F464288

General Info

Members Datasets Scaffolds Average Seq Length
565 467 1130 139

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000217|Ga0395899_0000217_33927_34376
Length 149
Sequence MKTTSYYPVIMTGDVAATADFYVQHLRFRPLFSSDWYVHLQSQEDETVNLGIVDAGHETVPEAARGRGAQGLLINFEVEDVDAVHERIAAAGPPILRSLRDEPFGQRHFIFADPNGVLIDVITPIPPSAEFLAQYEDGAAESPASGAAT

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
58 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
176 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
177 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
178 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
179 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
180 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
181 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
182 2512875024
183 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
184 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
185 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
186 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
187 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
188 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
189 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
190 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
191 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
192 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
193 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
194 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
195 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
196 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
197 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
198 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
199 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
200 2718217927 Rhizobium sp. N324 Isolate Nodule
201 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
202 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
203 2718218423 Rhizobium sp. N941 Isolate Nodule
204 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
205 2721755809 Rhizobium sp. N541 Isolate Nodule
206 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
207 2738543024 Aminobacter sp. AP02 Isolate Unclassified
208 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
209 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
210 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
211 2791355260 Rhizobium sp. L9 Isolate Nodule
212 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
213 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
214 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
215 2838048938 Rhizobium pisi 27/80 Isolate Nodule
216 2838061910 Rhizobium phaseoli L15 Isolate Nodule
217 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
218 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
219 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
220 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
221 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
222 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
223 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
224 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
225 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
226 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
227 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
228 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
229 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
230 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
231 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
232 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
233 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
234 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
235 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
236 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
237 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
238 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
239 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
240 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
241 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
242 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
243 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
244 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
245 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
246 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
247 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
248 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
249 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
250 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
251 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
252 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
253 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
254 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
255 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
256 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
257 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
258 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
259 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
260 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
261 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
262 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
263 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
264 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
265 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
266 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
267 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
268 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
269 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
270 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
271 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
272 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
273 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
274 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
275 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
276 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
277 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
278 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
279 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
280 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
281 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
282 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
283 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
284 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
285 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
286 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
287 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
288 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
289 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
290 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
291 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
292 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
293 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
294 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
295 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
296 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
297 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
298 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
299 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
300 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
301 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
302 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
303 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
304 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
305 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
306 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
307 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
308 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
309 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
310 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
311 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
312 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
313 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
314 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
315 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
316 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
317 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
318 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
319 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
320 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
321 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
322 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
323 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
324 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
325 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
326 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
327 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
328 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
329 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
330 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
331 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
332 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
333 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
334 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
335 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
336 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
337 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
338 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
339 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
340 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
341 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
342 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
343 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
344 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
345 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
346 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
347 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
348 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
349 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
350 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
351 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
352 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
353 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
354 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
355 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
356 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
357 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
358 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
359 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
360 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
361 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
362 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
363 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
364 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
365 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
366 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
367 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
368 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
369 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
370 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
371 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
372 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
373 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
374 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
375 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
376 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
377 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
378 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
379 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
380 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
381 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
382 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
383 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
384 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
385 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
386 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
387 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
388 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
389 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
390 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
391 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
392 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
393 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
394 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
395 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
396 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
397 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
398 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
399 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
400 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
401 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
402 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
403 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
404 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
405 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
406 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
407 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
408 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
409 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
410 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
411 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
412 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
413 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
414 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
415 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
416 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
417 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
418 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
419 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
420 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
421 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
422 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
423 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
424 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
425 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
426 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
427 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
428 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
429 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
430 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
431 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
432 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
433 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
434 3004167301 Mesorhizobium loti 582 Isolate Unclassified
435 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
436 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
437 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
438 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
439 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
440 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
441 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
442 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
443 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
444 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
445 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
446 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
447 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
448 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
449 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
450 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
451 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
452 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
453 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
454 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
455 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
456 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
457 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
458 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
459 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
460 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
461 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
462 8005275841 Rhizobium sp. N4311 Isolate Nodule
463 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
464 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
465 8018176218 Rhizobium sp. N122 Isolate Nodule
466 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
467 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.79
Metatranscriptomes 0
Isolates 52.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.87
Nodule 46.19
Rhizoplane 1.42
Rhizosphere 28.5
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000217 3300037312 Bacteria 80044
2 JGI25156J39149_1012146 3300002705 Bacteria 1912
3 JGI25157J39369_1001112 3300002741 Bacteria 11957
4 JGI25406J46586_10221915 3300003203 Unclassified 553
5 JGI25165J46597_1000006 3300003214 Bacteria 529784
6 rootH1_10027922 3300003316 Bacteria 1137
7 rootL2_10113058 3300003322 Bacteria 1814
8 Ga0055542_1000508 3300003762 Bacteria 35467
9 Ga0055529_1003707 3300003763 Bacteria 2469
10 Ga0055526_1004244 3300003771 Bacteria 8687
11 Ga0055536_1005040 3300003781 Bacteria 6562
12 Ga0055528_1000777 3300003790 Bacteria 22196
13 Ga0070658_10380409 3300005327 Bacteria 1211
14 Ga0070676_10866083 3300005328 Bacteria 671
15 Ga0070670_100474981 3300005331 Bacteria 1110
16 Ga0068869_101283881 3300005334 Bacteria 645
17 Ga0070668_100294636 3300005347 Bacteria 1359
18 Ga0070668_101329161 3300005347 Bacteria 654
19 Ga0070669_100613406 3300005353 Bacteria 912
20 Ga0070669_101190977 3300005353 Bacteria 658
21 Ga0070669_101439155 3300005353 Bacteria 598
22 Ga0070671_100521744 3300005355 Bacteria 1023
23 Ga0070674_100091279 3300005356 Bacteria 2199
24 Ga0070667_101169299 3300005367 Bacteria 720
25 Ga0070663_100502690 3300005455 Bacteria 1007
26 Ga0070663_101440599 3300005455 Bacteria 611
27 Ga0070678_100904919 3300005456 Bacteria 807
28 Ga0068867_100273678 3300005459 Bacteria 1382
29 Ga0068853_100011210 3300005539 Bacteria 7275
30 Ga0068853_100689779 3300005539 Bacteria 974
31 Ga0070686_101140234 3300005544 Bacteria 645
32 Ga0070665_101205022 3300005548 Bacteria 768
33 Ga0068855_100862474 3300005563 Bacteria 959
34 Ga0068857_100778486 3300005577 Bacteria 913
35 Ga0068856_100399695 3300005614 Bacteria 1394
36 Ga0068856_101106130 3300005614 Bacteria 810
37 Ga0068852_100939021 3300005616 Bacteria 883
38 Ga0068859_101190787 3300005617 Bacteria 839
39 Ga0068864_101826632 3300005618 Bacteria 613
40 Ga0068858_100686517 3300005842 Bacteria 996
41 Ga0081455_10017698 3300005937 Bacteria 6818
42 Ga0081455_10398734 3300005937 Bacteria 955
43 Ga0081539_10002197 3300005985 Bacteria 28566
44 Ga0075365_10039199 3300006038 Bacteria 3084
45 Ga0075365_10084413 3300006038 Bacteria 2155
46 Ga0075365_10206473 3300006038 Bacteria 1377
47 Ga0075365_10263312 3300006038 Bacteria 1212
48 Ga0075365_10601774 3300006038 Bacteria 777
49 Ga0075365_10714040 3300006038 Bacteria 708
50 Ga0075368_10018620 3300006042 Bacteria 2611
51 Ga0075368_10131074 3300006042 Bacteria 1042
52 Ga0075363_100076944 3300006048 Bacteria 1820
53 Ga0075363_100119123 3300006048 Bacteria 1473
54 Ga0075363_100207459 3300006048 Bacteria 1121
55 Ga0075364_10040508 3300006051 Bacteria 3021
56 Ga0075364_10177334 3300006051 Bacteria 1442
57 Ga0075364_10217951 3300006051 Bacteria 1295
58 Ga0075364_10521189 3300006051 Bacteria 812
59 Ga0075362_10035712 3300006177 Bacteria 2171
60 Ga0075362_10107098 3300006177 Bacteria 1312
61 Ga0075362_10305936 3300006177 Bacteria 789
62 Ga0075367_10138971 3300006178 Bacteria 1504
63 Ga0075369_10003762 3300006186 Bacteria 5549
64 Ga0075369_10051368 3300006186 Bacteria 1785
65 Ga0075369_10058007 3300006186 Bacteria 1685
66 Ga0075369_10108247 3300006186 Bacteria 1252
67 Ga0075366_10107871 3300006195 Bacteria 1674
68 Ga0075366_10221093 3300006195 Bacteria 1154
69 Ga0075366_10309667 3300006195 Bacteria 967
70 Ga0075366_10747359 3300006195 Bacteria 608
71 Ga0075370_10288288 3300006353 Bacteria 975
72 Ga0075428_100762011 3300006844 Bacteria 1030
73 Ga0068865_100399982 3300006881 Bacteria 1125
74 Ga0097620_101190579 3300006931 Bacteria 839
75 Ga0105240_10427608 3300009093 Bacteria 1486
76 Ga0105240_10679086 3300009093 Bacteria 1126
77 Ga0111539_10652023 3300009094 Bacteria 1226
78 Ga0105247_10860292 3300009101 Bacteria 697
79 Ga0105243_11127694 3300009148 Bacteria 794
80 Ga0105241_10712863 3300009174 Bacteria 917
81 Ga0105241_11515612 3300009174 Bacteria 646
82 Ga0105241_12040067 3300009174 Bacteria 565
83 Ga0105237_11901020 3300009545 Bacteria 603
84 Ga0105238_10001491 3300009551 Bacteria 23486
85 Ga0105238_12416195 3300009551 Bacteria 561
86 Ga0105249_10159135 3300009553 Bacteria 2181
87 Ga0123341_1000015 3300009765 Bacteria 86184
88 Ga0123342_1031981 3300009766 Bacteria 2502
89 Ga0105239_10007320 3300010375 Bacteria 12672
90 Ga0105239_10434695 3300010375 Bacteria 1488
91 Ga0105239_10581122 3300010375 Bacteria 1277
92 Ga0105239_10789618 3300010375 Bacteria 1088
93 Ga0105239_11522363 3300010375 Bacteria 773
94 Ga0105239_11756976 3300010375 Bacteria 718
95 Ga0105239_12440701 3300010375 Bacteria 609
96 Ga0105246_10892645 3300011119 Bacteria 796
97 Ga0157370_10154694 3300013104 Bacteria 2134
98 Ga0157370_10782821 3300013104 Bacteria 868
99 Ga0157370_11528549 3300013104 Bacteria 600
100 Ga0157374_10503048 3300013296 Bacteria 1216
101 Ga0157374_11762556 3300013296 Bacteria 644
102 Ga0157378_10675414 3300013297 Bacteria 1050
103 Ga0163162_10631633 3300013306 Bacteria 1195
104 Ga0157375_11464202 3300013308 Bacteria 805
105 Ga0163163_11908977 3300014325 Bacteria 654
106 Ga0163163_11967408 3300014325 Bacteria 644
107 Ga0157380_12644388 3300014326 Bacteria 568
108 Ga0182008_10201635 3300014497 Bacteria 1012
109 Ga0157377_10226101 3300014745 Bacteria 1201
110 Ga0157379_12270787 3300014968 Bacteria 540
111 Ga0157376_10219348 3300014969 Bacteria 1761
112 Ga0182006_1139380 3300015261 Bacteria 830
113 Ga0163161_11237242 3300017792 Bacteria 647
114 Ga0209026_1000247 3300025250 Bacteria 68920
115 Ga0209677_114742 3300025253 Bacteria 1054
116 Ga0209148_1000233 3300025254 Bacteria 90861
117 Ga0209148_1015008 3300025254 Bacteria 1362
118 Ga0209759_1000633 3300025256 Bacteria 33091
119 Ga0209233_1000010 3300025261 Bacteria 1194329
120 Ga0209233_1034717 3300025261 Bacteria 1145
121 Ga0209455_1000062 3300025272 Bacteria 335169
122 Ga0209673_1000320 3300025273 Bacteria 88073
123 Ga0209676_1000100 3300025292 Bacteria 229621
124 Ga0209025_1070567 3300025294 Bacteria 1243
125 Ga0209564_1000345 3300025295 Bacteria 88073
126 Ga0209758_1014101 3300025297 Bacteria 4286
127 Ga0209050_1024917 3300025298 Bacteria 2052
128 Ga0209256_1000343 3300025299 Bacteria 75902
129 Ga0207680_10403739 3300025903 Bacteria 966
130 Ga0207647_10051674 3300025904 Bacteria 2539
131 Ga0207647_10142474 3300025904 Bacteria 1404
132 Ga0207645_10196560 3300025907 Bacteria 1326
133 Ga0207645_10228593 3300025907 Bacteria 1228
134 Ga0207705_10395470 3300025909 Bacteria 1068
135 Ga0207684_11334562 3300025910 Bacteria 589
136 Ga0207695_10215316 3300025913 Bacteria 1830
137 Ga0207695_10336575 3300025913 Bacteria 1397
138 Ga0207695_10671238 3300025913 Bacteria 917
139 Ga0207671_10010598 3300025914 Bacteria 7588
140 Ga0207649_10296426 3300025920 Bacteria 1181
141 Ga0207681_11278908 3300025923 Bacteria 616
142 Ga0207694_10003480 3300025924 Bacteria 12519
143 Ga0207644_10883855 3300025931 Bacteria 749
144 Ga0207690_10353911 3300025932 Bacteria 1162
145 Ga0207669_10047039 3300025937 Bacteria 2553
146 Ga0207667_10277324 3300025949 Bacteria 1713
147 Ga0207668_10185148 3300025972 Bacteria 1646
148 Ga0207668_10519917 3300025972 Bacteria 1027
149 Ga0207658_10191179 3300025986 Bacteria 1702
150 Ga0207639_10016456 3300026041 Bacteria 5233
151 Ga0207639_10270409 3300026041 Bacteria 1490
152 Ga0207702_11267998 3300026078 Bacteria 731
153 Ga0207648_10101756 3300026089 Bacteria 2517
154 Ga0207674_10436161 3300026116 Bacteria 1266
155 Ga0207675_101578100 3300026118 Bacteria 677
156 Ga0207683_10366147 3300026121 Bacteria 1324
157 Ga0207683_10478769 3300026121 Bacteria 1149
158 Ga0207683_10828036 3300026121 Bacteria 859
159 Ga0207698_11307642 3300026142 Bacteria 740
160 Ga0209813_10096092 3300027866 Bacteria 1002
161 Ga0268266_11807334 3300028379 Bacteria 586
162 Ga0307408_100389225 3300031548 Bacteria 1194
163 Ga0307405_10877377 3300031731 Bacteria 757
164 Ga0307410_10512418 3300031852 Bacteria 989
165 Ga0307412_10670258 3300031911 Bacteria 887
166 Ga0307416_102889028 3300032002 Unclassified 575
167 Ga0373941_0092053 3300035115 Bacteria 1042
168 Ga0395899_0418499 3300037312 Bacteria 883
169 Ga0395900_0000270 3300037418 Bacteria 80046
170 Ga0395900_0139190 3300037418 Bacteria 2486
171 Ga0395900_0230280 3300037418 Bacteria 1864
172 Ga0395900_0253230 3300037418 Bacteria 1761
173 Ga0395900_0282063 3300037418 Bacteria 1653
174 Ga0395900_0580586 3300037418 Bacteria 1063
175 Ga0395900_0825229 3300037418 Bacteria 854
176 Ga0395898_0000470 3300037466 Bacteria 80783
177 Ga0395898_0450371 3300037466 Bacteria 1226
178 Ga0395898_1516354 3300037466 Bacteria 596
179 Ga0395905_0000253 3300037471 Bacteria 80046
180 Ga0395905_0043409 3300037471 Bacteria 4218
181 Ga0395905_0057269 3300037471 Bacteria 3646
182 Ga0395905_1252958 3300037471 Bacteria 645
183 Ga0395901_0000285 3300038443 Bacteria 62844
184 Ga0395901_0026064 3300038443 Bacteria 6003
185 Ga0395901_0191548 3300038443 Bacteria 2144
186 Ga0395901_0249253 3300038443 Bacteria 1851
187 Ga0395901_0569824 3300038443 Bacteria 1145
188 Ga0395901_0753450 3300038443 Bacteria 967
189 Ga0395901_0936742 3300038443 Bacteria 846
190 Ga0400483_081542 3300039062 Bacteria 1430
191 Ga0400483_184605 3300039062 Bacteria 2008
192 Ga0451793_1921909 3300041452 Bacteria 1295
193 Ga0451837_0268224 3300041494 Bacteria 580
194 Ga0439431_0170688 3300041997 Bacteria 625
195 Ga0439458_0080811 3300042157 Bacteria 829
196 Ga0439464_0118358 3300042439 Bacteria 815
197 Ga0466972_0036127 3300044658 Bacteria 2418
198 Ga0466972_0053777 3300044658 Bacteria 1938
199 Ga0466960_0134414 3300044901 Bacteria 1308
200 Ga0466967_0178466 3300045976 Bacteria 2002
201 Ga0495638_0585596 3300046460 Bacteria 550
202 Ga0495668_0130491 3300046616 Bacteria 1376
203 Ga0495668_0211483 3300046616 Bacteria 1062
204 Ga0495668_0735422 3300046616 Bacteria 546
205 Ga0495625_0042121 3300046660 Bacteria 3320
206 Ga0495625_0179689 3300046660 Bacteria 1408
207 Ga0495681_0259345 3300047470 Bacteria 684
208 Ga0495626_0174557 3300048091 Bacteria 894
209 Ga0496102_0137508 3300048905 Bacteria 2290
210 Ga0496103_0135808 3300048906 Bacteria 1572
211 Ga0496107_1116785 3300048910 Bacteria 569
212 Ga0496112_0355603 3300048915 Bacteria 1407
213 Ga0496113_0333293 3300048916 Bacteria 1217
214 Ga0496115_0997463 3300048918 Bacteria 640
215 Ga0496117_0309465 3300048920 Bacteria 833
216 Ga0496118_0058949 3300048921 Bacteria 2864
217 Ga0496119_0249143 3300048922 Bacteria 896
218 Ga0496119_0288955 3300048922 Bacteria 812
219 Ga0496120_0000909 3300048923 Bacteria 41346
220 Ga0496121_0328448 3300048924 Bacteria 1027
221 Ga0496124_0125543 3300048927 Bacteria 2045
222 Ga0496125_0133319 3300048928 Bacteria 1744
223 Ga0496126_0191261 3300048929 Bacteria 1733
224 Ga0496126_0244796 3300048929 Bacteria 1496
225 Ga0496126_0737574 3300048929 Bacteria 762
226 Ga0501298_174915 3300049521 Bacteria 536
227 Ga0501067_0041690 3300049583 Bacteria 2549
228 Ga0501073_0659733 3300049589 Bacteria 722
229 Ga0501080_0406926 3300049742 Bacteria 1224
230 Ga0501044_0020676 3300049823 Bacteria 7028
231 Ga0501045_0369442 3300049824 Bacteria 1068
232 nmdc:mga03683_34881_c1 3300050489 Bacteria 2038
233 nmdc:mga03683_420927_c1 3300050489 Bacteria 640
234 nmdc:mga03683_451644_c1 3300050489 Bacteria 618
235 nmdc:mga03n38_439673_c1 3300050490 Bacteria 724
236 nmdc:mga03n38_69981_c1 3300050490 Bacteria 1621
237 nmdc:mga00v17_394079_c1 3300050491 Bacteria 900
238 nmdc:mga00v17_401191_c1 3300050491 Bacteria 891
239 nmdc:mga00v17_695359_c1 3300050491 Bacteria 652
240 nmdc:mga0yw44_1658_c1 3300050492 Bacteria 8982
241 nmdc:mga0yw44_184166_c1 3300050492 Bacteria 1375
242 nmdc:mga0yw44_429587_c1 3300050492 Bacteria 895
243 nmdc:mga0yw44_739879_c1 3300050492 Bacteria 668
244 nmdc:mga0k408_131891_c1 3300050493 Bacteria 1483
245 nmdc:mga0k408_318313_c1 3300050493 Bacteria 928
246 nmdc:mga0k408_46534_c1 3300050493 Bacteria 2505
247 nmdc:mga0k408_895612_c1 3300050493 Bacteria 515
248 nmdc:mga06z11_43091_c1 3300050494 Bacteria 2268
249 nmdc:mga06z11_559175_c1 3300050494 Bacteria 695
250 nmdc:mga06z11_858075_c1 3300050494 Bacteria 553
251 nmdc:mga04h51_237441_c1 3300050495 Bacteria 727
252 nmdc:mga07m45_194016_c1 3300050496 Bacteria 1181
253 nmdc:mga07m45_222994_c1 3300050496 Bacteria 802
254 nmdc:mga07m45_323892_c1 3300050496 Bacteria 896
255 nmdc:mga08y16_263611_c1 3300050511 Bacteria 1779
256 nmdc:mga0sz30_149759_c1 3300050516 Bacteria 1032
257 nmdc:mga0sz30_15765_c2 3300050516 Bacteria 1435
258 nmdc:mga0sz30_398_c1 3300050516 Bacteria 16552
259 Ga0500610_0002918 3300053079 Bacteria 6437
260 Ga0500610_0407376 3300053079 Bacteria 550
261 Ga0495655_0009520 3300053083 Bacteria 1887
262 Ga0500562_179499 3300053108 Bacteria 575
263 Ga0500658_0053829 3300053134 Bacteria 1652
264 Ga0500658_0497330 3300053134 Bacteria 552
265 Ga0500568_0000170 3300053139 Bacteria 56559
266 Ga0500620_000162 3300053155 Bacteria 13386
267 Ga0500627_0050396 3300053158 Bacteria 1813
268 Ga0500627_0081341 3300053158 Bacteria 1444
269 Ga0500611_149260 3300053727 Bacteria 641
270 Ga0501084_1380089 3300054114 Bacteria 590
271 2503200503 2503198000 Bacteria 6884444
272 2509117985 2508501123 Bacteria 6283661
273 2509139698 2508501127 Bacteria 7037543
274 2509373607 2509276018 Bacteria 6910194
275 2509395288 2509276022 Bacteria 6200534
276 2510313978 2510065059 Bacteria 6847884
277 2512932116 2512875016 Bacteria 6529530
278 2512960120 2512875024 Bacteria 7195110
279 2513611991 2513237090 Bacteria 7096802
280 2514034791 2513237164 Bacteria 7563725
281 2514416998 2513237305 Bacteria 7293571
282 2514587871 2513237351 Bacteria 6968952
283 2515637149 2515154113 Bacteria 7807172
284 2588518150 2588253730 Bacteria 6881675
285 2597812440 2597489875 Bacteria 7010078
286 2599936077 2599185301 Bacteria 6161860
287 2616295647 2615840624 Bacteria 6557588
288 2643770896 2643221550 Bacteria 4619371
289 2643776243 2643221551 Bacteria 3750538
290 2643794690 2643221555 Bacteria 3749717
291 2643987964 2643221595 Bacteria 6565519
292 2644158134 2643221627 Bacteria 6761570
293 2688597665 2687453392 Bacteria 6880454
294 2694632424 2693429783 Bacteria 7019804
295 2694639173 2693429784 Bacteria 7241525
296 2719387352 2718217927 Bacteria 6972593
297 2719666997 2718217997 Bacteria 6740740
298 2720493417 2718218199 Bacteria 6740745
299 2721400987 2718218423 Bacteria 6438183
300 2723574851 2721755686 Bacteria 7343952
301 2724039800 2721755809 Bacteria 6438790
302 2724111652 2721755823 Bacteria 6752556
303 2739307094 2738543024 Bacteria 5603683
304 2756671954 2756170246 Bacteria 7451806
305 2792752156 2791355123 Bacteria 8049106
306 2793312991 2791355259 Bacteria 7254731
307 2793319638 2791355260 Bacteria 6598818
308 2805929491 2802429605 Bacteria 6875453
309 2819243904 2818991272 Bacteria 4622173
310 2838024216 2838022645 Bacteria 6494267
311 2838051088 2838048938 Bacteria 6044578
312 2838063934 2838061910 Bacteria 6794874
313 2841738461 2841734538 Bacteria 6784580
314 2842199758 2842198810 Bacteria 6608673
315 2842269913 2842264693 Bacteria 6472963
316 2842316410 2842311132 Bacteria 6616990
317 2842398423 2842395702 Bacteria 6780583
318 2842433842 2842428310 Bacteria 6767288
319 2842440126 2842434925 Bacteria 6502746
320 2842446863 2842441272 Bacteria 6769273
321 2842453637 2842447887 Bacteria 6754142
322 2842468209 2842462802 Bacteria 6588055
323 2842474735 2842469257 Bacteria 6752936
324 2844008099 2844002411 Bacteria 7168230
325 2844013056 2844009547 Bacteria 6728125
326 2847691520 2847686936 Bacteria 6278406
327 2856326763 2856320880 Bacteria 7263508
328 2856333562 2856328259 Bacteria 6528202
329 2856337968 2856334872 Bacteria 7037011
330 2856343640 2856342000 Bacteria 7176905
331 2856355670 2856349417 Bacteria 6230045
332 2856359262 2856356410 Bacteria 6297484
333 2856366224 2856364286 Bacteria 6939991
334 2857351387 2857349434 Bacteria 7926032
335 2857369308 2857367948 Bacteria 6965560
336 2869164513 2869162929 Bacteria 6399702
337 2869175584 2869169390 Bacteria 6659796
338 2869241610 2869234852 Bacteria 6654993
339 2869247246 2869242130 Bacteria 6609239
340 2869252854 2869249662 Bacteria 6868783
341 2869258593 2869256925 Bacteria 6981691
342 2869267532 2869264136 Bacteria 6880765
343 2869273385 2869271264 Bacteria 6908218
344 2869283684 2869278585 Bacteria 7077053
345 2869287259 2869285874 Bacteria 6901219
346 2871430558 2871429161 Bacteria 6547891
347 2871442709 2871435913 Bacteria 6880295
348 2871459577 2871451962 Bacteria 7336357
349 2871465816 2871459585 Bacteria 6866887
350 2871471303 2871466892 Bacteria 6923287
351 2871479912 2871474448 Bacteria 6806570
352 2871486951 2871481445 Bacteria 6700002
353 2871491916 2871488783 Bacteria 6929816
354 2871502653 2871495908 Bacteria 6935695
355 2874105615 2874102143 Bacteria 6342645
356 2874110975 2874109183 Bacteria 6517025
357 2874120379 2874116593 Bacteria 6674494
358 2874125220 2874123672 Bacteria 7238285
359 2874138273 2874131515 Bacteria 6820270
360 2874140144 2874139085 Bacteria 7021506
361 2874149164 2874146452 Bacteria 7533118
362 2874156050 2874155637 Bacteria 6724144
363 2874165388 2874162495 Bacteria 6174670
364 2874169104 2874168670 Bacteria 8062617
365 2876367854 2876363079 Bacteria 6544991
366 2876374116 2876369609 Bacteria 6807521
367 2876380201 2876377896 Bacteria 6565995
368 2876389529 2876386047 Bacteria 6698674
369 2876394080 2876392853 Bacteria 6660880
370 2876402924 2876399893 Bacteria 6927900
371 2876412811 2876406927 Bacteria 6191900
372 2876415413 2876413966 Bacteria 6831344
373 2876426311 2876420981 Bacteria 6687741
374 2878732248 2878730984 Bacteria 6380721
375 2878738886 2878738818 Bacteria 7136951
376 2878746991 2878745973 Bacteria 6867388
377 2878753119 2878753008 Bacteria 6922523
378 2878766545 2878760144 Bacteria 6823465
379 2878773741 2878767105 Bacteria 6898628
380 2878784312 2878781027 Bacteria 6834456
381 2878790127 2878788777 Bacteria 6567085
382 2881150942 2881147464 Bacteria 7779814
383 2881161467 2881155292 Bacteria 6461656
384 2881167202 2881161766 Bacteria 7127907
385 2881852576 2881845957 Bacteria 6611900
386 2881857753 2881853255 Bacteria 6698367
387 2881867094 2881861095 Bacteria 7128710
388 2882640590 2882632389 Bacteria 8154593
389 2882913218 2882912400 Bacteria 6801539
390 2885308700 2885305155 Bacteria 7348390
391 2885312527 2885312484 Bacteria 6415165
392 2885325993 2885318864 Bacteria 6729568
393 2885328779 2885326080 Bacteria 7134805
394 2885335160 2885334103 Bacteria 7216818
395 2885349131 2885342637 Bacteria 7011821
396 2885352160 2885350715 Bacteria 6787678
397 2888338730 2888337043 Bacteria 6629336
398 2888346209 2888343758 Bacteria 6611049
399 2888355532 2888350351 Bacteria 7372807
400 2889010495 2889010040 Bacteria 6749192
401 2889017833 2889016732 Bacteria 6700763
402 2903450633 2903448605 Bacteria 7357801
403 2903500493 2903492973 Bacteria 13473544
404 2903501825 2903492973 Bacteria 13473544
405 2903519045 2903513507 Bacteria 6344008
406 2903521628 2903521522 Bacteria 6525694
407 2903528006 2903528002 Bacteria 6586099
408 2903547694 2903540706 Bacteria 7062119
409 2904660411 2904659560 Bacteria 6685615
410 2906309804 2906308376 Bacteria 6841989
411 2906322439 2906321335 Bacteria 6579571
412 2906330298 2906328253 Bacteria 6585166
413 2906361761 2906354277 Bacteria 6991324
414 2906365262 2906363423 Bacteria 6856682
415 2906374354 2906370794 Bacteria 6881062
416 2906385339 2906378014 Bacteria 6911440
417 2906391439 2906386501 Bacteria 5977019
418 2906395484 2906393657 Bacteria 6790866
419 2906407809 2906401398 Bacteria 6693206
420 2906408295 2906408224 Bacteria 6162342
421 2906427518 2906427513 Bacteria 6375796
422 2922130653 2922130491 Bacteria 7173936
423 2922151362 2922151315 Bacteria 6902399
424 2922172968 2922172374 Bacteria 6167644
425 2922185179 2922178524 Bacteria 6025201
426 2922192584 2922185730 Bacteria 7113964
427 2924718563 2924710171 Bacteria 6752351
428 2924726586 2924718760 Bacteria 6331356
429 2924740064 2924733363 Bacteria 7574837
430 2924742388 2924741084 Bacteria 6661321
431 2924751033 2924748358 Bacteria 6154725
432 2924757311 2924754689 Bacteria 6774424
433 2924769157 2924762789 Bacteria 6561353
434 2924776248 2924776078 Bacteria 7492003
435 2924786227 2924784321 Bacteria 7416538
436 2937814898 2937813078 Bacteria 7783518
437 2937828869 2937822353 Bacteria 7290551
438 2937841743 2937836603 Bacteria 6811263
439 2937849985 2937848649 Bacteria 6983481
440 2937863853 2937861824 Bacteria 6660327
441 2937870005 2937868953 Bacteria 6639878
442 2937884295 2937877337 Bacteria 7246526
443 2937979603 2937972304 Bacteria 7532020
444 2937981320 2937980651 Bacteria 6517427
445 2938022154 2938014810 Bacteria 6700592
446 2939670135 2939669807 Bacteria 5028511
447 2958040196 2958034702 Bacteria 6989922
448 2958054540 2958041894 Bacteria 13082850
449 2958055536 2958041894 Bacteria 13082850
450 2958069127 2958064165 Bacteria 7158582
451 2958077919 2958071322 Bacteria 6815895
452 2958091606 2958084443 Bacteria 7312792
453 2958099362 2958092219 Bacteria 6861151
454 2958102233 2958100919 Bacteria 6800575
455 2958108474 2958108152 Bacteria 6681128
456 2958118071 2958115193 Bacteria 6923548
457 2958128007 2958122699 Bacteria 7280457
458 2958131759 2958130278 Bacteria 6897202
459 2958144395 2958137437 Bacteria 6050276
460 2958150916 2958144490 Bacteria 6677056
461 2958161873 2958158011 Bacteria 6058449
462 2958176749 2958172287 Bacteria 6716688
463 2958180819 2958179912 Bacteria 6874908
464 2961078657 2961077736 Bacteria 7079850
465 2961115736 2961114664 Bacteria 6680456
466 2961133601 2961127735 Bacteria 7196641
467 2961137981 2961136820 Bacteria 6775228
468 2961171081 2961170736 Bacteria 7072258
469 2961183914 2961183825 Bacteria 6688536
470 2963647090 2963644680 Bacteria 6530403
471 2965024915 2965018300 Bacteria 6883036
472 2965025855 2965025482 Bacteria 6532201
473 2965035396 2965032056 Bacteria 6887443
474 2965046792 2965040258 Bacteria 6855979
475 2965053278 2965047637 Bacteria 6623551
476 2965068495 2965062239 Bacteria 7412989
477 2965094666 2965089291 Bacteria 6866420
478 2965118746 2965110997 Bacteria 6693150
479 2965123308 2965119406 Bacteria 6956431
480 2967997649 2967996073 Bacteria 6787468
481 2968006648 2968003550 Bacteria 6929263
482 2968019038 2968016561 Bacteria 7022047
483 2968088108 2968083720 Bacteria 7351627
484 2968095156 2968091066 Bacteria 6052692
485 2968101846 2968097103 Bacteria 6107094
486 2968111469 2968110612 Bacteria 6814636
487 2968130712 2968128360 Bacteria 6270294
488 2970470789 2970469710 Bacteria 6969209
489 2970493397 2970489779 Bacteria 6517260
490 2970503675 2970503327 Bacteria 7099517
491 2970511213 2970510686 Bacteria 7006402
492 2970527706 2970524798 Bacteria 6840927
493 2970537687 2970532167 Bacteria 6553173
494 2970545140 2970540015 Bacteria 6977556
495 2970551548 2970547951 Bacteria 6931819
496 2970597891 2970593180 Bacteria 7073582
497 2970619597 2970619444 Bacteria 6986144
498 2970632746 2970627176 Bacteria 6680862
499 2977822051 2977821940 Bacteria 6906439
500 2977832409 2977828996 Bacteria 7007971
501 2977845642 2977843712 Bacteria 6753583
502 2977852620 2977851361 Bacteria 6694324
503 2977860968 2977858184 Bacteria 6215359
504 2977878007 2977872689 Bacteria 7270173
505 2977903684 2977898635 Bacteria 6675551
506 2977911388 2977907340 Bacteria 6577984
507 2977918596 2977915119 Bacteria 6829656
508 2977928526 2977922695 Bacteria 6956781
509 2977939094 2977935797 Bacteria 6252826
510 2977945214 2977942078 Bacteria 7570577
511 2977954695 2977950692 Bacteria 6893264
512 2977958700 2977957713 Bacteria 6877875
513 2977976701 2977971508 Bacteria 7472917
514 2977986677 2977986579 Bacteria 6581278
515 2979716489 2979710463 Bacteria 6785254
516 2979749386 2979742915 Bacteria 7301278
517 2979771286 2979764755 Bacteria 6610066
518 2979776101 2979772303 Bacteria 6618277
519 2979785355 2979779861 Bacteria 6219781
520 2979797140 2979793036 Bacteria 6808957
521 2979808311 2979808191 Bacteria 7179355
522 2987638571 2987636660 Bacteria 8088555
523 2987647880 2987645492 Bacteria 6117018
524 2987656544 2987652177 Bacteria 6969023
525 2987666405 2987659509 Bacteria 6966464
526 2987673008 2987666974 Bacteria 6509233
527 2987680067 2987673487 Bacteria 6884027
528 2996340397 2996336353 Bacteria 5511628
529 2996356674 2996348954 Bacteria 7239054
530 2996388557 2996386984 Bacteria 6978667
531 3000140033 3000135777 Bacteria 6891109
532 3004168099 3004167301 Bacteria 8330599
533 3004198692 3004195979 Bacteria 6776956
534 3004205186 3004203850 Bacteria 7307914
535 3004215469 3004211236 Bacteria 7417683
536 3004225688 3004218560 Bacteria 7421728
537 3004233034 3004232784 Bacteria 6662140
538 3004240399 3004239961 Bacteria 6892290
539 3004252115 3004248173 Bacteria 6563236
540 3004272728 3004268573 Bacteria 7043476
541 3004282977 3004275668 Bacteria 7114440
542 3004294713 3004289098 Bacteria 6135450
543 3004335211 3004334049 Bacteria 8449246
544 637075215 637000159 Bacteria 7596297
545 649872207 649633066 Bacteria 6690028
546 8002289148 8002285264 Bacteria 6717907
547 8004303641 8004300914 Bacteria 6132239
548 8004318352 8004312739 Bacteria 7444653
549 8004365480 8004361976 Bacteria 6858373
550 8004374691 8004374579 Bacteria 6898112
551 8004389096 8004387939 Bacteria 7049250
552 8004398744 8004395343 Bacteria 6620908
553 8004448844 8004445564 Bacteria 6322258
554 8004635298 8004633249 Bacteria 6723080
555 8004640999 8004640170 Bacteria 6723001
556 8004703749 8004695233 Bacteria 6731676
557 8004708975 8004703790 Bacteria 8006957
558 8004716159 8004714634 Bacteria 6776161
559 8004733122 8004727605 Bacteria 6643904
560 8005282099 8005275841 Bacteria 6929066
561 8006986594 8006984368 Bacteria 9651211
562 8018133532 8018127388 Bacteria 7351159
563 8018178381 8018176218 Bacteria 6896178
564 8055619935 8055617313 Bacteria 7548464
565 8057877085 8057874678 Bacteria 7494653
566 Ga0395899_0000217
567 JGI25156J39149_1012146
568 JGI25157J39369_1001112
569 JGI25406J46586_10221915
570 JGI25165J46597_1000006
571 rootH1_10027922
572 rootL2_10113058
573 Ga0055542_1000508
574 Ga0055529_1003707
575 Ga0055526_1004244
576 Ga0055536_1005040
577 Ga0055528_1000777
578 Ga0070658_10380409
579 Ga0070676_10866083
580 Ga0070670_100474981
581 Ga0068869_101283881
582 Ga0070668_100294636
583 Ga0070668_101329161
584 Ga0070669_100613406
585 Ga0070669_101190977
586 Ga0070669_101439155
587 Ga0070671_100521744
588 Ga0070674_100091279
589 Ga0070667_101169299
590 Ga0070663_100502690
591 Ga0070663_101440599
592 Ga0070678_100904919
593 Ga0068867_100273678
594 Ga0068853_100011210
595 Ga0068853_100689779
596 Ga0070686_101140234
597 Ga0070665_101205022
598 Ga0068855_100862474
599 Ga0068857_100778486
600 Ga0068856_100399695
601 Ga0068856_101106130
602 Ga0068852_100939021
603 Ga0068859_101190787
604 Ga0068864_101826632
605 Ga0068858_100686517
606 Ga0081455_10017698
607 Ga0081455_10398734
608 Ga0081539_10002197
609 Ga0075365_10039199
610 Ga0075365_10084413
611 Ga0075365_10206473
612 Ga0075365_10263312
613 Ga0075365_10601774
614 Ga0075365_10714040
615 Ga0075368_10018620
616 Ga0075368_10131074
617 Ga0075363_100076944
618 Ga0075363_100119123
619 Ga0075363_100207459
620 Ga0075364_10040508
621 Ga0075364_10177334
622 Ga0075364_10217951
623 Ga0075364_10521189
624 Ga0075362_10035712
625 Ga0075362_10107098
626 Ga0075362_10305936
627 Ga0075367_10138971
628 Ga0075369_10003762
629 Ga0075369_10051368
630 Ga0075369_10058007
631 Ga0075369_10108247
632 Ga0075366_10107871
633 Ga0075366_10221093
634 Ga0075366_10309667
635 Ga0075366_10747359
636 Ga0075370_10288288
637 Ga0075428_100762011
638 Ga0068865_100399982
639 Ga0097620_101190579
640 Ga0105240_10427608
641 Ga0105240_10679086
642 Ga0111539_10652023
643 Ga0105247_10860292
644 Ga0105243_11127694
645 Ga0105241_10712863
646 Ga0105241_11515612
647 Ga0105241_12040067
648 Ga0105237_11901020
649 Ga0105238_10001491
650 Ga0105238_12416195
651 Ga0105249_10159135
652 Ga0123341_1000015
653 Ga0123342_1031981
654 Ga0105239_10007320
655 Ga0105239_10434695
656 Ga0105239_10581122
657 Ga0105239_10789618
658 Ga0105239_11522363
659 Ga0105239_11756976
660 Ga0105239_12440701
661 Ga0105246_10892645
662 Ga0157370_10154694
663 Ga0157370_10782821
664 Ga0157370_11528549
665 Ga0157374_10503048
666 Ga0157374_11762556
667 Ga0157378_10675414
668 Ga0163162_10631633
669 Ga0157375_11464202
670 Ga0163163_11908977
671 Ga0163163_11967408
672 Ga0157380_12644388
673 Ga0182008_10201635
674 Ga0157377_10226101
675 Ga0157379_12270787
676 Ga0157376_10219348
677 Ga0182006_1139380
678 Ga0163161_11237242
679 Ga0209026_1000247
680 Ga0209677_114742
681 Ga0209148_1000233
682 Ga0209148_1015008
683 Ga0209759_1000633
684 Ga0209233_1000010
685 Ga0209233_1034717
686 Ga0209455_1000062
687 Ga0209673_1000320
688 Ga0209676_1000100
689 Ga0209025_1070567
690 Ga0209564_1000345
691 Ga0209758_1014101
692 Ga0209050_1024917
693 Ga0209256_1000343
694 Ga0207680_10403739
695 Ga0207647_10051674
696 Ga0207647_10142474
697 Ga0207645_10196560
698 Ga0207645_10228593
699 Ga0207705_10395470
700 Ga0207684_11334562
701 Ga0207695_10215316
702 Ga0207695_10336575
703 Ga0207695_10671238
704 Ga0207671_10010598
705 Ga0207649_10296426
706 Ga0207681_11278908
707 Ga0207694_10003480
708 Ga0207644_10883855
709 Ga0207690_10353911
710 Ga0207669_10047039
711 Ga0207667_10277324
712 Ga0207668_10185148
713 Ga0207668_10519917
714 Ga0207658_10191179
715 Ga0207639_10016456
716 Ga0207639_10270409
717 Ga0207702_11267998
718 Ga0207648_10101756
719 Ga0207674_10436161
720 Ga0207675_101578100
721 Ga0207683_10366147
722 Ga0207683_10478769
723 Ga0207683_10828036
724 Ga0207698_11307642
725 Ga0209813_10096092
726 Ga0268266_11807334
727 Ga0307408_100389225
728 Ga0307405_10877377
729 Ga0307410_10512418
730 Ga0307412_10670258
731 Ga0307416_102889028
732 Ga0373941_0092053
733 Ga0395899_0418499
734 Ga0395900_0000270
735 Ga0395900_0139190
736 Ga0395900_0230280
737 Ga0395900_0253230
738 Ga0395900_0282063
739 Ga0395900_0580586
740 Ga0395900_0825229
741 Ga0395898_0000470
742 Ga0395898_0450371
743 Ga0395898_1516354
744 Ga0395905_0000253
745 Ga0395905_0043409
746 Ga0395905_0057269
747 Ga0395905_1252958
748 Ga0395901_0000285
749 Ga0395901_0026064
750 Ga0395901_0191548
751 Ga0395901_0249253
752 Ga0395901_0569824
753 Ga0395901_0753450
754 Ga0395901_0936742
755 Ga0400483_081542
756 Ga0400483_184605
757 Ga0451793_1921909
758 Ga0451837_0268224
759 Ga0439431_0170688
760 Ga0439458_0080811
761 Ga0439464_0118358
762 Ga0466972_0036127
763 Ga0466972_0053777
764 Ga0466960_0134414
765 Ga0466967_0178466
766 Ga0495638_0585596
767 Ga0495668_0130491
768 Ga0495668_0211483
769 Ga0495668_0735422
770 Ga0495625_0042121
771 Ga0495625_0179689
772 Ga0495681_0259345
773 Ga0495626_0174557
774 Ga0496102_0137508
775 Ga0496103_0135808
776 Ga0496107_1116785
777 Ga0496112_0355603
778 Ga0496113_0333293
779 Ga0496115_0997463
780 Ga0496117_0309465
781 Ga0496118_0058949
782 Ga0496119_0249143
783 Ga0496119_0288955
784 Ga0496120_0000909
785 Ga0496121_0328448
786 Ga0496124_0125543
787 Ga0496125_0133319
788 Ga0496126_0191261
789 Ga0496126_0244796
790 Ga0496126_0737574
791 Ga0501298_174915
792 Ga0501067_0041690
793 Ga0501073_0659733
794 Ga0501080_0406926
795 Ga0501044_0020676
796 Ga0501045_0369442
797 nmdc:mga03683_34881_c1
798 nmdc:mga03683_420927_c1
799 nmdc:mga03683_451644_c1
800 nmdc:mga03n38_439673_c1
801 nmdc:mga03n38_69981_c1
802 nmdc:mga00v17_394079_c1
803 nmdc:mga00v17_401191_c1
804 nmdc:mga00v17_695359_c1
805 nmdc:mga0yw44_1658_c1
806 nmdc:mga0yw44_184166_c1
807 nmdc:mga0yw44_429587_c1
808 nmdc:mga0yw44_739879_c1
809 nmdc:mga0k408_131891_c1
810 nmdc:mga0k408_318313_c1
811 nmdc:mga0k408_46534_c1
812 nmdc:mga0k408_895612_c1
813 nmdc:mga06z11_43091_c1
814 nmdc:mga06z11_559175_c1
815 nmdc:mga06z11_858075_c1
816 nmdc:mga04h51_237441_c1
817 nmdc:mga07m45_194016_c1
818 nmdc:mga07m45_222994_c1
819 nmdc:mga07m45_323892_c1
820 nmdc:mga08y16_263611_c1
821 nmdc:mga0sz30_149759_c1
822 nmdc:mga0sz30_15765_c2
823 nmdc:mga0sz30_398_c1
824 Ga0500610_0002918
825 Ga0500610_0407376
826 Ga0495655_0009520
827 Ga0500562_179499
828 Ga0500658_0053829
829 Ga0500658_0497330
830 Ga0500568_0000170
831 Ga0500620_000162
832 Ga0500627_0050396
833 Ga0500627_0081341
834 Ga0500611_149260
835 Ga0501084_1380089
836 2503200503
837 2509117985
838 2509139698
839 2509373607
840 2509395288
841 2510313978
842 2512932116
843 2512960120
844 2513611991
845 2514034791
846 2514416998
847 2514587871
848 2515637149
849 2588518150
850 2597812440
851 2599936077
852 2616295647
853 2643770896
854 2643776243
855 2643794690
856 2643987964
857 2644158134
858 2688597665
859 2694632424
860 2694639173
861 2719387352
862 2719666997
863 2720493417
864 2721400987
865 2723574851
866 2724039800
867 2724111652
868 2739307094
869 2756671954
870 2792752156
871 2793312991
872 2793319638
873 2805929491
874 2819243904
875 2838024216
876 2838051088
877 2838063934
878 2841738461
879 2842199758
880 2842269913
881 2842316410
882 2842398423
883 2842433842
884 2842440126
885 2842446863
886 2842453637
887 2842468209
888 2842474735
889 2844008099
890 2844013056
891 2847691520
892 2856326763
893 2856333562
894 2856337968
895 2856343640
896 2856355670
897 2856359262
898 2856366224
899 2857351387
900 2857369308
901 2869164513
902 2869175584
903 2869241610
904 2869247246
905 2869252854
906 2869258593
907 2869267532
908 2869273385
909 2869283684
910 2869287259
911 2871430558
912 2871442709
913 2871459577
914 2871465816
915 2871471303
916 2871479912
917 2871486951
918 2871491916
919 2871502653
920 2874105615
921 2874110975
922 2874120379
923 2874125220
924 2874138273
925 2874140144
926 2874149164
927 2874156050
928 2874165388
929 2874169104
930 2876367854
931 2876374116
932 2876380201
933 2876389529
934 2876394080
935 2876402924
936 2876412811
937 2876415413
938 2876426311
939 2878732248
940 2878738886
941 2878746991
942 2878753119
943 2878766545
944 2878773741
945 2878784312
946 2878790127
947 2881150942
948 2881161467
949 2881167202
950 2881852576
951 2881857753
952 2881867094
953 2882640590
954 2882913218
955 2885308700
956 2885312527
957 2885325993
958 2885328779
959 2885335160
960 2885349131
961 2885352160
962 2888338730
963 2888346209
964 2888355532
965 2889010495
966 2889017833
967 2903450633
968 2903500493
969 2903501825
970 2903519045
971 2903521628
972 2903528006
973 2903547694
974 2904660411
975 2906309804
976 2906322439
977 2906330298
978 2906361761
979 2906365262
980 2906374354
981 2906385339
982 2906391439
983 2906395484
984 2906407809
985 2906408295
986 2906427518
987 2922130653
988 2922151362
989 2922172968
990 2922185179
991 2922192584
992 2924718563
993 2924726586
994 2924740064
995 2924742388
996 2924751033
997 2924757311
998 2924769157
999 2924776248
1000 2924786227
1001 2937814898
1002 2937828869
1003 2937841743
1004 2937849985
1005 2937863853
1006 2937870005
1007 2937884295
1008 2937979603
1009 2937981320
1010 2938022154
1011 2939670135
1012 2958040196
1013 2958054540
1014 2958055536
1015 2958069127
1016 2958077919
1017 2958091606
1018 2958099362
1019 2958102233
1020 2958108474
1021 2958118071
1022 2958128007
1023 2958131759
1024 2958144395
1025 2958150916
1026 2958161873
1027 2958176749
1028 2958180819
1029 2961078657
1030 2961115736
1031 2961133601
1032 2961137981
1033 2961171081
1034 2961183914
1035 2963647090
1036 2965024915
1037 2965025855
1038 2965035396
1039 2965046792
1040 2965053278
1041 2965068495
1042 2965094666
1043 2965118746
1044 2965123308
1045 2967997649
1046 2968006648
1047 2968019038
1048 2968088108
1049 2968095156
1050 2968101846
1051 2968111469
1052 2968130712
1053 2970470789
1054 2970493397
1055 2970503675
1056 2970511213
1057 2970527706
1058 2970537687
1059 2970545140
1060 2970551548
1061 2970597891
1062 2970619597
1063 2970632746
1064 2977822051
1065 2977832409
1066 2977845642
1067 2977852620
1068 2977860968
1069 2977878007
1070 2977903684
1071 2977911388
1072 2977918596
1073 2977928526
1074 2977939094
1075 2977945214
1076 2977954695
1077 2977958700
1078 2977976701
1079 2977986677
1080 2979716489
1081 2979749386
1082 2979771286
1083 2979776101
1084 2979785355
1085 2979797140
1086 2979808311
1087 2987638571
1088 2987647880
1089 2987656544
1090 2987666405
1091 2987673008
1092 2987680067
1093 2996340397
1094 2996356674
1095 2996388557
1096 3000140033
1097 3004168099
1098 3004198692
1099 3004205186
1100 3004215469
1101 3004225688
1102 3004233034
1103 3004240399
1104 3004252115
1105 3004272728
1106 3004282977
1107 3004294713
1108 3004335211
1109 637075215
1110 649872207
1111 8002289148
1112 8004303641
1113 8004318352
1114 8004365480
1115 8004374691
1116 8004389096
1117 8004398744
1118 8004448844
1119 8004635298
1120 8004640999
1121 8004703749
1122 8004708975
1123 8004716159
1124 8004733122
1125 8005282099
1126 8006986594
1127 8018133532
1128 8018178381
1129 8055619935
1130 8057877085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

121

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9662 3 124
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9584 3 124
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9518 1 124
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9442 1 124
2i7r-assembly1.cif.gz_B conserved domain protein 0.875 4 123
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.966 70 120 3.30.720.110
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9476 3 55 3.30.720.120
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9301 3 55 3.30.720.120
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9206 68 122 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.917 68 124 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A529NS65-F1-model_v4 Glyoxalase 0.9933 1 125
AF-A0A853GZ86-F1-model_v4 VOC family protein 0.9858 1 135 GO:0004493
GO:0046491
GO:0046872
AF-A0A527Y325-F1-model_v4 Glyoxalase 0.9858 7 74
AF-A0A530BQP1-F1-model_v4 Glyoxalase 0.9793 1 84
AF-A0A529SQR2-F1-model_v4 Glyoxalase 0.978 1 96

Map