F464291

General Info

Members Datasets Scaffolds Average Seq Length
565 373 1130 400

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0000574|Ga0395901_0000574_35788_37212
Length 474
Sequence LAGRLFGDFFGCRNLVYFGLEIAASKLCNYYVATKKGLACSPKSVPKQLNRQERNKSMDQPQQTELNQGIKPRSPEAHVTVPHGSAGEVFFAFLKLGVTSFGGPIAHLAYFRTEFVERRRWLDDKSFSDLVALCQFLPGPASSQVGMALGLGRAGWLGALAAWLAFTLPSAIVLILFAFGVAHWAALSQSGAVHGLKVVAVAVVAQAVWGMAKSLCPDRPRAGIAIGAALLVLALPSAAGQILAIAAGGVIGRWGLELKHLPAARHRDYGISKTTGAIALLLFVALLGALPAIAAASHSTWLSAIAVFYKAGALVFGGGHVVLPLLQSGVVPNGWVGNDAFLAGYGAAQAVPGPLFTFAAYLGAVMPSPLGGWTGGLALLVAIFAPAFLLVAGALPFWESLRQRDSVQRAMAGINAAVVGVLAAALYDPVWTSAIHSRADFGLALAAFGLLVHGRLSPFIVVVLAALAGWAMAL

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
72 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
148 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
149 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
175 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
176 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
177 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
178 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
289 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
300 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
301 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
302 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
303 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
304 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
305 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
306 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
307 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
308 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
309 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
310 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
311 2643221594 Achromobacter sp. Root170 Isolate Unclassified
312 2643221621 Achromobacter sp. Root83 Isolate Unclassified
313 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
314 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
315 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
316 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
317 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
318 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
319 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
320 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
321 2808606394 Promicromonospora sp. C35 Isolate Unclassified
322 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
323 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
324 2818991452 Burkholderia cepacia 561 Isolate Unclassified
325 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
326 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
327 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
328 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
329 2855730933 Achromobacter sp. HZ28 Isolate Nodule
330 2855767633 Achromobacter sp. HZ34 Isolate Nodule
331 2858950400 Achromobacter sp. K91 Isolate Unclassified
332 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
333 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
334 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
335 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
336 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
337 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
338 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
339 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
340 2904564687 Burkholderia sp. 571 Isolate Unclassified
341 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
342 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
343 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
344 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
345 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
346 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
347 2919476304 Duganella sp. 3397 Isolate Unclassified
348 2919675420 Luteimonas terrae 4099 Isolate Unclassified
349 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
350 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
351 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
352 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
353 2928163908 Burkholderia sp. 567 Isolate Unclassified
354 2928536128 Burkholderia sola 565 Isolate Unclassified
355 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
356 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
357 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
358 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
359 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
360 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
361 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
362 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
363 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
364 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
365 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
366 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
367 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
368 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
369 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
370 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
371 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
372 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
373 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.73
Metatranscriptomes 0
Isolates 13.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 10.27
Nodule 2.48
Rhizoplane 3.72
Rhizosphere 70.62
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0000574 3300038443 Bacteria 42766
2 SwRhRL2b_contig_2162838 2162886007 Bacteria 2840
3 SwRhRL2b_contig_2682132 2162886007 Bacteria 1432
4 JGI25151J46595_10000131 3300003187 Bacteria 100435
5 JGI25151J46595_10002410 3300003187 Bacteria 11285
6 JGI25151J46595_10040096 3300003187 Bacteria 1720
7 JGI25165J46597_1000025 3300003214 Bacteria 333075
8 rootL2_10162752 3300003322 Bacteria 1620
9 Ga0055538_1000013 3300003751 Bacteria 348596
10 Ga0055539_1000018 3300003752 Bacteria 348596
11 Ga0055533_1000022 3300003756 Bacteria 348596
12 Ga0055525_1000024 3300003759 Bacteria 348596
13 Ga0055526_1001612 3300003771 Bacteria 15841
14 Ga0055526_1004498 3300003771 Bacteria 8351
15 Ga0055537_1001551 3300003773 Bacteria 8774
16 Ga0055524_1005163 3300003775 Bacteria 5888
17 Ga0055536_1000090 3300003781 Bacteria 77889
18 Ga0055534_1000757 3300003784 Bacteria 15353
19 Ga0055534_1002351 3300003784 Bacteria 6602
20 Ga0055541_1000013 3300003841 Bacteria 348596
21 Ga0065165_1000001 3300005262 Bacteria 494087
22 Ga0065704_10079600 3300005289 Bacteria 4117
23 Ga0065704_10087137 3300005289 Bacteria 3052
24 Ga0070658_10015681 3300005327 Bacteria 6060
25 Ga0070658_10062054 3300005327 Bacteria 3046
26 Ga0070683_100045202 3300005329 Bacteria 4064
27 Ga0068869_100005371 3300005334 Bacteria 8052
28 Ga0068869_100025276 3300005334 Bacteria 4122
29 Ga0070666_10003380 3300005335 Bacteria 9673
30 Ga0068868_100010295 3300005338 Bacteria 6764
31 Ga0070660_100000815 3300005339 Bacteria 20688
32 Ga0070660_100023074 3300005339 Bacteria 4607
33 Ga0070660_100037868 3300005339 Bacteria 3657
34 Ga0070660_100055494 3300005339 Bacteria 3061
35 Ga0070660_100086070 3300005339 Bacteria 2472
36 Ga0070689_100174084 3300005340 Bacteria 1745
37 Ga0070661_100055803 3300005344 Bacteria 2892
38 Ga0070669_100015207 3300005353 Bacteria 5481
39 Ga0070675_100015653 3300005354 Bacteria 6002
40 Ga0070671_100237620 3300005355 Bacteria 1547
41 Ga0070659_100000637 3300005366 Bacteria 25696
42 Ga0070659_100057220 3300005366 Bacteria 3074
43 Ga0070667_100097347 3300005367 Bacteria 2538
44 Ga0070701_10008112 3300005438 Bacteria 4523
45 Ga0070708_100014220 3300005445 Bacteria 6540
46 Ga0070708_100093067 3300005445 Bacteria 2747
47 Ga0070663_100000495 3300005455 Bacteria 20806
48 Ga0070663_100030473 3300005455 Bacteria 3697
49 Ga0070662_100000752 3300005457 Bacteria 19873
50 Ga0070681_10178706 3300005458 Bacteria 2044
51 Ga0070681_10230619 3300005458 Bacteria 1766
52 Ga0070706_100000388 3300005467 Bacteria 52771
53 Ga0070706_100019315 3300005467 Bacteria 6285
54 Ga0070707_100041939 3300005468 Bacteria 4381
55 Ga0070698_100105052 3300005471 Bacteria 2794
56 Ga0070698_100187403 3300005471 Bacteria 2007
57 Ga0070699_100009784 3300005518 Bacteria 8294
58 Ga0070699_100073777 3300005518 Bacteria 2969
59 Ga0070679_100175752 3300005530 Bacteria 2114
60 Ga0070684_100041117 3300005535 Bacteria 3984
61 Ga0070697_100019344 3300005536 Bacteria 5378
62 Ga0070697_100196088 3300005536 Bacteria 1715
63 Ga0068853_100003918 3300005539 Bacteria 11422
64 Ga0068853_100028407 3300005539 Bacteria 4704
65 Ga0070696_100058155 3300005546 Bacteria 2700
66 Ga0070696_100159510 3300005546 Bacteria 1661
67 Ga0070693_100052321 3300005547 Bacteria 2341
68 Ga0070704_100028751 3300005549 Bacteria 3702
69 Ga0068855_100025742 3300005563 Bacteria 7035
70 Ga0068855_100110310 3300005563 Bacteria 3159
71 Ga0068855_100171029 3300005563 Bacteria 2461
72 Ga0070664_100010718 3300005564 Bacteria 7433
73 Ga0068857_100007527 3300005577 Bacteria 9369
74 Ga0068857_100010070 3300005577 Bacteria 8214
75 Ga0068854_100030944 3300005578 Bacteria 3716
76 Ga0068854_100035802 3300005578 Bacteria 3476
77 Ga0068854_100167848 3300005578 Bacteria 1705
78 Ga0068852_100022802 3300005616 Bacteria 5027
79 Ga0068852_100045127 3300005616 Bacteria 3747
80 Ga0068852_100090448 3300005616 Bacteria 2737
81 Ga0068859_100006569 3300005617 Bacteria 11802
82 Ga0068864_100008900 3300005618 Bacteria 8275
83 Ga0068861_100001850 3300005719 Bacteria 13615
84 Ga0068851_10020638 3300005834 Bacteria 3192
85 Ga0068851_10029602 3300005834 Bacteria 2712
86 Ga0068863_100032733 3300005841 Bacteria 4953
87 Ga0068858_100034057 3300005842 Bacteria 4725
88 Ga0068860_100156728 3300005843 Bacteria 2195
89 Ga0068862_100043338 3300005844 Bacteria 3836
90 Ga0068862_100080957 3300005844 Bacteria 2817
91 Ga0070717_10011901 3300006028 Bacteria 6621
92 Ga0070717_10173763 3300006028 Bacteria 1875
93 Ga0075364_10000241 3300006051 Bacteria 26213
94 Ga0075364_10019578 3300006051 Bacteria 4248
95 Ga0075364_10053825 3300006051 Bacteria 2631
96 Ga0070716_100083546 3300006173 Bacteria 1913
97 Ga0070712_100009916 3300006175 Bacteria 6005
98 Ga0097621_100007843 3300006237 Bacteria 7656
99 Ga0075370_10069306 3300006353 Bacteria 2015
100 Ga0068871_100027451 3300006358 Bacteria 4453
101 Ga0075428_100097502 3300006844 Bacteria 3205
102 Ga0075428_100098601 3300006844 Bacteria 3186
103 Ga0075431_100000746 3300006847 Bacteria 28089
104 Ga0075429_100089055 3300006880 Bacteria 2690
105 Ga0097620_100006569 3300006931 Bacteria 11802
106 Ga0099824_1030680 3300006942 Bacteria 2128
107 Ga0099822_1003706 3300006943 Bacteria 19688
108 Ga0079104_1001730 3300006946 Bacteria 13875
109 Ga0079104_1007105 3300006946 Bacteria 4117
110 Ga0099826_10000039 3300006948 Bacteria 99286
111 Ga0105250_10002148 3300009092 Bacteria 10119
112 Ga0111539_10020521 3300009094 Bacteria 8137
113 Ga0114129_10001070 3300009147 Bacteria 35994
114 Ga0114129_10100051 3300009147 Bacteria 4012
115 Ga0114129_10144150 3300009147 Bacteria 3263
116 Ga0105248_10004400 3300009177 Bacteria 15593
117 Ga0105248_10005940 3300009177 Bacteria 13414
118 Ga0105248_10012680 3300009177 Bacteria 9300
119 Ga0105237_10016183 3300009545 Bacteria 7756
120 Ga0105237_10036428 3300009545 Bacteria 4979
121 Ga0105238_10007494 3300009551 Bacteria 10932
122 Ga0105238_10011653 3300009551 Bacteria 8859
123 Ga0105238_10012510 3300009551 Bacteria 8561
124 Ga0105238_10052632 3300009551 Bacteria 4093
125 Ga0105238_10074902 3300009551 Bacteria 3377
126 Ga0099796_10000276 3300010159 Bacteria 8117
127 Ga0099796_10015184 3300010159 Bacteria 2245
128 Ga0105239_10013790 3300010375 Bacteria 8970
129 Ga0105239_10043880 3300010375 Bacteria 4903
130 Ga0105239_10202282 3300010375 Bacteria 2225
131 Ga0157347_1000034 3300012502 Bacteria 5131
132 Ga0157371_10001514 3300013102 Bacteria 24008
133 Ga0157371_10051085 3300013102 Bacteria 2938
134 Ga0157369_10008661 3300013105 Bacteria 11666
135 Ga0157374_10009759 3300013296 Bacteria 8242
136 Ga0157378_10020686 3300013297 Bacteria 5788
137 Ga0157372_10004459 3300013307 Bacteria 14933
138 Ga0157372_10153648 3300013307 Bacteria 2658
139 Ga0157372_10154140 3300013307 Bacteria 2653
140 Ga0157375_10047478 3300013308 Bacteria 4194
141 Ga0163163_10049178 3300014325 Bacteria 4148
142 Ga0157379_10004214 3300014968 Bacteria 12278
143 Ga0157376_10006746 3300014969 Bacteria 8127
144 Ga0182006_1000008 3300015261 Bacteria 449652
145 Ga0182006_1002448 3300015261 Bacteria 10147
146 Ga0182006_1038981 3300015261 Bacteria 1877
147 Ga0182005_1000008 3300015265 Bacteria 471394
148 Ga0183362_10001 3300015683 Bacteria 2046624
149 Ga0163161_10032047 3300017792 Bacteria 3750
150 Ga0213872_10005211 3300021361 Bacteria 6725
151 Ga0213875_10002319 3300021388 Bacteria 11514
152 Ga0209784_100005 3300025224 Bacteria 1040422
153 Ga0209566_100005 3300025225 Bacteria 1040422
154 Ga0209674_100009 3300025226 Bacteria 1040422
155 Ga0209563_100012 3300025230 Bacteria 1040422
156 Ga0209677_100006 3300025253 Bacteria 1040422
157 Ga0209233_1000053 3300025261 Bacteria 444909
158 Ga0209565_1000927 3300025263 Bacteria 15517
159 Ga0209565_1003320 3300025263 Bacteria 5268
160 Ga0209673_1000443 3300025273 Bacteria 71250
161 Ga0209673_1010110 3300025273 Bacteria 4008
162 Ga0209675_1000291 3300025291 Bacteria 46848
163 Ga0209675_1001223 3300025291 Bacteria 15517
164 Ga0209675_1002115 3300025291 Bacteria 10517
165 Ga0209676_1000059 3300025292 Bacteria 344882
166 Ga0209025_1000028 3300025294 Bacteria 490678
167 Ga0209025_1000879 3300025294 Bacteria 47123
168 Ga0209025_1002965 3300025294 Bacteria 16857
169 Ga0209025_1010155 3300025294 Bacteria 6423
170 Ga0209564_1000623 3300025295 Bacteria 53919
171 Ga0209564_1002245 3300025295 Bacteria 15893
172 Ga0209564_1002915 3300025295 Bacteria 12446
173 Ga0209564_1004985 3300025295 Bacteria 7816
174 Ga0209256_1000661 3300025299 Bacteria 46620
175 Ga0209256_1003207 3300025299 Bacteria 11817
176 Ga0207656_10019146 3300025321 Bacteria 2705
177 Ga0207696_1003576 3300025711 Bacteria 7019
178 Ga0207688_10005778 3300025901 Bacteria 6735
179 Ga0207680_10007805 3300025903 Bacteria 5229
180 Ga0207684_10010691 3300025910 Bacteria 8061
181 Ga0207684_10174831 3300025910 Bacteria 1851
182 Ga0207707_10126088 3300025912 Bacteria 2239
183 Ga0207695_10000573 3300025913 Bacteria 75332
184 Ga0207671_10031935 3300025914 Bacteria 3921
185 Ga0207693_10006671 3300025915 Bacteria 9536
186 Ga0207693_10035719 3300025915 Bacteria 3918
187 Ga0207657_10000137 3300025919 Bacteria 74712
188 Ga0207657_10003404 3300025919 Bacteria 16996
189 Ga0207657_10023220 3300025919 Bacteria 5781
190 Ga0207657_10026864 3300025919 Bacteria 5280
191 Ga0207657_10037213 3300025919 Bacteria 4348
192 Ga0207652_10101333 3300025921 Bacteria 2543
193 Ga0207652_10137820 3300025921 Bacteria 2180
194 Ga0207646_10016047 3300025922 Bacteria 7039
195 Ga0207681_10055000 3300025923 Bacteria 2709
196 Ga0207694_10119344 3300025924 Bacteria 2104
197 Ga0207690_10000013 3300025932 Bacteria 266156
198 Ga0207706_10001109 3300025933 Bacteria 27405
199 Ga0207711_10005616 3300025941 Bacteria 10604
200 Ga0207689_10000605 3300025942 Bacteria 34379
201 Ga0207689_10002130 3300025942 Bacteria 18622
202 Ga0207679_10149315 3300025945 Bacteria 1900
203 Ga0207667_10023248 3300025949 Bacteria 6825
204 Ga0207667_10027384 3300025949 Bacteria 6205
205 Ga0207667_10091394 3300025949 Bacteria 3144
206 Ga0207667_10179673 3300025949 Bacteria 2173
207 Ga0207651_10000815 3300025960 Bacteria 13452
208 Ga0207640_10088754 3300025981 Bacteria 2135
209 Ga0207658_10103211 3300025986 Bacteria 2238
210 Ga0207677_10002600 3300026023 Bacteria 9491
211 Ga0207639_10071657 3300026041 Bacteria 2711
212 Ga0207639_10094938 3300026041 Bacteria 2395
213 Ga0207678_10000119 3300026067 Bacteria 65478
214 Ga0207678_10000497 3300026067 Bacteria 35757
215 Ga0207702_10173163 3300026078 Bacteria 1981
216 Ga0207648_10066129 3300026089 Bacteria 3153
217 Ga0207676_10011899 3300026095 Bacteria 6225
218 Ga0207674_10004838 3300026116 Bacteria 16125
219 Ga0207674_10015373 3300026116 Bacteria 8409
220 Ga0207674_10028948 3300026116 Bacteria 5839
221 Ga0207674_10029689 3300026116 Bacteria 5754
222 Ga0207675_100000926 3300026118 Bacteria 29286
223 Ga0207698_10015729 3300026142 Bacteria 5078
224 Ga0207698_10059749 3300026142 Bacteria 2961
225 Ga0209281_1001457 3300027111 Bacteria 13898
226 Ga0209589_1000015 3300027357 Bacteria 225913
227 Ga0209489_100015 3300027361 Bacteria 225913
228 Ga0209700_100025 3300027363 Bacteria 225913
229 Ga0209282_1000058 3300027666 Bacteria 99152
230 Ga0316181_1070820 3300030744 Bacteria 2748
231 Ga0265330_10011296 3300031235 Bacteria 4194
232 Ga0265320_10002374 3300031240 Bacteria 13161
233 Ga0265325_10004104 3300031241 Bacteria 9278
234 Ga0265325_10013704 3300031241 Bacteria 4604
235 Ga0265339_10000425 3300031249 Bacteria 33388
236 Ga0265316_10136146 3300031344 Bacteria 1848
237 Ga0307408_100028832 3300031548 Bacteria 3839
238 Ga0265313_10000107 3300031595 Bacteria 83816
239 Ga0265314_10025974 3300031711 Bacteria 4408
240 Ga0307516_10001128 3300031730 Bacteria 37196
241 Ga0307406_10022582 3300031901 Bacteria 3734
242 Ga0307406_10053404 3300031901 Bacteria 2574
243 Ga0307412_10212565 3300031911 Bacteria 1477
244 Ga0316215_1001466 3300033544 Bacteria 2272
245 Ga0373931_0006912 3300035691 Bacteria 5338
246 Ga0373925_0077596 3300037068 Bacteria 2522
247 Ga0395899_0008100 3300037312 Bacteria 8092
248 Ga0395900_0006777 3300037418 Bacteria 11891
249 Ga0395900_0079503 3300037418 Bacteria 3370
250 Ga0395898_0043891 3300037466 Bacteria 4404
251 Ga0395898_0097958 3300037466 Bacteria 2816
252 Ga0395905_0000353 3300037471 Bacteria 65228
253 Ga0395905_0013434 3300037471 Bacteria 7846
254 Ga0395905_0068361 3300037471 Bacteria 3327
255 Ga0436364_0616684 3300037853 Bacteria 34041
256 Ga0395901_0205259 3300038443 Bacteria 2065
257 Ga0436361_0439571 3300039447 Bacteria 4790
258 Ga0436361_1211686 3300039447 Bacteria 8622
259 Ga0439447_000627 3300041407 Bacteria 13144
260 Ga0439447_005618 3300041407 Bacteria 4151
261 Ga0451793_1587026 3300041452 Bacteria 1598
262 Ga0451797_1457614 3300041453 Bacteria 3551
263 Ga0439432_023781 3300042006 Bacteria 2016
264 Ga0439432_025387 3300042006 Bacteria 1944
265 Ga0439452_005096 3300042010 Bacteria 4284
266 Ga0439456_004556 3300042013 Bacteria 2802
267 Ga0439463_011493 3300042016 Bacteria 2174
268 Ga0450890_002362 3300042127 Bacteria 2603
269 Ga0450907_001201 3300042146 Bacteria 5860
270 Ga0439460_0011782 3300042461 Bacteria 2259
271 Ga0451577_0021805 3300042876 Bacteria 5858
272 Ga0451577_0065911 3300042876 Bacteria 3229
273 Ga0466961_0011072 3300044693 Bacteria 5765
274 Ga0466971_0023990 3300044719 Bacteria 2719
275 Ga0466957_0009939 3300044842 Bacteria 5443
276 Ga0466957_0095449 3300044842 Bacteria 1867
277 Ga0466957_0149432 3300044842 Bacteria 1510
278 Ga0466959_0102528 3300045049 Bacteria 2048
279 Ga0451576_0096489 3300045051 Bacteria 3075
280 Ga0466958_0000187 3300045836 Bacteria 22479
281 Ga0466958_0056301 3300045836 Bacteria 2388
282 Ga0466967_0021844 3300045976 Bacteria 5208
283 Ga0495638_0000145 3300046460 Bacteria 112275
284 Ga0495638_0023560 3300046460 Bacteria 4025
285 Ga0495605_0006921 3300046474 Bacteria 6478
286 Ga0495585_0008730 3300046492 Bacteria 6128
287 Ga0495596_0000738 3300046500 Bacteria 20164
288 Ga0495607_0008050 3300046501 Bacteria 7238
289 Ga0495607_0023097 3300046501 Bacteria 3896
290 Ga0495583_0017814 3300046506 Bacteria 3759
291 Ga0495583_0029329 3300046506 Bacteria 2693
292 Ga0495606_0004680 3300046507 Bacteria 13523
293 Ga0495608_0168422 3300046511 Bacteria 1390
294 Ga0495610_0002945 3300046512 Bacteria 13742
295 Ga0495618_0098689 3300046514 Bacteria 1869
296 Ga0495620_0027151 3300046515 Bacteria 2683
297 Ga0495631_0001207 3300046518 Bacteria 15935
298 Ga0495632_0006023 3300046519 Bacteria 7881
299 Ga0495637_0027844 3300046520 Bacteria 2525
300 Ga0495643_0034274 3300046522 Bacteria 2802
301 Ga0495648_0002842 3300046524 Bacteria 15591
302 Ga0495648_0090617 3300046524 Bacteria 1713
303 Ga0495666_0012358 3300046526 Bacteria 4256
304 Ga0495642_0006479 3300046528 Bacteria 4492
305 Ga0495642_0017735 3300046528 Bacteria 2781
306 Ga0495609_0000943 3300046538 Bacteria 21055
307 Ga0495609_0019502 3300046538 Bacteria 3137
308 Ga0495597_0000167 3300046542 Bacteria 58157
309 Ga0495597_0018990 3300046542 Bacteria 3221
310 Ga0495645_0036425 3300046543 Bacteria 3586
311 Ga0495633_0001624 3300046558 Bacteria 16970
312 Ga0495656_0001352 3300046615 Bacteria 8004
313 Ga0495668_0008800 3300046616 Bacteria 6257
314 Ga0495611_0002205 3300046648 Bacteria 9054
315 Ga0495625_0000467 3300046660 Bacteria 60730
316 Ga0495659_0002637 3300046664 Bacteria 5786
317 Ga0495661_0003823 3300046665 Bacteria 11016
318 Ga0495661_0010519 3300046665 Bacteria 6310
319 Ga0495669_0000012 3300046684 Bacteria 157373
320 Ga0495671_0000066 3300046692 Bacteria 105167
321 Ga0495671_0001086 3300046692 Bacteria 18821
322 Ga0495600_0151529 3300046809 Bacteria 1501
323 Ga0495660_0003780 3300046810 Bacteria 9283
324 Ga0495604_0005176 3300047317 Bacteria 10329
325 Ga0495672_0002271 3300047320 Bacteria 17861
326 Ga0495672_0012359 3300047320 Bacteria 5960
327 Ga0495685_025804 3300047447 Bacteria 2022
328 Ga0495593_0010951 3300047673 Bacteria 5223
329 Ga0496101_0084325 3300048904 Bacteria 2353
330 Ga0496102_0017089 3300048905 Bacteria 6351
331 Ga0496102_0178839 3300048905 Bacteria 1998
332 Ga0496103_0126082 3300048906 Bacteria 1633
333 Ga0496104_0055042 3300048907 Bacteria 3761
334 Ga0496104_0241225 3300048907 Bacteria 1720
335 Ga0496107_0120045 3300048910 Bacteria 1936
336 Ga0496110_0000148 3300048913 Bacteria 41684
337 Ga0496110_0089697 3300048913 Bacteria 2748
338 Ga0496111_0006204 3300048914 Bacteria 7744
339 Ga0496111_0054707 3300048914 Unclassified 2886
340 Ga0496113_0037116 3300048916 Bacteria 3574
341 Ga0496114_0010521 3300048917 Bacteria 7362
342 Ga0496115_0027875 3300048918 Bacteria 4422
343 Ga0496116_0014321 3300048919 Bacteria 6339
344 Ga0496116_0047596 3300048919 Bacteria 2886
345 Ga0496116_0079465 3300048919 Unclassified 2041
346 Ga0496117_0000156 3300048920 Bacteria 145285
347 Ga0496118_0000005 3300048921 Bacteria 697350
348 Ga0496118_0148913 3300048921 Bacteria 1468
349 Ga0496119_0000133 3300048922 Bacteria 104400
350 Ga0496119_0008959 3300048922 Bacteria 8688
351 Ga0496119_0026819 3300048922 Bacteria 3982
352 Ga0496120_0013066 3300048923 Bacteria 5614
353 Ga0496120_0067602 3300048923 Bacteria 1973
354 Ga0496121_0005527 3300048924 Bacteria 16152
355 Ga0496121_0008550 3300048924 Bacteria 12005
356 Ga0496121_0022034 3300048924 Bacteria 6204
357 Ga0496122_0008855 3300048925 Bacteria 10738
358 Ga0496122_0015579 3300048925 Bacteria 7256
359 Ga0496123_0002314 3300048926 Bacteria 23928
360 Ga0496123_0015495 3300048926 Bacteria 6249
361 Ga0496124_0020596 3300048927 Bacteria 6088
362 Ga0496125_0000710 3300048928 Bacteria 55020
363 Ga0496125_0005203 3300048928 Bacteria 14597
364 Ga0496125_0058294 3300048928 Bacteria 3120
365 Ga0496126_0065314 3300048929 Bacteria 3257
366 Ga0496126_0116288 3300048929 Bacteria 2325
367 Ga0496126_0154946 3300048929 Bacteria 1961
368 Ga0496126_0202149 3300048929 Bacteria 1677
369 Ga0495678_001890 3300049459 Bacteria 15210
370 Ga0495678_015557 3300049459 Bacteria 3498
371 Ga0495682_0011136 3300049460 Bacteria 3465
372 Ga0501032_0028641 3300049569 Bacteria 3827
373 Ga0501033_0020588 3300049570 Bacteria 4985
374 Ga0501034_0001709 3300049571 Bacteria 28248
375 Ga0501034_0025558 3300049571 Bacteria 6013
376 Ga0501034_0062645 3300049571 Unclassified 3735
377 Ga0501034_0117406 3300049571 Bacteria 2648
378 Ga0501036_0015891 3300049572 Bacteria 6287
379 Ga0501036_0026779 3300049572 Bacteria 4871
380 Ga0501036_0153723 3300049572 Bacteria 1941
381 Ga0501037_0194924 3300049573 Bacteria 1433
382 Ga0501038_0000014 3300049574 Bacteria 164836
383 Ga0501038_0024830 3300049574 Bacteria 5343
384 Ga0501039_0004707 3300049575 Bacteria 10330
385 Ga0501040_0006648 3300049576 Bacteria 7503
386 Ga0501040_0091002 3300049576 Bacteria 2121
387 Ga0501040_0185316 3300049576 Bacteria 1476
388 Ga0501041_0000023 3300049577 Bacteria 51046
389 Ga0501041_0001081 3300049577 Bacteria 14919
390 Ga0501041_0018662 3300049577 Bacteria 4131
391 Ga0501041_0100474 3300049577 Bacteria 1790
392 Ga0501042_0047504 3300049578 Bacteria 3061
393 Ga0501042_0088194 3300049578 Bacteria 2226
394 Ga0501043_0000121 3300049579 Bacteria 72050
395 Ga0501043_0045567 3300049579 Bacteria 3449
396 Ga0501043_0200714 3300049579 Bacteria 1548
397 Ga0501046_0000157 3300049580 Bacteria 70302
398 Ga0501046_0017088 3300049580 Bacteria 6063
399 Ga0501046_0125077 3300049580 Bacteria 1954
400 Ga0501046_0178819 3300049580 Bacteria 1587
401 Ga0501047_0000198 3300049581 Bacteria 72705
402 Ga0501047_0050766 3300049581 Bacteria 4006
403 Ga0501047_0061826 3300049581 Bacteria 3613
404 Ga0501048_0000020 3300049582 Bacteria 70567
405 Ga0501048_0001216 3300049582 Bacteria 19497
406 Ga0501048_0011807 3300049582 Bacteria 6513
407 Ga0501048_0231257 3300049582 Bacteria 1312
408 Ga0501068_0075082 3300049584 Bacteria 2067
409 Ga0501070_0014599 3300049586 Bacteria 6610
410 Ga0501071_0000496 3300049587 Bacteria 19961
411 Ga0501071_0061432 3300049587 Bacteria 2721
412 Ga0501072_0001424 3300049588 Bacteria 17944
413 Ga0501072_0015746 3300049588 Bacteria 5796
414 Ga0501072_0048824 3300049588 Bacteria 3332
415 Ga0501074_0027398 3300049590 Bacteria 4132
416 Ga0501074_0032693 3300049590 Bacteria 3768
417 Ga0501074_0058718 3300049590 Bacteria 2771
418 Ga0501074_0071397 3300049590 Bacteria 2496
419 Ga0501074_0086448 3300049590 Bacteria 2246
420 Ga0501075_0001541 3300049591 Bacteria 15041
421 Ga0501075_0094203 3300049591 Bacteria 2273
422 Ga0501075_0204635 3300049591 Bacteria 1505
423 Ga0501076_0027248 3300049592 Bacteria 4432
424 Ga0501076_0049514 3300049592 Bacteria 3323
425 Ga0501076_0088942 3300049592 Bacteria 2482
426 Ga0501076_0179224 3300049592 Bacteria 1727
427 Ga0501077_0000714 3300049593 Bacteria 20042
428 Ga0501077_0002269 3300049593 Bacteria 11589
429 Ga0501077_0002332 3300049593 Bacteria 11433
430 Ga0501077_0006844 3300049593 Bacteria 7014
431 Ga0501079_0000769 3300049741 Bacteria 21929
432 Ga0501079_0006340 3300049741 Bacteria 8876
433 Ga0501079_0015449 3300049741 Bacteria 5826
434 Ga0501079_0060690 3300049741 Bacteria 2917
435 Ga0501079_0078499 3300049741 Bacteria 2553
436 Ga0501080_0004129 3300049742 Bacteria 12869
437 Ga0501080_0005187 3300049742 Bacteria 11609
438 Ga0501080_0005645 3300049742 Bacteria 11182
439 Ga0501080_0060269 3300049742 Bacteria 3532
440 Ga0501080_0140633 3300049742 Bacteria 2232
441 Ga0501081_0002294 3300049743 Bacteria 12048
442 Ga0501081_0003181 3300049743 Bacteria 10439
443 Ga0501081_0008301 3300049743 Bacteria 6739
444 Ga0501083_0007955 3300049744 Bacteria 7507
445 Ga0501083_0019946 3300049744 Bacteria 4666
446 Ga0501083_0046396 3300049744 Bacteria 2938
447 Ga0501083_0052403 3300049744 Bacteria 2741
448 Ga0501035_0037565 3300049822 Bacteria 4385
449 Ga0501035_0246860 3300049822 Bacteria 1517
450 Ga0501044_0050216 3300049823 Bacteria 4305
451 Ga0501044_0181990 3300049823 Bacteria 2068
452 Ga0501045_0000975 3300049824 Bacteria 18730
453 Ga0501045_0013664 3300049824 Bacteria 5739
454 Ga0501045_0081109 3300049824 Bacteria 2392
455 Ga0501045_0163537 3300049824 Bacteria 1657
456 nmdc:mga00v17_141_c1 3300050491 Bacteria 41598
457 nmdc:mga00v17_9143_c2 3300050491 Bacteria 4606
458 nmdc:mga0k408_41613_c1 3300050493 Bacteria 2645
459 nmdc:mga07m45_13976_c1 3300050496 Bacteria 4268
460 nmdc:mga05p37_40430_c1 3300050507 Bacteria 5727
461 nmdc:mga09592_84037_c1 3300050508 Bacteria 2714
462 nmdc:mga0qj67_7804_c1 3300050509 Bacteria 7910
463 nmdc:mga06r32_218654_c1 3300050510 Bacteria 1893
464 nmdc:mga08y16_123188_c1 3300050511 Bacteria 2698
465 Ga0495601_0135543 3300053077 Bacteria 1605
466 Ga0495595_0065470 3300053084 Bacteria 1709
467 Ga0495619_0003906 3300053085 Bacteria 9579
468 Ga0500643_012946 3300053087 Bacteria 2969
469 Ga0500556_0000336 3300053104 Bacteria 35065
470 Ga0500557_000622 3300053105 Bacteria 4867
471 Ga0500562_020100 3300053108 Bacteria 1733
472 Ga0500595_017608 3300053119 Bacteria 2633
473 Ga0500568_0001808 3300053139 Bacteria 13178
474 Ga0500568_0066652 3300053139 Bacteria 1384
475 Ga0500616_0000917 3300053153 Bacteria 32210
476 Ga0500596_001643 3300053735 Bacteria 4519
477 Ga0501084_0000739 3300054114 Bacteria 24952
478 Ga0501084_0002070 3300054114 Bacteria 16013
479 Ga0501084_0009931 3300054114 Bacteria 7869
480 Ga0501084_0049269 3300054114 Bacteria 3526
481 Ga0501082_0000869 3300060353 Bacteria 26666
482 Ga0501082_0031019 3300060353 Bacteria 4607
483 Ga0501082_0049319 3300060353 Bacteria 3630
484 Ga0501082_0112868 3300060353 Bacteria 2353
485 Ga0466962_0009066 3300061719 Bacteria 4763
486 Ga0466962_0027249 3300061719 Bacteria 2743
487 Ga0530510_0000323 3300061734 Bacteria 30875
488 Ga0530510_0018161 3300061734 Bacteria 4986
489 Ga0530510_0025237 3300061734 Bacteria 4249
490 Ga0530510_0044764 3300061734 Bacteria 3199
491 2510281030 2510065053 Bacteria 5005518
492 2510294839 2510065055 Bacteria 5037935
493 2510309178 2510065058 Bacteria 5005894
494 2521557167 2521172590 Bacteria 5047645
495 2523105525 2522572158 Bacteria 6514390
496 2553007691 2551306416 Bacteria 6152985
497 2554814891 2554235132 Bacteria 6772433
498 2574430001 2574179768 Bacteria 4907129
499 2599740777 2599185239 Bacteria 8686614
500 2599747128 2599185240 Bacteria 7968121
501 2599902387 2599185292 Bacteria 6290804
502 2600209664 2599185355 Bacteria 7968906
503 2643979068 2643221594 Bacteria 5811388
504 2644121294 2643221621 Bacteria 6212786
505 2676744886 2675903129 Bacteria 7964495
506 2723876514 2721755763 Bacteria 4464185
507 2729148161 2728369097 Bacteria 4333476
508 2739605186 2739367654 Bacteria 6049412
509 2739612542 2739367655 Bacteria 4051151
510 2774131970 2773857672 Bacteria 4993178
511 2808929640 2808606377 Bacteria 6646337
512 2808951781 2808606381 Bacteria 6646461
513 2809028414 2808606394 Bacteria 6248540
514 2809036171 2808606395 Bacteria 6020352
515 2819618676 2818991449 Bacteria 5518009
516 2819633222 2818991452 Bacteria 8442785
517 2834644616 2834641062 Bacteria 5559922
518 2839099433 2839094727 Bacteria 5534556
519 2846040110 2846037992 Bacteria 4526407
520 2852650756 2852649853 Bacteria 4036942
521 2855733387 2855730933 Bacteria 7047938
522 2855772396 2855767633 Bacteria 7049357
523 2858954849 2858950400 Bacteria 6783797
524 2870070409 2870068957 Bacteria 8925310
525 2881415395 2881412998 Bacteria 6492157
526 2891637219 2891633521 Bacteria 4602265
527 2894026315 2894023352 Bacteria 5167372
528 2897562650 2897561785 Bacteria 3256946
529 2901310261 2901300506 Bacteria 8463898
530 2904440125 2904439833 Bacteria 5931679
531 2904530939 2904530477 Bacteria 5876334
532 2904569236 2904564687 Bacteria 7609577
533 2904576456 2904571731 Bacteria 7608790
534 2904587428 2904584206 Bacteria 6028872
535 2904592537 2904589729 Bacteria 6113573
536 2904604672 2904601388 Bacteria 5884906
537 2917834980 2917832318 Bacteria 5346010
538 2919082502 2919079590 Bacteria 5946433
539 2919477959 2919476304 Bacteria 5888696
540 2919676418 2919675420 Bacteria 3969095
541 2919704118 2919704043 Bacteria 5560311
542 2923515795 2923510766 Bacteria 5926163
543 2923517434 2923516293 Bacteria 3716336
544 2928161340 2928157003 Bacteria 7522202
545 2928168170 2928163908 Bacteria 7561269
546 2928541634 2928536128 Bacteria 7657547
547 2929161039 2929160207 Bacteria 9075316
548 2932425967 2932422444 Bacteria 4678430
549 2939672446 2939669807 Bacteria 5028511
550 2974301069 2974298342 Bacteria 4840922
551 2981993279 2981990288 Bacteria 7590678
552 2984503543 2984499530 Bacteria 5020881
553 2996341660 2996336353 Bacteria 5511628
554 3007424083 3007419365 Bacteria 7026924
555 640488366 640427133 Bacteria 4567418
556 642415616 641736154 Bacteria 7689995
557 651176401 651053060 Bacteria 4689946
558 8002392780 8002392321 Bacteria 4159911
559 8002871195 8002869464 Bacteria 3588529
560 8003404324 8003400568 Bacteria 5535898
561 8020959245 8020953355 Bacteria 7439080
562 8021127229 8021120328 Bacteria 8782274
563 8045865742 8045864390 Bacteria 5043873
564 8054564224 8054563764 Bacteria 5592885
565 8056061077 8056060235 Bacteria 7259403
566 Ga0395901_0000574
567 SwRhRL2b_contig_2162838
568 SwRhRL2b_contig_2682132
569 JGI25151J46595_10000131
570 JGI25151J46595_10002410
571 JGI25151J46595_10040096
572 JGI25165J46597_1000025
573 rootL2_10162752
574 Ga0055538_1000013
575 Ga0055539_1000018
576 Ga0055533_1000022
577 Ga0055525_1000024
578 Ga0055526_1001612
579 Ga0055526_1004498
580 Ga0055537_1001551
581 Ga0055524_1005163
582 Ga0055536_1000090
583 Ga0055534_1000757
584 Ga0055534_1002351
585 Ga0055541_1000013
586 Ga0065165_1000001
587 Ga0065704_10079600
588 Ga0065704_10087137
589 Ga0070658_10015681
590 Ga0070658_10062054
591 Ga0070683_100045202
592 Ga0068869_100005371
593 Ga0068869_100025276
594 Ga0070666_10003380
595 Ga0068868_100010295
596 Ga0070660_100000815
597 Ga0070660_100023074
598 Ga0070660_100037868
599 Ga0070660_100055494
600 Ga0070660_100086070
601 Ga0070689_100174084
602 Ga0070661_100055803
603 Ga0070669_100015207
604 Ga0070675_100015653
605 Ga0070671_100237620
606 Ga0070659_100000637
607 Ga0070659_100057220
608 Ga0070667_100097347
609 Ga0070701_10008112
610 Ga0070708_100014220
611 Ga0070708_100093067
612 Ga0070663_100000495
613 Ga0070663_100030473
614 Ga0070662_100000752
615 Ga0070681_10178706
616 Ga0070681_10230619
617 Ga0070706_100000388
618 Ga0070706_100019315
619 Ga0070707_100041939
620 Ga0070698_100105052
621 Ga0070698_100187403
622 Ga0070699_100009784
623 Ga0070699_100073777
624 Ga0070679_100175752
625 Ga0070684_100041117
626 Ga0070697_100019344
627 Ga0070697_100196088
628 Ga0068853_100003918
629 Ga0068853_100028407
630 Ga0070696_100058155
631 Ga0070696_100159510
632 Ga0070693_100052321
633 Ga0070704_100028751
634 Ga0068855_100025742
635 Ga0068855_100110310
636 Ga0068855_100171029
637 Ga0070664_100010718
638 Ga0068857_100007527
639 Ga0068857_100010070
640 Ga0068854_100030944
641 Ga0068854_100035802
642 Ga0068854_100167848
643 Ga0068852_100022802
644 Ga0068852_100045127
645 Ga0068852_100090448
646 Ga0068859_100006569
647 Ga0068864_100008900
648 Ga0068861_100001850
649 Ga0068851_10020638
650 Ga0068851_10029602
651 Ga0068863_100032733
652 Ga0068858_100034057
653 Ga0068860_100156728
654 Ga0068862_100043338
655 Ga0068862_100080957
656 Ga0070717_10011901
657 Ga0070717_10173763
658 Ga0075364_10000241
659 Ga0075364_10019578
660 Ga0075364_10053825
661 Ga0070716_100083546
662 Ga0070712_100009916
663 Ga0097621_100007843
664 Ga0075370_10069306
665 Ga0068871_100027451
666 Ga0075428_100097502
667 Ga0075428_100098601
668 Ga0075431_100000746
669 Ga0075429_100089055
670 Ga0097620_100006569
671 Ga0099824_1030680
672 Ga0099822_1003706
673 Ga0079104_1001730
674 Ga0079104_1007105
675 Ga0099826_10000039
676 Ga0105250_10002148
677 Ga0111539_10020521
678 Ga0114129_10001070
679 Ga0114129_10100051
680 Ga0114129_10144150
681 Ga0105248_10004400
682 Ga0105248_10005940
683 Ga0105248_10012680
684 Ga0105237_10016183
685 Ga0105237_10036428
686 Ga0105238_10007494
687 Ga0105238_10011653
688 Ga0105238_10012510
689 Ga0105238_10052632
690 Ga0105238_10074902
691 Ga0099796_10000276
692 Ga0099796_10015184
693 Ga0105239_10013790
694 Ga0105239_10043880
695 Ga0105239_10202282
696 Ga0157347_1000034
697 Ga0157371_10001514
698 Ga0157371_10051085
699 Ga0157369_10008661
700 Ga0157374_10009759
701 Ga0157378_10020686
702 Ga0157372_10004459
703 Ga0157372_10153648
704 Ga0157372_10154140
705 Ga0157375_10047478
706 Ga0163163_10049178
707 Ga0157379_10004214
708 Ga0157376_10006746
709 Ga0182006_1000008
710 Ga0182006_1002448
711 Ga0182006_1038981
712 Ga0182005_1000008
713 Ga0183362_10001
714 Ga0163161_10032047
715 Ga0213872_10005211
716 Ga0213875_10002319
717 Ga0209784_100005
718 Ga0209566_100005
719 Ga0209674_100009
720 Ga0209563_100012
721 Ga0209677_100006
722 Ga0209233_1000053
723 Ga0209565_1000927
724 Ga0209565_1003320
725 Ga0209673_1000443
726 Ga0209673_1010110
727 Ga0209675_1000291
728 Ga0209675_1001223
729 Ga0209675_1002115
730 Ga0209676_1000059
731 Ga0209025_1000028
732 Ga0209025_1000879
733 Ga0209025_1002965
734 Ga0209025_1010155
735 Ga0209564_1000623
736 Ga0209564_1002245
737 Ga0209564_1002915
738 Ga0209564_1004985
739 Ga0209256_1000661
740 Ga0209256_1003207
741 Ga0207656_10019146
742 Ga0207696_1003576
743 Ga0207688_10005778
744 Ga0207680_10007805
745 Ga0207684_10010691
746 Ga0207684_10174831
747 Ga0207707_10126088
748 Ga0207695_10000573
749 Ga0207671_10031935
750 Ga0207693_10006671
751 Ga0207693_10035719
752 Ga0207657_10000137
753 Ga0207657_10003404
754 Ga0207657_10023220
755 Ga0207657_10026864
756 Ga0207657_10037213
757 Ga0207652_10101333
758 Ga0207652_10137820
759 Ga0207646_10016047
760 Ga0207681_10055000
761 Ga0207694_10119344
762 Ga0207690_10000013
763 Ga0207706_10001109
764 Ga0207711_10005616
765 Ga0207689_10000605
766 Ga0207689_10002130
767 Ga0207679_10149315
768 Ga0207667_10023248
769 Ga0207667_10027384
770 Ga0207667_10091394
771 Ga0207667_10179673
772 Ga0207651_10000815
773 Ga0207640_10088754
774 Ga0207658_10103211
775 Ga0207677_10002600
776 Ga0207639_10071657
777 Ga0207639_10094938
778 Ga0207678_10000119
779 Ga0207678_10000497
780 Ga0207702_10173163
781 Ga0207648_10066129
782 Ga0207676_10011899
783 Ga0207674_10004838
784 Ga0207674_10015373
785 Ga0207674_10028948
786 Ga0207674_10029689
787 Ga0207675_100000926
788 Ga0207698_10015729
789 Ga0207698_10059749
790 Ga0209281_1001457
791 Ga0209589_1000015
792 Ga0209489_100015
793 Ga0209700_100025
794 Ga0209282_1000058
795 Ga0316181_1070820
796 Ga0265330_10011296
797 Ga0265320_10002374
798 Ga0265325_10004104
799 Ga0265325_10013704
800 Ga0265339_10000425
801 Ga0265316_10136146
802 Ga0307408_100028832
803 Ga0265313_10000107
804 Ga0265314_10025974
805 Ga0307516_10001128
806 Ga0307406_10022582
807 Ga0307406_10053404
808 Ga0307412_10212565
809 Ga0316215_1001466
810 Ga0373931_0006912
811 Ga0373925_0077596
812 Ga0395899_0008100
813 Ga0395900_0006777
814 Ga0395900_0079503
815 Ga0395898_0043891
816 Ga0395898_0097958
817 Ga0395905_0000353
818 Ga0395905_0013434
819 Ga0395905_0068361
820 Ga0436364_0616684
821 Ga0395901_0205259
822 Ga0436361_0439571
823 Ga0436361_1211686
824 Ga0439447_000627
825 Ga0439447_005618
826 Ga0451793_1587026
827 Ga0451797_1457614
828 Ga0439432_023781
829 Ga0439432_025387
830 Ga0439452_005096
831 Ga0439456_004556
832 Ga0439463_011493
833 Ga0450890_002362
834 Ga0450907_001201
835 Ga0439460_0011782
836 Ga0451577_0021805
837 Ga0451577_0065911
838 Ga0466961_0011072
839 Ga0466971_0023990
840 Ga0466957_0009939
841 Ga0466957_0095449
842 Ga0466957_0149432
843 Ga0466959_0102528
844 Ga0451576_0096489
845 Ga0466958_0000187
846 Ga0466958_0056301
847 Ga0466967_0021844
848 Ga0495638_0000145
849 Ga0495638_0023560
850 Ga0495605_0006921
851 Ga0495585_0008730
852 Ga0495596_0000738
853 Ga0495607_0008050
854 Ga0495607_0023097
855 Ga0495583_0017814
856 Ga0495583_0029329
857 Ga0495606_0004680
858 Ga0495608_0168422
859 Ga0495610_0002945
860 Ga0495618_0098689
861 Ga0495620_0027151
862 Ga0495631_0001207
863 Ga0495632_0006023
864 Ga0495637_0027844
865 Ga0495643_0034274
866 Ga0495648_0002842
867 Ga0495648_0090617
868 Ga0495666_0012358
869 Ga0495642_0006479
870 Ga0495642_0017735
871 Ga0495609_0000943
872 Ga0495609_0019502
873 Ga0495597_0000167
874 Ga0495597_0018990
875 Ga0495645_0036425
876 Ga0495633_0001624
877 Ga0495656_0001352
878 Ga0495668_0008800
879 Ga0495611_0002205
880 Ga0495625_0000467
881 Ga0495659_0002637
882 Ga0495661_0003823
883 Ga0495661_0010519
884 Ga0495669_0000012
885 Ga0495671_0000066
886 Ga0495671_0001086
887 Ga0495600_0151529
888 Ga0495660_0003780
889 Ga0495604_0005176
890 Ga0495672_0002271
891 Ga0495672_0012359
892 Ga0495685_025804
893 Ga0495593_0010951
894 Ga0496101_0084325
895 Ga0496102_0017089
896 Ga0496102_0178839
897 Ga0496103_0126082
898 Ga0496104_0055042
899 Ga0496104_0241225
900 Ga0496107_0120045
901 Ga0496110_0000148
902 Ga0496110_0089697
903 Ga0496111_0006204
904 Ga0496111_0054707
905 Ga0496113_0037116
906 Ga0496114_0010521
907 Ga0496115_0027875
908 Ga0496116_0014321
909 Ga0496116_0047596
910 Ga0496116_0079465
911 Ga0496117_0000156
912 Ga0496118_0000005
913 Ga0496118_0148913
914 Ga0496119_0000133
915 Ga0496119_0008959
916 Ga0496119_0026819
917 Ga0496120_0013066
918 Ga0496120_0067602
919 Ga0496121_0005527
920 Ga0496121_0008550
921 Ga0496121_0022034
922 Ga0496122_0008855
923 Ga0496122_0015579
924 Ga0496123_0002314
925 Ga0496123_0015495
926 Ga0496124_0020596
927 Ga0496125_0000710
928 Ga0496125_0005203
929 Ga0496125_0058294
930 Ga0496126_0065314
931 Ga0496126_0116288
932 Ga0496126_0154946
933 Ga0496126_0202149
934 Ga0495678_001890
935 Ga0495678_015557
936 Ga0495682_0011136
937 Ga0501032_0028641
938 Ga0501033_0020588
939 Ga0501034_0001709
940 Ga0501034_0025558
941 Ga0501034_0062645
942 Ga0501034_0117406
943 Ga0501036_0015891
944 Ga0501036_0026779
945 Ga0501036_0153723
946 Ga0501037_0194924
947 Ga0501038_0000014
948 Ga0501038_0024830
949 Ga0501039_0004707
950 Ga0501040_0006648
951 Ga0501040_0091002
952 Ga0501040_0185316
953 Ga0501041_0000023
954 Ga0501041_0001081
955 Ga0501041_0018662
956 Ga0501041_0100474
957 Ga0501042_0047504
958 Ga0501042_0088194
959 Ga0501043_0000121
960 Ga0501043_0045567
961 Ga0501043_0200714
962 Ga0501046_0000157
963 Ga0501046_0017088
964 Ga0501046_0125077
965 Ga0501046_0178819
966 Ga0501047_0000198
967 Ga0501047_0050766
968 Ga0501047_0061826
969 Ga0501048_0000020
970 Ga0501048_0001216
971 Ga0501048_0011807
972 Ga0501048_0231257
973 Ga0501068_0075082
974 Ga0501070_0014599
975 Ga0501071_0000496
976 Ga0501071_0061432
977 Ga0501072_0001424
978 Ga0501072_0015746
979 Ga0501072_0048824
980 Ga0501074_0027398
981 Ga0501074_0032693
982 Ga0501074_0058718
983 Ga0501074_0071397
984 Ga0501074_0086448
985 Ga0501075_0001541
986 Ga0501075_0094203
987 Ga0501075_0204635
988 Ga0501076_0027248
989 Ga0501076_0049514
990 Ga0501076_0088942
991 Ga0501076_0179224
992 Ga0501077_0000714
993 Ga0501077_0002269
994 Ga0501077_0002332
995 Ga0501077_0006844
996 Ga0501079_0000769
997 Ga0501079_0006340
998 Ga0501079_0015449
999 Ga0501079_0060690
1000 Ga0501079_0078499
1001 Ga0501080_0004129
1002 Ga0501080_0005187
1003 Ga0501080_0005645
1004 Ga0501080_0060269
1005 Ga0501080_0140633
1006 Ga0501081_0002294
1007 Ga0501081_0003181
1008 Ga0501081_0008301
1009 Ga0501083_0007955
1010 Ga0501083_0019946
1011 Ga0501083_0046396
1012 Ga0501083_0052403
1013 Ga0501035_0037565
1014 Ga0501035_0246860
1015 Ga0501044_0050216
1016 Ga0501044_0181990
1017 Ga0501045_0000975
1018 Ga0501045_0013664
1019 Ga0501045_0081109
1020 Ga0501045_0163537
1021 nmdc:mga00v17_141_c1
1022 nmdc:mga00v17_9143_c2
1023 nmdc:mga0k408_41613_c1
1024 nmdc:mga07m45_13976_c1
1025 nmdc:mga05p37_40430_c1
1026 nmdc:mga09592_84037_c1
1027 nmdc:mga0qj67_7804_c1
1028 nmdc:mga06r32_218654_c1
1029 nmdc:mga08y16_123188_c1
1030 Ga0495601_0135543
1031 Ga0495595_0065470
1032 Ga0495619_0003906
1033 Ga0500643_012946
1034 Ga0500556_0000336
1035 Ga0500557_000622
1036 Ga0500562_020100
1037 Ga0500595_017608
1038 Ga0500568_0001808
1039 Ga0500568_0066652
1040 Ga0500616_0000917
1041 Ga0500596_001643
1042 Ga0501084_0000739
1043 Ga0501084_0002070
1044 Ga0501084_0009931
1045 Ga0501084_0049269
1046 Ga0501082_0000869
1047 Ga0501082_0031019
1048 Ga0501082_0049319
1049 Ga0501082_0112868
1050 Ga0466962_0009066
1051 Ga0466962_0027249
1052 Ga0530510_0000323
1053 Ga0530510_0018161
1054 Ga0530510_0025237
1055 Ga0530510_0044764
1056 2510281030
1057 2510294839
1058 2510309178
1059 2521557167
1060 2523105525
1061 2553007691
1062 2554814891
1063 2574430001
1064 2599740777
1065 2599747128
1066 2599902387
1067 2600209664
1068 2643979068
1069 2644121294
1070 2676744886
1071 2723876514
1072 2729148161
1073 2739605186
1074 2739612542
1075 2774131970
1076 2808929640
1077 2808951781
1078 2809028414
1079 2809036171
1080 2819618676
1081 2819633222
1082 2834644616
1083 2839099433
1084 2846040110
1085 2852650756
1086 2855733387
1087 2855772396
1088 2858954849
1089 2870070409
1090 2881415395
1091 2891637219
1092 2894026315
1093 2897562650
1094 2901310261
1095 2904440125
1096 2904530939
1097 2904569236
1098 2904576456
1099 2904587428
1100 2904592537
1101 2904604672
1102 2917834980
1103 2919082502
1104 2919477959
1105 2919676418
1106 2919704118
1107 2923515795
1108 2923517434
1109 2928161340
1110 2928168170
1111 2928541634
1112 2929161039
1113 2932425967
1114 2939672446
1115 2974301069
1116 2981993279
1117 2984503543
1118 2996341660
1119 3007424083
1120 640488366
1121 642415616
1122 651176401
1123 8002392780
1124 8002871195
1125 8003404324
1126 8020959245
1127 8021127229
1128 8045865742
1129 8054564224
1130 8056061077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

302

470

0.94

PF02417

Chromate_transp

Chromate transporter

87

253

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.3378 68 375
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.3367 68 375
4yzf-assembly2.cif.gz_C crystal structure of the anion exchanger domain of human erythrocyte band 3 0.3302 6 393
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.3253 4 400
5da0-assembly1.cif.gz_A structure of the the slc26 transporter slc26dg in complex with a nanobody 0.3238 4 397
ID Description Score Start End Superfamily
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3218 14 399 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.317 14 399 1.20.1740.10
af_A0A1D6LTK4_165_459_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.293 54 357 1.20.1740.10
af_A0A1D6LTK4_165_459_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2822 54 357 1.20.1740.10
af_Q4E277_72_471_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2742 14 401 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A6F8QPN4-F1-model_v4 Chromate transporter 0.9964 56 401 GO:0005886
GO:0015109
AF-A0A2S9GSM2-F1-model_v4 2A51: chromate transporter, chromate ion transporter (CHR) family 0.9942 10 397 GO:0005886
GO:0015109
AF-A0A5E6T2R0-F1-model_v4 Chromate transport protein 0.9925 6 401 GO:0005886
GO:0015109
AF-A0A387K1P2-F1-model_v4 Chromate ion transporter 0.9911 100 401 GO:0005886
GO:0015109
AF-A0A6F8QPN4-F1-model_v4 Chromate transporter 0.9906 56 401 GO:0005886
GO:0015109

Map