.cif.gz_J | crystal structure of wild type phosphoserine aminotransferase (psat) from e. histolytica | 0.966 | 7 | 265 |
| 2bi5-assembly1.cif.gz_B | radiation damage of the schiff base in phosphoserine aminotransferase (structure e) | 0.965 | 3 | 359 |
| 6xdk-assembly1.cif.gz_A | crystal structure of phosphoserine aminotransferase (serc) from stenotrophomonas maltophilia k279a | 0.964 | 5 | 361 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2bi2B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9797 | 18 | 256 | 3.40.640.10 |
| af_I1J8D7_67_308_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9763 | 17 | 255 | 3.40.640.10 |
| 2bi2B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9636 | 18 | 256 | 3.40.640.10 |
| af_I1J8D7_67_308_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9605 | 17 | 255 | 3.40.640.10 |
| af_Q55CQ6_22_267_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.96 | 17 | 255 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K9MY05-F1-model_v4 | Phosphoserine aminotransferase (Phosphohydroxythreonine aminotransferase) | 0.9836 | 65 | 270 |
GO:0004648
GO:0005737 GO:0006564 GO:0008615 GO:0030170 |
| AF-A0A658JAD1-F1-model_v4 | deleted | 0.981 | 74 | 299 |
|
| AF-A0A2N1YZ66-F1-model_v4 | deleted | 0.9804 | 37 | 282 |
|
| AF-A0A382MXN5-F1-model_v4 | Aminotransferase class V domain-containing protein | 0.9803 | 4 | 193 |
GO:0004648
GO:0005737 GO:0006564 GO:0030170 |
| AF-A0A2N2TGM9-F1-model_v4 | Phosphoserine aminotransferase (EC 2.6.1.52) | 0.9802 | 4 | 322 |
GO:0004648
GO:0005737 GO:0006564 GO:0008615 GO:0030170 |