F464293
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 565 | 288 | 565 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300041496|Ga0451839_1658697|Ga0451839_1658697_51_440 |
| Length | 129 |
| Sequence | VTATLLKRRNGGGASYKRAVGKARRHFRVRKNVRGSAERPRISVFRSNRGVFAQLIDDESGRTLAAVNWTEDDLKSLKRMEQASKAGQLLAERAKAAGVERAVFDRGGYQYHGRVKAFAEGVREGGLAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 177 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 178 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 179 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 180 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 181 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 184 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 185 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 186 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 187 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 188 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 189 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 190 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 191 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 192 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 193 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 194 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 195 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 196 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 197 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 198 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 199 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 200 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 207 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 208 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 1.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.9 |
| Rhizosphere | 90.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214788558 | 2209111006 | Bacteria | 740 |
| 2 | Ga0070658_10135610 | 3300005327 | Bacteria | 2054 |
| 3 | Ga0070676_10310769 | 3300005328 | Bacteria | 1071 |
| 4 | Ga0070676_11546477 | 3300005328 | Bacteria | 512 |
| 5 | Ga0070683_100026337 | 3300005329 | Bacteria | 5234 |
| 6 | Ga0070683_100165138 | 3300005329 | Bacteria | 2100 |
| 7 | Ga0070683_100268238 | 3300005329 | Bacteria | 1624 |
| 8 | Ga0070683_100472928 | 3300005329 | Bacteria | 1197 |
| 9 | Ga0070683_101094229 | 3300005329 | Bacteria | 765 |
| 10 | Ga0070670_100033541 | 3300005331 | Bacteria | 4421 |
| 11 | Ga0070680_100539340 | 3300005336 | Bacteria | 999 |
| 12 | Ga0070680_100854024 | 3300005336 | Bacteria | 785 |
| 13 | Ga0070682_100097996 | 3300005337 | Bacteria | 1930 |
| 14 | Ga0070682_100226337 | 3300005337 | Bacteria | 1334 |
| 15 | Ga0070682_100530400 | 3300005337 | Bacteria | 918 |
| 16 | Ga0070682_101621493 | 3300005337 | Bacteria | 560 |
| 17 | Ga0068868_100044025 | 3300005338 | Bacteria | 3488 |
| 18 | Ga0068868_100165391 | 3300005338 | Bacteria | 1829 |
| 19 | Ga0068868_100177485 | 3300005338 | Bacteria | 1766 |
| 20 | Ga0068868_100328251 | 3300005338 | Bacteria | 1305 |
| 21 | Ga0070660_100614225 | 3300005339 | Bacteria | 910 |
| 22 | Ga0070660_100667768 | 3300005339 | Bacteria | 871 |
| 23 | Ga0070660_101407188 | 3300005339 | Bacteria | 592 |
| 24 | Ga0070689_100034533 | 3300005340 | Bacteria | 3858 |
| 25 | Ga0070691_10046732 | 3300005341 | Bacteria | 2057 |
| 26 | Ga0070691_10408502 | 3300005341 | Bacteria | 767 |
| 27 | Ga0070661_101061817 | 3300005344 | Bacteria | 674 |
| 28 | Ga0070692_10022707 | 3300005345 | Bacteria | 3067 |
| 29 | Ga0070692_10340495 | 3300005345 | Bacteria | 929 |
| 30 | Ga0070692_10533978 | 3300005345 | Bacteria | 766 |
| 31 | Ga0070675_100926197 | 3300005354 | Bacteria | 799 |
| 32 | Ga0070675_101676115 | 3300005354 | Bacteria | 587 |
| 33 | Ga0070675_102168615 | 3300005354 | Bacteria | 512 |
| 34 | Ga0070671_101097860 | 3300005355 | Bacteria | 699 |
| 35 | Ga0070674_100030615 | 3300005356 | Bacteria | 3559 |
| 36 | Ga0070674_100329595 | 3300005356 | Bacteria | 1226 |
| 37 | Ga0070688_100323970 | 3300005365 | Bacteria | 1120 |
| 38 | Ga0070688_100576041 | 3300005365 | Bacteria | 859 |
| 39 | Ga0070688_100903581 | 3300005365 | Bacteria | 697 |
| 40 | Ga0070659_100116007 | 3300005366 | Bacteria | 2165 |
| 41 | Ga0070659_100502286 | 3300005366 | Bacteria | 1034 |
| 42 | Ga0070659_101106061 | 3300005366 | Bacteria | 698 |
| 43 | Ga0070667_101344892 | 3300005367 | Bacteria | 670 |
| 44 | Ga0070667_101938106 | 3300005367 | Bacteria | 555 |
| 45 | Ga0070714_100032487 | 3300005435 | Bacteria | 4356 |
| 46 | Ga0070713_100076472 | 3300005436 | Bacteria | 2843 |
| 47 | Ga0070713_102151749 | 3300005436 | Bacteria | 541 |
| 48 | Ga0070701_10118602 | 3300005438 | Bacteria | 1488 |
| 49 | Ga0070701_10422967 | 3300005438 | Bacteria | 849 |
| 50 | Ga0070701_10578682 | 3300005438 | Bacteria | 741 |
| 51 | Ga0070705_100174325 | 3300005440 | Bacteria | 1450 |
| 52 | Ga0070705_101460579 | 3300005440 | Bacteria | 572 |
| 53 | Ga0070700_100050208 | 3300005441 | Bacteria | 2593 |
| 54 | Ga0070700_100212094 | 3300005441 | Bacteria | 1367 |
| 55 | Ga0070700_100437796 | 3300005441 | Bacteria | 992 |
| 56 | Ga0070700_100830494 | 3300005441 | Bacteria | 747 |
| 57 | Ga0070694_100461334 | 3300005444 | Bacteria | 1005 |
| 58 | Ga0070694_101330060 | 3300005444 | Bacteria | 605 |
| 59 | Ga0070663_100093522 | 3300005455 | Bacteria | 2231 |
| 60 | Ga0070678_100231512 | 3300005456 | Bacteria | 1541 |
| 61 | Ga0070678_100249884 | 3300005456 | Bacteria | 1487 |
| 62 | Ga0070678_100777902 | 3300005456 | Bacteria | 868 |
| 63 | Ga0070678_100840850 | 3300005456 | Bacteria | 836 |
| 64 | Ga0070662_100290847 | 3300005457 | Bacteria | 1325 |
| 65 | Ga0070662_100727378 | 3300005457 | Bacteria | 841 |
| 66 | Ga0070681_10028712 | 3300005458 | Bacteria | 5591 |
| 67 | Ga0070681_11840570 | 3300005458 | Bacteria | 532 |
| 68 | Ga0068867_100000479 | 3300005459 | Bacteria | 26567 |
| 69 | Ga0068867_100266372 | 3300005459 | Bacteria | 1399 |
| 70 | Ga0068867_100465074 | 3300005459 | Bacteria | 1081 |
| 71 | Ga0068867_101470620 | 3300005459 | Bacteria | 634 |
| 72 | Ga0070685_10016222 | 3300005466 | Bacteria | 3966 |
| 73 | Ga0070685_10033786 | 3300005466 | Bacteria | 2877 |
| 74 | Ga0070685_10632115 | 3300005466 | Bacteria | 774 |
| 75 | Ga0070685_11522765 | 3300005466 | Bacteria | 516 |
| 76 | Ga0070707_101234820 | 3300005468 | Bacteria | 713 |
| 77 | Ga0070679_100337405 | 3300005530 | Bacteria | 1455 |
| 78 | Ga0070679_100652922 | 3300005530 | Bacteria | 995 |
| 79 | Ga0070684_100009592 | 3300005535 | Bacteria | 7629 |
| 80 | Ga0070684_100073453 | 3300005535 | Bacteria | 3013 |
| 81 | Ga0070684_100089974 | 3300005535 | Bacteria | 2728 |
| 82 | Ga0070684_100175615 | 3300005535 | Bacteria | 1947 |
| 83 | Ga0070684_100282563 | 3300005535 | Bacteria | 1520 |
| 84 | Ga0070684_101325737 | 3300005535 | Bacteria | 677 |
| 85 | Ga0068853_100214281 | 3300005539 | Bacteria | 1756 |
| 86 | Ga0068853_101158939 | 3300005539 | Bacteria | 746 |
| 87 | Ga0070672_101163351 | 3300005543 | Bacteria | 687 |
| 88 | Ga0070672_101263576 | 3300005543 | Bacteria | 659 |
| 89 | Ga0070686_100029765 | 3300005544 | Bacteria | 3325 |
| 90 | Ga0070686_100987198 | 3300005544 | Bacteria | 690 |
| 91 | Ga0070696_100805289 | 3300005546 | Bacteria | 773 |
| 92 | Ga0070693_100008759 | 3300005547 | Bacteria | 5010 |
| 93 | Ga0070693_100107157 | 3300005547 | Bacteria | 1712 |
| 94 | Ga0070693_100683570 | 3300005547 | Bacteria | 750 |
| 95 | Ga0070665_100260330 | 3300005548 | Bacteria | 1736 |
| 96 | Ga0068855_100915327 | 3300005563 | Bacteria | 926 |
| 97 | Ga0070664_100140035 | 3300005564 | Bacteria | 2130 |
| 98 | Ga0070664_100619270 | 3300005564 | Bacteria | 1005 |
| 99 | Ga0070664_101737282 | 3300005564 | Bacteria | 592 |
| 100 | Ga0068857_101121497 | 3300005577 | Bacteria | 760 |
| 101 | Ga0068857_102152194 | 3300005577 | Bacteria | 547 |
| 102 | Ga0068854_101396687 | 3300005578 | Bacteria | 633 |
| 103 | Ga0068854_101588781 | 3300005578 | Bacteria | 596 |
| 104 | Ga0068856_100064277 | 3300005614 | Bacteria | 3626 |
| 105 | Ga0070702_100341204 | 3300005615 | Bacteria | 1052 |
| 106 | Ga0070702_100497382 | 3300005615 | Bacteria | 894 |
| 107 | Ga0070702_100674749 | 3300005615 | Bacteria | 785 |
| 108 | Ga0068852_100289255 | 3300005616 | Bacteria | 1582 |
| 109 | Ga0068859_100206295 | 3300005617 | Bacteria | 2050 |
| 110 | Ga0068859_100493347 | 3300005617 | Bacteria | 1320 |
| 111 | Ga0068864_100068829 | 3300005618 | Bacteria | 3076 |
| 112 | Ga0068864_100177399 | 3300005618 | Bacteria | 1946 |
| 113 | Ga0068864_100652732 | 3300005618 | Bacteria | 1025 |
| 114 | Ga0068864_102364994 | 3300005618 | Bacteria | 538 |
| 115 | Ga0068866_10154694 | 3300005718 | Bacteria | 1332 |
| 116 | Ga0068866_11107131 | 3300005718 | Bacteria | 568 |
| 117 | Ga0068861_102489232 | 3300005719 | Bacteria | 521 |
| 118 | Ga0068870_10407150 | 3300005840 | Bacteria | 887 |
| 119 | Ga0068863_100833450 | 3300005841 | Bacteria | 921 |
| 120 | Ga0068863_101187839 | 3300005841 | Bacteria | 769 |
| 121 | Ga0068858_100013304 | 3300005842 | Bacteria | 7759 |
| 122 | Ga0068860_100070792 | 3300005843 | Bacteria | 3316 |
| 123 | Ga0068860_101015154 | 3300005843 | Bacteria | 848 |
| 124 | Ga0068862_100582629 | 3300005844 | Bacteria | 1072 |
| 125 | Ga0081455_10013977 | 3300005937 | Bacteria | 7890 |
| 126 | Ga0081455_10050580 | 3300005937 | Bacteria | 3573 |
| 127 | Ga0070717_10138672 | 3300006028 | Bacteria | 2096 |
| 128 | Ga0075432_10001059 | 3300006058 | Bacteria | 8769 |
| 129 | Ga0075432_10160294 | 3300006058 | Bacteria | 869 |
| 130 | Ga0070715_10355246 | 3300006163 | Bacteria | 802 |
| 131 | Ga0070716_100152367 | 3300006173 | Bacteria | 1489 |
| 132 | Ga0070712_100700416 | 3300006175 | Bacteria | 863 |
| 133 | Ga0097621_100171613 | 3300006237 | Bacteria | 1870 |
| 134 | Ga0068871_100976339 | 3300006358 | Bacteria | 788 |
| 135 | Ga0075428_100006916 | 3300006844 | Bacteria | 12599 |
| 136 | Ga0075430_100066743 | 3300006846 | Bacteria | 3021 |
| 137 | Ga0075431_100004224 | 3300006847 | Bacteria | 14071 |
| 138 | Ga0075431_100630402 | 3300006847 | Bacteria | 1054 |
| 139 | Ga0075431_102026320 | 3300006847 | Bacteria | 531 |
| 140 | Ga0075431_102135584 | 3300006847 | Bacteria | 515 |
| 141 | Ga0075433_10061868 | 3300006852 | Bacteria | 3279 |
| 142 | Ga0075429_100011161 | 3300006880 | Bacteria | 7778 |
| 143 | Ga0075429_100122353 | 3300006880 | Bacteria | 2275 |
| 144 | Ga0075429_101533607 | 3300006880 | Bacteria | 579 |
| 145 | Ga0075429_101809631 | 3300006880 | Bacteria | 530 |
| 146 | Ga0068865_100024285 | 3300006881 | Bacteria | 3975 |
| 147 | Ga0068865_100152686 | 3300006881 | Bacteria | 1753 |
| 148 | Ga0068865_100393351 | 3300006881 | Bacteria | 1133 |
| 149 | Ga0068865_100472529 | 3300006881 | Bacteria | 1040 |
| 150 | Ga0068865_101107660 | 3300006881 | Bacteria | 698 |
| 151 | Ga0075436_100183706 | 3300006914 | Bacteria | 1478 |
| 152 | Ga0075436_100482832 | 3300006914 | Bacteria | 905 |
| 153 | Ga0097620_100206294 | 3300006931 | Bacteria | 2050 |
| 154 | Ga0097620_100493310 | 3300006931 | Bacteria | 1320 |
| 155 | Ga0105240_11088820 | 3300009093 | Bacteria | 851 |
| 156 | Ga0105240_11738300 | 3300009093 | Bacteria | 651 |
| 157 | Ga0111539_10065262 | 3300009094 | Bacteria | 4302 |
| 158 | Ga0111539_10589261 | 3300009094 | Bacteria | 1295 |
| 159 | Ga0105245_10106734 | 3300009098 | Bacteria | 2599 |
| 160 | Ga0105245_10272234 | 3300009098 | Bacteria | 1652 |
| 161 | Ga0105245_10370677 | 3300009098 | Bacteria | 1423 |
| 162 | Ga0105245_10925057 | 3300009098 | Bacteria | 914 |
| 163 | Ga0114129_10104282 | 3300009147 | Bacteria | 3918 |
| 164 | Ga0114129_10211509 | 3300009147 | Bacteria | 2621 |
| 165 | Ga0105243_10015204 | 3300009148 | Bacteria | 5824 |
| 166 | Ga0105243_10223874 | 3300009148 | Bacteria | 1665 |
| 167 | Ga0105243_11260850 | 3300009148 | Bacteria | 755 |
| 168 | Ga0105242_10004657 | 3300009176 | Bacteria | 10630 |
| 169 | Ga0105242_10183321 | 3300009176 | Bacteria | 1848 |
| 170 | Ga0105242_10470528 | 3300009176 | Bacteria | 1189 |
| 171 | Ga0105242_10984704 | 3300009176 | Bacteria | 850 |
| 172 | Ga0105248_10175727 | 3300009177 | Bacteria | 2413 |
| 173 | Ga0105248_10211049 | 3300009177 | Bacteria | 2188 |
| 174 | Ga0105238_10547473 | 3300009551 | Bacteria | 1161 |
| 175 | Ga0105238_11416863 | 3300009551 | Bacteria | 722 |
| 176 | Ga0105249_10198350 | 3300009553 | Bacteria | 1963 |
| 177 | Ga0105249_10302551 | 3300009553 | Bacteria | 1605 |
| 178 | Ga0105249_10735901 | 3300009553 | Bacteria | 1048 |
| 179 | Ga0105239_10048544 | 3300010375 | Bacteria | 4655 |
| 180 | Ga0105239_11067271 | 3300010375 | Bacteria | 929 |
| 181 | Ga0105246_10485846 | 3300011119 | Bacteria | 1046 |
| 182 | Ga0105246_10534281 | 3300011119 | Bacteria | 1002 |
| 183 | Ga0157345_1011949 | 3300012498 | Bacteria | 778 |
| 184 | Ga0157369_12331324 | 3300013105 | Bacteria | 542 |
| 185 | Ga0157374_10281061 | 3300013296 | Bacteria | 1643 |
| 186 | Ga0157374_12136394 | 3300013296 | Bacteria | 587 |
| 187 | Ga0157378_10014133 | 3300013297 | Bacteria | 6986 |
| 188 | Ga0157372_10412731 | 3300013307 | Bacteria | 1573 |
| 189 | Ga0157372_11131611 | 3300013307 | Bacteria | 905 |
| 190 | Ga0157375_10076560 | 3300013308 | Bacteria | 3373 |
| 191 | Ga0157375_10442969 | 3300013308 | Bacteria | 1465 |
| 192 | Ga0157375_10673481 | 3300013308 | Bacteria | 1189 |
| 193 | Ga0163163_10160843 | 3300014325 | Bacteria | 2291 |
| 194 | Ga0163163_11207070 | 3300014325 | Bacteria | 819 |
| 195 | Ga0163163_11445795 | 3300014325 | Bacteria | 749 |
| 196 | Ga0157380_10037399 | 3300014326 | Bacteria | 3761 |
| 197 | Ga0157380_11059926 | 3300014326 | Bacteria | 847 |
| 198 | Ga0157380_13347550 | 3300014326 | Bacteria | 513 |
| 199 | Ga0157377_11536149 | 3300014745 | Bacteria | 531 |
| 200 | Ga0157379_10047939 | 3300014968 | Bacteria | 3813 |
| 201 | Ga0157379_10075804 | 3300014968 | Bacteria | 3012 |
| 202 | Ga0157379_12315490 | 3300014968 | Bacteria | 535 |
| 203 | Ga0157376_10082369 | 3300014969 | Bacteria | 2765 |
| 204 | Ga0157376_10189630 | 3300014969 | Bacteria | 1884 |
| 205 | Ga0157376_11297569 | 3300014969 | Bacteria | 758 |
| 206 | Ga0163161_10192074 | 3300017792 | Bacteria | 1570 |
| 207 | Ga0163161_10410596 | 3300017792 | Bacteria | 1087 |
| 208 | Ga0197907_11393950 | 3300020069 | Bacteria | 2559 |
| 209 | Ga0206349_1009212 | 3300020075 | Bacteria | 520 |
| 210 | Ga0206352_10211361 | 3300020078 | Bacteria | 649 |
| 211 | Ga0206350_11358413 | 3300020080 | Bacteria | 1101 |
| 212 | Ga0206354_10092926 | 3300020081 | Bacteria | 609 |
| 213 | Ga0213876_10204198 | 3300021384 | Bacteria | 1050 |
| 214 | Ga0213876_10432658 | 3300021384 | Bacteria | 700 |
| 215 | Ga0213876_10569760 | 3300021384 | Bacteria | 602 |
| 216 | Ga0213875_10040297 | 3300021388 | Bacteria | 2199 |
| 217 | Ga0207666_1002632 | 3300025271 | Bacteria | 2171 |
| 218 | Ga0207697_10152268 | 3300025315 | Bacteria | 1007 |
| 219 | Ga0207642_10026787 | 3300025899 | Bacteria | 2351 |
| 220 | Ga0207710_10515411 | 3300025900 | Bacteria | 621 |
| 221 | Ga0207688_10437116 | 3300025901 | Bacteria | 815 |
| 222 | Ga0207645_10122945 | 3300025907 | Bacteria | 1686 |
| 223 | Ga0207645_10159449 | 3300025907 | Bacteria | 1475 |
| 224 | Ga0207643_10382390 | 3300025908 | Bacteria | 888 |
| 225 | Ga0207643_10632535 | 3300025908 | Bacteria | 690 |
| 226 | Ga0207705_11196101 | 3300025909 | Bacteria | 583 |
| 227 | Ga0207654_10055781 | 3300025911 | Bacteria | 2289 |
| 228 | Ga0207707_10020646 | 3300025912 | Bacteria | 5753 |
| 229 | Ga0207707_10332626 | 3300025912 | Bacteria | 1310 |
| 230 | Ga0207695_11252532 | 3300025913 | Bacteria | 622 |
| 231 | Ga0207693_10579300 | 3300025915 | Bacteria | 874 |
| 232 | Ga0207660_10077102 | 3300025917 | Bacteria | 2439 |
| 233 | Ga0207660_10209038 | 3300025917 | Bacteria | 1527 |
| 234 | Ga0207660_11059476 | 3300025917 | Bacteria | 661 |
| 235 | Ga0207662_10007284 | 3300025918 | Bacteria | 6015 |
| 236 | Ga0207662_10082054 | 3300025918 | Bacteria | 1969 |
| 237 | Ga0207657_10032320 | 3300025919 | Bacteria | 4730 |
| 238 | Ga0207657_10067330 | 3300025919 | Bacteria | 3045 |
| 239 | Ga0207657_10832545 | 3300025919 | Bacteria | 712 |
| 240 | Ga0207657_11006248 | 3300025919 | Bacteria | 639 |
| 241 | Ga0207649_10395737 | 3300025920 | Bacteria | 1033 |
| 242 | Ga0207649_10542095 | 3300025920 | Bacteria | 889 |
| 243 | Ga0207652_10022071 | 3300025921 | Bacteria | 5262 |
| 244 | Ga0207652_10941441 | 3300025921 | Bacteria | 761 |
| 245 | Ga0207681_10810273 | 3300025923 | Bacteria | 782 |
| 246 | Ga0207694_10177800 | 3300025924 | Bacteria | 1725 |
| 247 | Ga0207659_10746571 | 3300025926 | Bacteria | 839 |
| 248 | Ga0207687_10054197 | 3300025927 | Bacteria | 2804 |
| 249 | Ga0207687_10294726 | 3300025927 | Bacteria | 1305 |
| 250 | Ga0207687_10452310 | 3300025927 | Bacteria | 1065 |
| 251 | Ga0207687_10723154 | 3300025927 | Bacteria | 846 |
| 252 | Ga0207687_10734047 | 3300025927 | Bacteria | 840 |
| 253 | Ga0207687_11429344 | 3300025927 | Bacteria | 594 |
| 254 | Ga0207664_10003706 | 3300025929 | Bacteria | 10244 |
| 255 | Ga0207644_10554400 | 3300025931 | Bacteria | 952 |
| 256 | Ga0207690_10255835 | 3300025932 | Bacteria | 1355 |
| 257 | Ga0207690_10919683 | 3300025932 | Bacteria | 726 |
| 258 | Ga0207706_10083036 | 3300025933 | Bacteria | 2816 |
| 259 | Ga0207706_10230165 | 3300025933 | Bacteria | 1622 |
| 260 | Ga0207686_10425012 | 3300025934 | Bacteria | 1017 |
| 261 | Ga0207686_11105406 | 3300025934 | Bacteria | 646 |
| 262 | Ga0207709_10006045 | 3300025935 | Bacteria | 6820 |
| 263 | Ga0207709_10031452 | 3300025935 | Bacteria | 3100 |
| 264 | Ga0207709_10088841 | 3300025935 | Bacteria | 2013 |
| 265 | Ga0207670_11203691 | 3300025936 | Bacteria | 641 |
| 266 | Ga0207669_10052680 | 3300025937 | Bacteria | 2446 |
| 267 | Ga0207669_10417499 | 3300025937 | Bacteria | 1055 |
| 268 | Ga0207704_10159217 | 3300025938 | Bacteria | 1604 |
| 269 | Ga0207704_10401882 | 3300025938 | Bacteria | 1081 |
| 270 | Ga0207704_11850255 | 3300025938 | Bacteria | 519 |
| 271 | Ga0207691_10132342 | 3300025940 | Bacteria | 2202 |
| 272 | Ga0207691_10877032 | 3300025940 | Bacteria | 752 |
| 273 | Ga0207711_10498852 | 3300025941 | Bacteria | 1134 |
| 274 | Ga0207711_10764462 | 3300025941 | Bacteria | 900 |
| 275 | Ga0207689_10563148 | 3300025942 | Bacteria | 957 |
| 276 | Ga0207689_10856882 | 3300025942 | Bacteria | 767 |
| 277 | Ga0207661_10007134 | 3300025944 | Bacteria | 7939 |
| 278 | Ga0207661_10241790 | 3300025944 | Bacteria | 1602 |
| 279 | Ga0207661_11247530 | 3300025944 | Bacteria | 683 |
| 280 | Ga0207679_10518934 | 3300025945 | Bacteria | 1065 |
| 281 | Ga0207679_10609477 | 3300025945 | Bacteria | 985 |
| 282 | Ga0207679_11825537 | 3300025945 | Bacteria | 555 |
| 283 | Ga0207651_10528727 | 3300025960 | Bacteria | 1023 |
| 284 | Ga0207712_10137427 | 3300025961 | Bacteria | 1871 |
| 285 | Ga0207712_10714360 | 3300025961 | Bacteria | 875 |
| 286 | Ga0207668_10345582 | 3300025972 | Bacteria | 1242 |
| 287 | Ga0207640_10407980 | 3300025981 | Bacteria | 1108 |
| 288 | Ga0207640_11095752 | 3300025981 | Bacteria | 704 |
| 289 | Ga0207640_12147336 | 3300025981 | Bacteria | 507 |
| 290 | Ga0207658_11178024 | 3300025986 | Bacteria | 700 |
| 291 | Ga0207658_12195442 | 3300025986 | Bacteria | 501 |
| 292 | Ga0207677_10275788 | 3300026023 | Bacteria | 1378 |
| 293 | Ga0207703_10044345 | 3300026035 | Bacteria | 3574 |
| 294 | Ga0207703_10186900 | 3300026035 | Bacteria | 1832 |
| 295 | Ga0207639_10084823 | 3300026041 | Bacteria | 2517 |
| 296 | Ga0207678_10108230 | 3300026067 | Bacteria | 2371 |
| 297 | Ga0207678_10544552 | 3300026067 | Bacteria | 1015 |
| 298 | Ga0207678_10898448 | 3300026067 | Bacteria | 783 |
| 299 | Ga0207708_10039177 | 3300026075 | Bacteria | 3610 |
| 300 | Ga0207708_11215171 | 3300026075 | Bacteria | 659 |
| 301 | Ga0207702_10109504 | 3300026078 | Bacteria | 2453 |
| 302 | Ga0207641_10215750 | 3300026088 | Bacteria | 1777 |
| 303 | Ga0207641_10953959 | 3300026088 | Bacteria | 853 |
| 304 | Ga0207648_10002304 | 3300026089 | Bacteria | 20620 |
| 305 | Ga0207676_10055322 | 3300026095 | Bacteria | 3115 |
| 306 | Ga0207676_10402209 | 3300026095 | Bacteria | 1280 |
| 307 | Ga0207676_10592449 | 3300026095 | Bacteria | 1064 |
| 308 | Ga0207676_10778748 | 3300026095 | Bacteria | 932 |
| 309 | Ga0207674_11287266 | 3300026116 | Bacteria | 701 |
| 310 | Ga0207675_100013791 | 3300026118 | Bacteria | 7538 |
| 311 | Ga0207675_100341998 | 3300026118 | Bacteria | 1465 |
| 312 | Ga0207675_101510298 | 3300026118 | Bacteria | 692 |
| 313 | Ga0207683_10055593 | 3300026121 | Bacteria | 3471 |
| 314 | Ga0207683_10064538 | 3300026121 | Bacteria | 3227 |
| 315 | Ga0207683_10117210 | 3300026121 | Bacteria | 2388 |
| 316 | Ga0207683_10348139 | 3300026121 | Bacteria | 1360 |
| 317 | Ga0207698_10111228 | 3300026142 | Bacteria | 2296 |
| 318 | Ga0207698_11347927 | 3300026142 | Bacteria | 728 |
| 319 | Ga0207428_10000181 | 3300027907 | Bacteria | 88299 |
| 320 | Ga0207428_10019256 | 3300027907 | Bacteria | 5820 |
| 321 | Ga0207428_10376334 | 3300027907 | Bacteria | 1042 |
| 322 | Ga0268266_10283614 | 3300028379 | Bacteria | 1541 |
| 323 | Ga0268266_11438426 | 3300028379 | Bacteria | 665 |
| 324 | Ga0268266_12257481 | 3300028379 | Bacteria | 516 |
| 325 | Ga0268265_10577377 | 3300028380 | Bacteria | 1071 |
| 326 | Ga0268264_10070742 | 3300028381 | Bacteria | 2954 |
| 327 | Ga0268264_11266214 | 3300028381 | Bacteria | 747 |
| 328 | Ga0265332_10123344 | 3300031238 | Bacteria | 1088 |
| 329 | Ga0265342_10012141 | 3300031712 | Bacteria | 5843 |
| 330 | Ga0307405_12012937 | 3300031731 | Bacteria | 517 |
| 331 | Ga0307413_11992312 | 3300031824 | Unclassified | 523 |
| 332 | Ga0307407_11326529 | 3300031903 | Bacteria | 565 |
| 333 | Ga0307409_102209356 | 3300031995 | Bacteria | 580 |
| 334 | Ga0316593_10164191 | 3300032168 | Unclassified | 812 |
| 335 | Ga0373958_0140919 | 3300034819 | Bacteria | 597 |
| 336 | Ga0373952_0079765 | 3300035092 | Bacteria | 833 |
| 337 | Ga0373939_0127791 | 3300035114 | Bacteria | 904 |
| 338 | Ga0373960_0045682 | 3300035121 | Bacteria | 1283 |
| 339 | Ga0395899_0183732 | 3300037312 | Bacteria | 1466 |
| 340 | Ga0395900_0328361 | 3300037418 | Bacteria | 1508 |
| 341 | Ga0395898_0000942 | 3300037466 | Bacteria | 46333 |
| 342 | Ga0395898_0151036 | 3300037466 | Bacteria | 2222 |
| 343 | Ga0436364_0932459 | 3300037853 | Bacteria | 3637 |
| 344 | Ga0436365_0690359 | 3300039437 | Bacteria | 678 |
| 345 | Ga0436365_0757678 | 3300039437 | Bacteria | 2752 |
| 346 | Ga0436365_1678207 | 3300039437 | Bacteria | 1904 |
| 347 | Ga0436365_1830572 | 3300039437 | Bacteria | 1452 |
| 348 | Ga0436362_1029262 | 3300039453 | Bacteria | 1506 |
| 349 | Ga0439436_0140355 | 3300041404 | Bacteria | 679 |
| 350 | Ga0439439_0003464 | 3300041406 | Bacteria | 3480 |
| 351 | Ga0439453_0055595 | 3300041408 | Bacteria | 809 |
| 352 | Ga0439461_0002477 | 3300041410 | Bacteria | 2953 |
| 353 | Ga0451804_0241165 | 3300041463 | Bacteria | 527 |
| 354 | Ga0451807_1334824 | 3300041486 | Bacteria | 1297 |
| 355 | Ga0451835_0318087 | 3300041492 | Bacteria | 1166 |
| 356 | Ga0451839_1326170 | 3300041496 | Bacteria | 646 |
| 357 | Ga0451839_1658697 | 3300041496 | Bacteria | 587 |
| 358 | Ga0451841_0613115 | 3300041498 | Bacteria | 549 |
| 359 | Ga0439431_0011116 | 3300041997 | Bacteria | 2052 |
| 360 | Ga0439433_0006891 | 3300041999 | Bacteria | 2450 |
| 361 | Ga0439442_037613 | 3300042002 | Bacteria | 1014 |
| 362 | Ga0439445_0046164 | 3300042004 | Bacteria | 1167 |
| 363 | Ga0439449_0102347 | 3300042007 | Bacteria | 1059 |
| 364 | Ga0439456_080017 | 3300042013 | Bacteria | 729 |
| 365 | Ga0450920_003850 | 3300042122 | Bacteria | 2614 |
| 366 | Ga0450923_053382 | 3300042125 | Bacteria | 872 |
| 367 | Ga0439446_0046474 | 3300042156 | Bacteria | 1289 |
| 368 | Ga0439458_0041336 | 3300042157 | Bacteria | 1120 |
| 369 | Ga0439434_0002488 | 3300042435 | Bacteria | 5364 |
| 370 | Ga0439435_0269919 | 3300042436 | Bacteria | 577 |
| 371 | Ga0450918_026981 | 3300042531 | Bacteria | 1009 |
| 372 | Ga0451577_0007199 | 3300042876 | Bacteria | 10963 |
| 373 | Ga0466965_0133553 | 3300044683 | Bacteria | 1288 |
| 374 | Ga0466961_0271816 | 3300044693 | Bacteria | 1038 |
| 375 | Ga0466961_0941297 | 3300044693 | Bacteria | 514 |
| 376 | Ga0466963_0259870 | 3300044694 | Bacteria | 1219 |
| 377 | Ga0466963_0300229 | 3300044694 | Bacteria | 1129 |
| 378 | Ga0466963_0783701 | 3300044694 | Bacteria | 672 |
| 379 | Ga0466964_0307397 | 3300044706 | Bacteria | 801 |
| 380 | Ga0453684_0017333 | 3300044712 | Bacteria | 11163 |
| 381 | Ga0466968_0009436 | 3300044735 | Bacteria | 3752 |
| 382 | Ga0466970_0140951 | 3300044765 | Bacteria | 1328 |
| 383 | Ga0466970_0194938 | 3300044765 | Bacteria | 1126 |
| 384 | Ga0466957_0711270 | 3300044842 | Bacteria | 709 |
| 385 | Ga0466960_0200847 | 3300044901 | Bacteria | 1089 |
| 386 | Ga0466960_0698165 | 3300044901 | Bacteria | 608 |
| 387 | Ga0466959_0009134 | 3300045049 | Bacteria | 7040 |
| 388 | Ga0466958_0018199 | 3300045836 | Bacteria | 4073 |
| 389 | Ga0466967_0005406 | 3300045976 | Bacteria | 8846 |
| 390 | Ga0466967_0471141 | 3300045976 | Bacteria | 1229 |
| 391 | Ga0466967_0866921 | 3300045976 | Bacteria | 897 |
| 392 | Ga0466967_0914713 | 3300045976 | Bacteria | 873 |
| 393 | Ga0466967_0986967 | 3300045976 | Bacteria | 838 |
| 394 | Ga0495653_0944590 | 3300046463 | Bacteria | 512 |
| 395 | Ga0495580_0998518 | 3300046472 | Bacteria | 534 |
| 396 | Ga0495605_0137316 | 3300046474 | Bacteria | 1099 |
| 397 | Ga0495596_0159182 | 3300046500 | Bacteria | 877 |
| 398 | Ga0495616_0404018 | 3300046513 | Bacteria | 561 |
| 399 | Ga0495637_0067382 | 3300046520 | Bacteria | 1453 |
| 400 | Ga0495644_0042316 | 3300046523 | Bacteria | 1715 |
| 401 | Ga0495663_0065403 | 3300046525 | Bacteria | 1149 |
| 402 | Ga0495654_0332888 | 3300046530 | Bacteria | 614 |
| 403 | Ga0495598_0117185 | 3300046537 | Bacteria | 899 |
| 404 | Ga0495656_0139414 | 3300046615 | Bacteria | 1162 |
| 405 | Ga0495611_0103611 | 3300046648 | Bacteria | 1323 |
| 406 | Ga0495659_0315146 | 3300046664 | Bacteria | 663 |
| 407 | Ga0495659_0325375 | 3300046664 | Bacteria | 653 |
| 408 | Ga0495589_0493667 | 3300046794 | Bacteria | 559 |
| 409 | Ga0495581_0627268 | 3300047315 | Bacteria | 622 |
| 410 | Ga0495636_0028454 | 3300047318 | Bacteria | 2280 |
| 411 | Ga0495675_0534761 | 3300047444 | Bacteria | 670 |
| 412 | Ga0495602_0559276 | 3300048088 | Bacteria | 792 |
| 413 | Ga0496100_0486474 | 3300048903 | Bacteria | 949 |
| 414 | Ga0496101_0163659 | 3300048904 | Bacteria | 1707 |
| 415 | Ga0496101_0556809 | 3300048904 | Bacteria | 907 |
| 416 | Ga0496102_0020994 | 3300048905 | Bacteria | 5774 |
| 417 | Ga0496102_0093608 | 3300048905 | Bacteria | 2784 |
| 418 | Ga0496102_0839515 | 3300048905 | Bacteria | 841 |
| 419 | Ga0496103_0067521 | 3300048906 | Bacteria | 2233 |
| 420 | Ga0496104_0003461 | 3300048907 | Bacteria | 13603 |
| 421 | Ga0496104_0066078 | 3300048907 | Bacteria | 3433 |
| 422 | Ga0496105_0022153 | 3300048908 | Bacteria | 5146 |
| 423 | Ga0496105_1250345 | 3300048908 | Bacteria | 544 |
| 424 | Ga0496105_1337927 | 3300048908 | Bacteria | 521 |
| 425 | Ga0496106_0005388 | 3300048909 | Bacteria | 9463 |
| 426 | Ga0496106_0381361 | 3300048909 | Bacteria | 1133 |
| 427 | Ga0496106_0787132 | 3300048909 | Bacteria | 755 |
| 428 | Ga0496106_1525884 | 3300048909 | Bacteria | 513 |
| 429 | Ga0496107_0014931 | 3300048910 | Bacteria | 5439 |
| 430 | Ga0496107_0045026 | 3300048910 | Bacteria | 3173 |
| 431 | Ga0496108_0092552 | 3300048911 | Bacteria | 2571 |
| 432 | Ga0496108_0309845 | 3300048911 | Bacteria | 1376 |
| 433 | Ga0496109_0087389 | 3300048912 | Bacteria | 2880 |
| 434 | Ga0496109_0169897 | 3300048912 | Bacteria | 2045 |
| 435 | Ga0496109_1639696 | 3300048912 | Bacteria | 577 |
| 436 | Ga0496110_0005006 | 3300048913 | Bacteria | 10353 |
| 437 | Ga0496111_0103230 | 3300048914 | Bacteria | 2096 |
| 438 | Ga0496111_0399740 | 3300048914 | Bacteria | 1015 |
| 439 | Ga0496111_0465455 | 3300048914 | Bacteria | 932 |
| 440 | Ga0496112_1084166 | 3300048915 | Bacteria | 719 |
| 441 | Ga0496112_1461625 | 3300048915 | Bacteria | 598 |
| 442 | Ga0496113_0180619 | 3300048916 | Bacteria | 1673 |
| 443 | Ga0496113_0462684 | 3300048916 | Bacteria | 1019 |
| 444 | Ga0496113_1480645 | 3300048916 | Bacteria | 524 |
| 445 | Ga0496114_0010104 | 3300048917 | Bacteria | 7507 |
| 446 | Ga0496114_0038009 | 3300048917 | Bacteria | 3982 |
| 447 | Ga0496114_0073477 | 3300048917 | Bacteria | 2878 |
| 448 | Ga0496114_0851047 | 3300048917 | Bacteria | 792 |
| 449 | Ga0496115_0044878 | 3300048918 | Bacteria | 3527 |
| 450 | Ga0501031_0068501 | 3300049568 | Bacteria | 2312 |
| 451 | Ga0501031_0209414 | 3300049568 | Bacteria | 1271 |
| 452 | Ga0501031_0327609 | 3300049568 | Bacteria | 992 |
| 453 | Ga0501034_0203447 | 3300049571 | Bacteria | 1937 |
| 454 | Ga0501036_0148825 | 3300049572 | Bacteria | 1975 |
| 455 | Ga0501036_0296415 | 3300049572 | Bacteria | 1353 |
| 456 | Ga0501036_0704824 | 3300049572 | Bacteria | 834 |
| 457 | Ga0501036_1039229 | 3300049572 | Bacteria | 670 |
| 458 | Ga0501037_0223419 | 3300049573 | Bacteria | 1324 |
| 459 | Ga0501037_0510216 | 3300049573 | Bacteria | 815 |
| 460 | Ga0501037_0620055 | 3300049573 | Bacteria | 725 |
| 461 | Ga0501038_0144467 | 3300049574 | Bacteria | 1943 |
| 462 | Ga0501038_1181390 | 3300049574 | Bacteria | 556 |
| 463 | Ga0501039_0007709 | 3300049575 | Bacteria | 8218 |
| 464 | Ga0501039_0115948 | 3300049575 | Bacteria | 2097 |
| 465 | Ga0501039_0174244 | 3300049575 | Bacteria | 1692 |
| 466 | Ga0501039_1328554 | 3300049575 | Bacteria | 554 |
| 467 | Ga0501040_0025481 | 3300049576 | Bacteria | 3976 |
| 468 | Ga0501040_0187522 | 3300049576 | Bacteria | 1467 |
| 469 | Ga0501040_0213523 | 3300049576 | Bacteria | 1372 |
| 470 | Ga0501041_0067285 | 3300049577 | Bacteria | 2196 |
| 471 | Ga0501041_0439854 | 3300049577 | Bacteria | 827 |
| 472 | Ga0501041_0759355 | 3300049577 | Bacteria | 621 |
| 473 | Ga0501041_0761458 | 3300049577 | Bacteria | 620 |
| 474 | Ga0501042_0015136 | 3300049578 | Bacteria | 5275 |
| 475 | Ga0501042_0118116 | 3300049578 | Bacteria | 1909 |
| 476 | Ga0501042_0133118 | 3300049578 | Bacteria | 1792 |
| 477 | Ga0501042_0170317 | 3300049578 | Bacteria | 1571 |
| 478 | Ga0501042_0210924 | 3300049578 | Bacteria | 1401 |
| 479 | Ga0501043_0217764 | 3300049579 | Bacteria | 1478 |
| 480 | Ga0501043_0792996 | 3300049579 | Bacteria | 686 |
| 481 | Ga0501046_0057062 | 3300049580 | Bacteria | 3064 |
| 482 | Ga0501046_0521761 | 3300049580 | Bacteria | 849 |
| 483 | Ga0501047_1266265 | 3300049581 | Bacteria | 551 |
| 484 | Ga0501048_0015470 | 3300049582 | Bacteria | 5636 |
| 485 | Ga0501048_0287913 | 3300049582 | Bacteria | 1168 |
| 486 | Ga0501048_0367479 | 3300049582 | Bacteria | 1027 |
| 487 | Ga0501067_0038670 | 3300049583 | Bacteria | 2649 |
| 488 | Ga0501068_0029609 | 3300049584 | Bacteria | 3243 |
| 489 | Ga0501068_0718064 | 3300049584 | Bacteria | 654 |
| 490 | Ga0501069_0036892 | 3300049585 | Bacteria | 2697 |
| 491 | Ga0501069_0795595 | 3300049585 | Bacteria | 573 |
| 492 | Ga0501070_0035611 | 3300049586 | Bacteria | 4159 |
| 493 | Ga0501071_0001083 | 3300049587 | Bacteria | 15121 |
| 494 | Ga0501071_0556278 | 3300049587 | Bacteria | 881 |
| 495 | Ga0501071_1382492 | 3300049587 | Bacteria | 544 |
| 496 | Ga0501072_0016036 | 3300049588 | Bacteria | 5745 |
| 497 | Ga0501072_0129945 | 3300049588 | Bacteria | 2007 |
| 498 | Ga0501072_0366310 | 3300049588 | Bacteria | 1144 |
| 499 | Ga0501072_0525125 | 3300049588 | Bacteria | 936 |
| 500 | Ga0501072_0894644 | 3300049588 | Bacteria | 694 |
| 501 | Ga0501072_1605102 | 3300049588 | Bacteria | 501 |
| 502 | Ga0501074_0036342 | 3300049590 | Bacteria | 3568 |
| 503 | Ga0501074_0197734 | 3300049590 | Bacteria | 1433 |
| 504 | Ga0501074_0611332 | 3300049590 | Bacteria | 771 |
| 505 | Ga0501075_0003018 | 3300049591 | Bacteria | 11243 |
| 506 | Ga0501075_0158531 | 3300049591 | Bacteria | 1726 |
| 507 | Ga0501075_0313729 | 3300049591 | Bacteria | 1195 |
| 508 | Ga0501075_0482020 | 3300049591 | Bacteria | 946 |
| 509 | Ga0501075_0726025 | 3300049591 | Bacteria | 756 |
| 510 | Ga0501075_1068007 | 3300049591 | Bacteria | 613 |
| 511 | Ga0501076_0040146 | 3300049592 | Bacteria | 3676 |
| 512 | Ga0501076_0222483 | 3300049592 | Bacteria | 1542 |
| 513 | Ga0501076_0521371 | 3300049592 | Bacteria | 980 |
| 514 | Ga0501076_0529542 | 3300049592 | Bacteria | 971 |
| 515 | Ga0501077_0001393 | 3300049593 | Bacteria | 14562 |
| 516 | Ga0501077_0695744 | 3300049593 | Bacteria | 653 |
| 517 | Ga0501077_0792664 | 3300049593 | Bacteria | 609 |
| 518 | Ga0501079_0008393 | 3300049741 | Bacteria | 7829 |
| 519 | Ga0501079_0079813 | 3300049741 | Bacteria | 2530 |
| 520 | Ga0501079_0312217 | 3300049741 | Bacteria | 1230 |
| 521 | Ga0501079_0350482 | 3300049741 | Bacteria | 1157 |
| 522 | Ga0501079_0704837 | 3300049741 | Bacteria | 795 |
| 523 | Ga0501080_0048644 | 3300049742 | Bacteria | 3946 |
| 524 | Ga0501081_0004393 | 3300049743 | Bacteria | 9040 |
| 525 | Ga0501081_0323816 | 3300049743 | Bacteria | 1133 |
| 526 | Ga0501081_0681376 | 3300049743 | Bacteria | 771 |
| 527 | Ga0501083_0051083 | 3300049744 | Bacteria | 2781 |
| 528 | Ga0501035_0174832 | 3300049822 | Bacteria | 1853 |
| 529 | Ga0501035_0308733 | 3300049822 | Bacteria | 1331 |
| 530 | Ga0501035_0594967 | 3300049822 | Bacteria | 902 |
| 531 | Ga0501044_1353658 | 3300049823 | Bacteria | 578 |
| 532 | Ga0501045_0010860 | 3300049824 | Bacteria | 6381 |
| 533 | Ga0501045_0111188 | 3300049824 | Bacteria | 2031 |
| 534 | Ga0501045_0246640 | 3300049824 | Bacteria | 1329 |
| 535 | Ga0501045_0524550 | 3300049824 | Bacteria | 879 |
| 536 | nmdc:mga05p37_47021_c1 | 3300050507 | Bacteria | 5307 |
| 537 | nmdc:mga05p37_48463_c1 | 3300050507 | Bacteria | 5225 |
| 538 | nmdc:mga09592_45593_c1 | 3300050508 | Bacteria | 3693 |
| 539 | nmdc:mga09592_939353_c1 | 3300050508 | Bacteria | 725 |
| 540 | nmdc:mga0qj67_27322_c1 | 3300050509 | Bacteria | 4422 |
| 541 | nmdc:mga06r32_153768_c1 | 3300050510 | Bacteria | 2280 |
| 542 | nmdc:mga06r32_1653532_c1 | 3300050510 | Bacteria | 578 |
| 543 | nmdc:mga08y16_125036_c1 | 3300050511 | Bacteria | 2676 |
| 544 | nmdc:mga08y16_574024_c1 | 3300050511 | Bacteria | 1139 |
| 545 | nmdc:mga08y16_583630_c1 | 3300050511 | Bacteria | 1128 |
| 546 | nmdc:mga08y16_889200_c1 | 3300050511 | Bacteria | 878 |
| 547 | nmdc:mga0n895_439122_c1 | 3300050512 | Bacteria | 1318 |
| 548 | nmdc:mga0a205_62900_c1 | 3300050515 | Bacteria | 3585 |
| 549 | Ga0495619_0362824 | 3300053085 | Bacteria | 1002 |
| 550 | Ga0501084_0005571 | 3300054114 | Bacteria | 10338 |
| 551 | Ga0501084_0237792 | 3300054114 | Bacteria | 1537 |
| 552 | Ga0501084_0429719 | 3300054114 | Bacteria | 1116 |
| 553 | Ga0501084_0442662 | 3300054114 | Bacteria | 1098 |
| 554 | Ga0501084_1094273 | 3300054114 | Bacteria | 669 |
| 555 | Ga0587101_018959 | 3300059623 | Bacteria | 970 |
| 556 | Ga0501082_0021659 | 3300060353 | Bacteria | 5541 |
| 557 | Ga0501082_0377070 | 3300060353 | Bacteria | 1238 |
| 558 | Ga0501082_0399182 | 3300060353 | Bacteria | 1200 |
| 559 | Ga0501082_0593535 | 3300060353 | Bacteria | 969 |
| 560 | Ga0466962_0026051 | 3300061719 | Bacteria | 2808 |
| 561 | Ga0466962_0649515 | 3300061719 | Bacteria | 539 |
| 562 | Ga0530510_0032518 | 3300061734 | Bacteria | 3754 |
| 563 | Ga0530510_0130624 | 3300061734 | Bacteria | 1848 |
| 564 | Ga0530510_0309865 | 3300061734 | Bacteria | 1182 |
| 565 | Ga0530510_1439833 | 3300061734 | Unclassified | 529 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031824 | Ga0307413_11992312 | Ga0307413_119923121 | 93 |
| 2 | 3300006175 | Ga0070712_100700416 | Ga0070712_1007004162 | 101 |
| 3 | 3300025915 | Ga0207693_10579300 | Ga0207693_105793002 | 101 |
| 4 | 3300031903 | Ga0307407_11326529 | Ga0307407_113265292 | 101 |
| 5 | 3300041404 | Ga0439436_0140355 | Ga0439436_0140355_305_658 | 101 |
| 6 | 3300041406 | Ga0439439_0003464 | Ga0439439_0003464_3059_3412 | 101 |
| 7 | 3300041410 | Ga0439461_0002477 | Ga0439461_0002477_2526_2879 | 101 |
| 8 | 3300041997 | Ga0439431_0011116 | Ga0439431_0011116_662_1015 | 101 |
| 9 | 3300041999 | Ga0439433_0006891 | Ga0439433_0006891_520_873 | 101 |
| 10 | 3300042002 | Ga0439442_037613 | Ga0439442_037613_430_783 | 101 |
| 11 | 3300042004 | Ga0439445_0046164 | Ga0439445_0046164_772_1125 | 101 |
| 12 | 3300042007 | Ga0439449_0102347 | Ga0439449_0102347_295_648 | 101 |
| 13 | 3300042125 | Ga0450923_053382 | Ga0450923_053382_126_479 | 101 |
| 14 | 3300042156 | Ga0439446_0046474 | Ga0439446_0046474_582_935 | 101 |
| 15 | 3300042435 | Ga0439434_0002488 | Ga0439434_0002488_4562_4915 | 101 |
| 16 | 3300048915 | Ga0496112_1084166 | Ga0496112_1084166_122_430 | 101 |
| 17 | 3300031995 | Ga0307409_102209356 | Ga0307409_1022093562 | 102 |
| 18 | 3300041408 | Ga0439453_0055595 | Ga0439453_0055595_213_566 | 102 |
| 19 | 3300041496 | Ga0451839_1326170 | Ga0451839_1326170_22_339 | 102 |
| 20 | 3300042013 | Ga0439456_080017 | Ga0439456_080017_225_578 | 102 |
| 21 | 3300049572 | Ga0501036_1039229 | Ga0501036_1039229_72_425 | 102 |
| 22 | 3300049575 | Ga0501039_0174244 | Ga0501039_0174244_1243_1596 | 102 |
| 23 | 3300049576 | Ga0501040_0187522 | Ga0501040_0187522_656_1009 | 102 |
| 24 | 3300049577 | Ga0501041_0761458 | Ga0501041_0761458_256_609 | 102 |
| 25 | 3300049578 | Ga0501042_0210924 | Ga0501042_0210924_577_930 | 102 |
| 26 | 3300049580 | Ga0501046_0521761 | Ga0501046_0521761_475_828 | 102 |
| 27 | 3300049587 | Ga0501071_0556278 | Ga0501071_0556278_482_835 | 102 |
| 28 | 3300049588 | Ga0501072_0366310 | Ga0501072_0366310_663_1016 | 102 |
| 29 | 3300049590 | Ga0501074_0611332 | Ga0501074_0611332_382_735 | 102 |
| 30 | 3300049591 | Ga0501075_0726025 | Ga0501075_0726025_20_373 | 102 |
| 31 | 3300049592 | Ga0501076_0529542 | Ga0501076_0529542_437_790 | 102 |
| 32 | 3300049741 | Ga0501079_0704837 | Ga0501079_0704837_267_620 | 102 |
| 33 | 3300049743 | Ga0501081_0323816 | Ga0501081_0323816_459_812 | 102 |
| 34 | 3300049822 | Ga0501035_0594967 | Ga0501035_0594967_421_774 | 102 |
| 35 | 3300049824 | Ga0501045_0111188 | Ga0501045_0111188_219_572 | 102 |
| 36 | 3300054114 | Ga0501084_0429719 | Ga0501084_0429719_544_897 | 102 |
| 37 | 3300054114 | Ga0501084_1094273 | Ga0501084_1094273_280_633 | 102 |
| 38 | 3300060353 | Ga0501082_0593535 | Ga0501082_0593535_202_555 | 102 |
| 39 | 3300061734 | Ga0530510_0309865 | Ga0530510_0309865_150_503 | 102 |
| 40 | 3300042436 | Ga0439435_0269919 | Ga0439435_0269919_80_403 | 104 |
| 41 | 3300048917 | Ga0496114_0851047 | Ga0496114_0851047_179_547 | 105 |
| 42 | 3300044693 | Ga0466961_0271816 | Ga0466961_0271816_522_875 | 106 |
| 43 | 3300044693 | Ga0466961_0941297 | Ga0466961_0941297_40_393 | 106 |
| 44 | 3300044694 | Ga0466963_0300229 | Ga0466963_0300229_450_803 | 106 |
| 45 | 3300044735 | Ga0466968_0009436 | Ga0466968_0009436_2864_3217 | 106 |
| 46 | 3300044765 | Ga0466970_0140951 | Ga0466970_0140951_17_370 | 106 |
| 47 | 3300045049 | Ga0466959_0009134 | Ga0466959_0009134_187_540 | 106 |
| 48 | 3300045836 | Ga0466958_0018199 | Ga0466958_0018199_3000_3353 | 106 |
| 49 | 3300061719 | Ga0466962_0026051 | Ga0466962_0026051_652_1005 | 106 |
| 50 | 3300020080 | Ga0206350_11358413 | Ga0206350_113584133 | 107 |
| 51 | 3300037418 | Ga0395900_0328361 | Ga0395900_0328361_443_796 | 107 |
| 52 | 3300037466 | Ga0395898_0151036 | Ga0395898_0151036_1679_2032 | 107 |
| 53 | 3300039437 | Ga0436365_0690359 | Ga0436365_0690359_278_631 | 107 |
| 54 | 3300044694 | Ga0466963_0259870 | Ga0466963_0259870_400_753 | 108 |
| 55 | 3300045976 | Ga0466967_0005406 | Ga0466967_0005406_472_825 | 108 |
| 56 | 2209111006 | 2214788558 | 2213813822 | 114 |
| 57 | 3300005327 | Ga0070658_10135610 | Ga0070658_101356102 | 114 |
| 58 | 3300005328 | Ga0070676_10310769 | Ga0070676_103107692 | 114 |
| 59 | 3300005328 | Ga0070676_11546477 | Ga0070676_115464772 | 114 |
| 60 | 3300005329 | Ga0070683_100026337 | Ga0070683_1000263371 | 114 |
| 61 | 3300005329 | Ga0070683_100165138 | Ga0070683_1001651383 | 114 |
| 62 | 3300005329 | Ga0070683_100268238 | Ga0070683_1002682383 | 114 |
| 63 | 3300005329 | Ga0070683_100472928 | Ga0070683_1004729282 | 114 |
| 64 | 3300005329 | Ga0070683_101094229 | Ga0070683_1010942292 | 114 |
| 65 | 3300005331 | Ga0070670_100033541 | Ga0070670_1000335416 | 114 |
| 66 | 3300005336 | Ga0070680_100539340 | Ga0070680_1005393402 | 114 |
| 67 | 3300005336 | Ga0070680_100854024 | Ga0070680_1008540241 | 114 |
| 68 | 3300005337 | Ga0070682_100097996 | Ga0070682_1000979961 | 114 |
| 69 | 3300005337 | Ga0070682_100226337 | Ga0070682_1002263371 | 114 |
| 70 | 3300005337 | Ga0070682_100530400 | Ga0070682_1005304002 | 114 |
| 71 | 3300005337 | Ga0070682_101621493 | Ga0070682_1016214931 | 114 |
| 72 | 3300005338 | Ga0068868_100044025 | Ga0068868_1000440253 | 114 |
| 73 | 3300005338 | Ga0068868_100165391 | Ga0068868_1001653913 | 114 |
| 74 | 3300005338 | Ga0068868_100177485 | Ga0068868_1001774854 | 114 |
| 75 | 3300005338 | Ga0068868_100328251 | Ga0068868_1003282513 | 114 |
| 76 | 3300005339 | Ga0070660_100614225 | Ga0070660_1006142252 | 114 |
| 77 | 3300005339 | Ga0070660_100667768 | Ga0070660_1006677681 | 114 |
| 78 | 3300005339 | Ga0070660_101407188 | Ga0070660_1014071881 | 114 |
| 79 | 3300005340 | Ga0070689_100034533 | Ga0070689_1000345338 | 114 |
| 80 | 3300005341 | Ga0070691_10046732 | Ga0070691_100467324 | 114 |
| 81 | 3300005341 | Ga0070691_10408502 | Ga0070691_104085021 | 114 |
| 82 | 3300005344 | Ga0070661_101061817 | Ga0070661_1010618171 | 114 |
| 83 | 3300005345 | Ga0070692_10022707 | Ga0070692_100227072 | 114 |
| 84 | 3300005345 | Ga0070692_10340495 | Ga0070692_103404951 | 114 |
| 85 | 3300005345 | Ga0070692_10533978 | Ga0070692_105339782 | 114 |
| 86 | 3300005354 | Ga0070675_100926197 | Ga0070675_1009261971 | 114 |
| 87 | 3300005354 | Ga0070675_101676115 | Ga0070675_1016761151 | 114 |
| 88 | 3300005354 | Ga0070675_102168615 | Ga0070675_1021686151 | 114 |
| 89 | 3300005355 | Ga0070671_101097860 | Ga0070671_1010978602 | 114 |
| 90 | 3300005356 | Ga0070674_100030615 | Ga0070674_1000306155 | 114 |
| 91 | 3300005356 | Ga0070674_100329595 | Ga0070674_1003295952 | 114 |
| 92 | 3300005365 | Ga0070688_100323970 | Ga0070688_1003239702 | 114 |
| 93 | 3300005365 | Ga0070688_100576041 | Ga0070688_1005760412 | 114 |
| 94 | 3300005365 | Ga0070688_100903581 | Ga0070688_1009035812 | 114 |
| 95 | 3300005366 | Ga0070659_100116007 | Ga0070659_1001160072 | 114 |
| 96 | 3300005366 | Ga0070659_100502286 | Ga0070659_1005022862 | 114 |
| 97 | 3300005366 | Ga0070659_101106061 | Ga0070659_1011060612 | 114 |
| 98 | 3300005367 | Ga0070667_101344892 | Ga0070667_1013448922 | 114 |
| 99 | 3300005367 | Ga0070667_101938106 | Ga0070667_1019381061 | 114 |
| 100 | 3300005435 | Ga0070714_100032487 | Ga0070714_1000324875 | 114 |
| 101 | 3300005436 | Ga0070713_100076472 | Ga0070713_1000764724 | 114 |
| 102 | 3300005436 | Ga0070713_102151749 | Ga0070713_1021517491 | 114 |
| 103 | 3300005438 | Ga0070701_10118602 | Ga0070701_101186022 | 114 |
| 104 | 3300005438 | Ga0070701_10422967 | Ga0070701_104229672 | 114 |
| 105 | 3300005438 | Ga0070701_10578682 | Ga0070701_105786822 | 114 |
| 106 | 3300005440 | Ga0070705_100174325 | Ga0070705_1001743252 | 114 |
| 107 | 3300005440 | Ga0070705_101460579 | Ga0070705_1014605791 | 114 |
| 108 | 3300005441 | Ga0070700_100050208 | Ga0070700_1000502082 | 114 |
| 109 | 3300005441 | Ga0070700_100212094 | Ga0070700_1002120944 | 114 |
| 110 | 3300005441 | Ga0070700_100437796 | Ga0070700_1004377962 | 114 |
| 111 | 3300005441 | Ga0070700_100830494 | Ga0070700_1008304942 | 114 |
| 112 | 3300005444 | Ga0070694_100461334 | Ga0070694_1004613341 | 114 |
| 113 | 3300005444 | Ga0070694_101330060 | Ga0070694_1013300602 | 114 |
| 114 | 3300005455 | Ga0070663_100093522 | Ga0070663_1000935221 | 114 |
| 115 | 3300005456 | Ga0070678_100231512 | Ga0070678_1002315123 | 114 |
| 116 | 3300005456 | Ga0070678_100249884 | Ga0070678_1002498842 | 114 |
| 117 | 3300005456 | Ga0070678_100777902 | Ga0070678_1007779022 | 114 |
| 118 | 3300005456 | Ga0070678_100840850 | Ga0070678_1008408502 | 114 |
| 119 | 3300005457 | Ga0070662_100290847 | Ga0070662_1002908472 | 114 |
| 120 | 3300005457 | Ga0070662_100727378 | Ga0070662_1007273782 | 114 |
| 121 | 3300005458 | Ga0070681_10028712 | Ga0070681_1002871210 | 114 |
| 122 | 3300005458 | Ga0070681_11840570 | Ga0070681_118405701 | 114 |
| 123 | 3300005459 | Ga0068867_100000479 | Ga0068867_10000047929 | 114 |
| 124 | 3300005459 | Ga0068867_100266372 | Ga0068867_1002663722 | 114 |
| 125 | 3300005459 | Ga0068867_100465074 | Ga0068867_1004650742 | 114 |
| 126 | 3300005459 | Ga0068867_101470620 | Ga0068867_1014706201 | 114 |
| 127 | 3300005466 | Ga0070685_10016222 | Ga0070685_100162228 | 114 |
| 128 | 3300005466 | Ga0070685_10033786 | Ga0070685_100337862 | 114 |
| 129 | 3300005466 | Ga0070685_10632115 | Ga0070685_106321151 | 114 |
| 130 | 3300005466 | Ga0070685_11522765 | Ga0070685_115227652 | 114 |
| 131 | 3300005468 | Ga0070707_101234820 | Ga0070707_1012348202 | 114 |
| 132 | 3300005530 | Ga0070679_100337405 | Ga0070679_1003374052 | 114 |
| 133 | 3300005530 | Ga0070679_100652922 | Ga0070679_1006529222 | 114 |
| 134 | 3300005535 | Ga0070684_100009592 | Ga0070684_10000959212 | 114 |
| 135 | 3300005535 | Ga0070684_100073453 | Ga0070684_1000734536 | 114 |
| 136 | 3300005535 | Ga0070684_100089974 | Ga0070684_1000899747 | 114 |
| 137 | 3300005535 | Ga0070684_100175615 | Ga0070684_1001756152 | 114 |
| 138 | 3300005535 | Ga0070684_100282563 | Ga0070684_1002825632 | 114 |
| 139 | 3300005535 | Ga0070684_101325737 | Ga0070684_1013257371 | 114 |
| 140 | 3300005539 | Ga0068853_100214281 | Ga0068853_1002142813 | 114 |
| 141 | 3300005539 | Ga0068853_101158939 | Ga0068853_1011589391 | 114 |
| 142 | 3300005543 | Ga0070672_101163351 | Ga0070672_1011633512 | 114 |
| 143 | 3300005543 | Ga0070672_101263576 | Ga0070672_1012635762 | 114 |
| 144 | 3300005544 | Ga0070686_100029765 | Ga0070686_1000297652 | 114 |
| 145 | 3300005544 | Ga0070686_100987198 | Ga0070686_1009871982 | 114 |
| 146 | 3300005546 | Ga0070696_100805289 | Ga0070696_1008052892 | 114 |
| 147 | 3300005547 | Ga0070693_100008759 | Ga0070693_1000087597 | 114 |
| 148 | 3300005547 | Ga0070693_100107157 | Ga0070693_1001071573 | 114 |
| 149 | 3300005547 | Ga0070693_100683570 | Ga0070693_1006835702 | 114 |
| 150 | 3300005548 | Ga0070665_100260330 | Ga0070665_1002603302 | 114 |
| 151 | 3300005563 | Ga0068855_100915327 | Ga0068855_1009153272 | 114 |
| 152 | 3300005564 | Ga0070664_100140035 | Ga0070664_1001400351 | 114 |
| 153 | 3300005564 | Ga0070664_100619270 | Ga0070664_1006192702 | 114 |
| 154 | 3300005564 | Ga0070664_101737282 | Ga0070664_1017372822 | 114 |
| 155 | 3300005577 | Ga0068857_101121497 | Ga0068857_1011214972 | 114 |
| 156 | 3300005577 | Ga0068857_102152194 | Ga0068857_1021521942 | 114 |
| 157 | 3300005578 | Ga0068854_101396687 | Ga0068854_1013966872 | 114 |
| 158 | 3300005578 | Ga0068854_101588781 | Ga0068854_1015887812 | 114 |
| 159 | 3300005614 | Ga0068856_100064277 | Ga0068856_1000642776 | 114 |
| 160 | 3300005615 | Ga0070702_100341204 | Ga0070702_1003412042 | 114 |
| 161 | 3300005615 | Ga0070702_100497382 | Ga0070702_1004973822 | 114 |
| 162 | 3300005615 | Ga0070702_100674749 | Ga0070702_1006747491 | 114 |
| 163 | 3300005616 | Ga0068852_100289255 | Ga0068852_1002892552 | 114 |
| 164 | 3300005617 | Ga0068859_100206295 | Ga0068859_1002062954 | 114 |
| 165 | 3300005617 | Ga0068859_100493347 | Ga0068859_1004933472 | 114 |
| 166 | 3300005618 | Ga0068864_100068829 | Ga0068864_1000688292 | 114 |
| 167 | 3300005618 | Ga0068864_100177399 | Ga0068864_1001773992 | 114 |
| 168 | 3300005618 | Ga0068864_100652732 | Ga0068864_1006527322 | 114 |
| 169 | 3300005618 | Ga0068864_102364994 | Ga0068864_1023649941 | 114 |
| 170 | 3300005718 | Ga0068866_10154694 | Ga0068866_101546944 | 114 |
| 171 | 3300005718 | Ga0068866_11107131 | Ga0068866_111071311 | 114 |
| 172 | 3300005719 | Ga0068861_102489232 | Ga0068861_1024892322 | 114 |
| 173 | 3300005840 | Ga0068870_10407150 | Ga0068870_104071502 | 114 |
| 174 | 3300005841 | Ga0068863_100833450 | Ga0068863_1008334502 | 114 |
| 175 | 3300005841 | Ga0068863_101187839 | Ga0068863_1011878392 | 114 |
| 176 | 3300005842 | Ga0068858_100013304 | Ga0068858_10001330414 | 114 |
| 177 | 3300005843 | Ga0068860_100070792 | Ga0068860_1000707925 | 114 |
| 178 | 3300005843 | Ga0068860_101015154 | Ga0068860_1010151542 | 114 |
| 179 | 3300005844 | Ga0068862_100582629 | Ga0068862_1005826292 | 114 |
| 180 | 3300005937 | Ga0081455_10013977 | Ga0081455_1001397712 | 114 |
| 181 | 3300005937 | Ga0081455_10050580 | Ga0081455_100505805 | 114 |
| 182 | 3300006028 | Ga0070717_10138672 | Ga0070717_101386725 | 114 |
| 183 | 3300006058 | Ga0075432_10001059 | Ga0075432_1000105912 | 114 |
| 184 | 3300006058 | Ga0075432_10160294 | Ga0075432_101602942 | 114 |
| 185 | 3300006163 | Ga0070715_10355246 | Ga0070715_103552462 | 114 |
| 186 | 3300006173 | Ga0070716_100152367 | Ga0070716_1001523673 | 114 |
| 187 | 3300006237 | Ga0097621_100171613 | Ga0097621_1001716132 | 114 |
| 188 | 3300006358 | Ga0068871_100976339 | Ga0068871_1009763392 | 114 |
| 189 | 3300006844 | Ga0075428_100006916 | Ga0075428_1000069166 | 114 |
| 190 | 3300006846 | Ga0075430_100066743 | Ga0075430_1000667435 | 114 |
| 191 | 3300006847 | Ga0075431_100004224 | Ga0075431_10000422417 | 114 |
| 192 | 3300006847 | Ga0075431_100630402 | Ga0075431_1006304022 | 114 |
| 193 | 3300006847 | Ga0075431_102026320 | Ga0075431_1020263202 | 114 |
| 194 | 3300006847 | Ga0075431_102135584 | Ga0075431_1021355842 | 114 |
| 195 | 3300006852 | Ga0075433_10061868 | Ga0075433_100618685 | 114 |
| 196 | 3300006880 | Ga0075429_100011161 | Ga0075429_1000111615 | 114 |
| 197 | 3300006880 | Ga0075429_100122353 | Ga0075429_1001223532 | 114 |
| 198 | 3300006880 | Ga0075429_101533607 | Ga0075429_1015336072 | 114 |
| 199 | 3300006880 | Ga0075429_101809631 | Ga0075429_1018096312 | 114 |
| 200 | 3300006881 | Ga0068865_100024285 | Ga0068865_1000242853 | 114 |
| 201 | 3300006881 | Ga0068865_100152686 | Ga0068865_1001526864 | 114 |
| 202 | 3300006881 | Ga0068865_100393351 | Ga0068865_1003933513 | 114 |
| 203 | 3300006881 | Ga0068865_100472529 | Ga0068865_1004725292 | 114 |
| 204 | 3300006881 | Ga0068865_101107660 | Ga0068865_1011076602 | 114 |
| 205 | 3300006914 | Ga0075436_100183706 | Ga0075436_1001837062 | 114 |
| 206 | 3300006914 | Ga0075436_100482832 | Ga0075436_1004828322 | 114 |
| 207 | 3300006931 | Ga0097620_100206294 | Ga0097620_1002062942 | 114 |
| 208 | 3300006931 | Ga0097620_100493310 | Ga0097620_1004933102 | 114 |
| 209 | 3300009093 | Ga0105240_11088820 | Ga0105240_110888202 | 114 |
| 210 | 3300009093 | Ga0105240_11738300 | Ga0105240_117383002 | 114 |
| 211 | 3300009094 | Ga0111539_10065262 | Ga0111539_100652625 | 114 |
| 212 | 3300009094 | Ga0111539_10589261 | Ga0111539_105892613 | 114 |
| 213 | 3300009098 | Ga0105245_10106734 | Ga0105245_101067346 | 114 |
| 214 | 3300009098 | Ga0105245_10272234 | Ga0105245_102722343 | 114 |
| 215 | 3300009098 | Ga0105245_10370677 | Ga0105245_103706772 | 114 |
| 216 | 3300009098 | Ga0105245_10925057 | Ga0105245_109250572 | 114 |
| 217 | 3300009147 | Ga0114129_10104282 | Ga0114129_101042825 | 114 |
| 218 | 3300009147 | Ga0114129_10211509 | Ga0114129_102115092 | 114 |
| 219 | 3300009148 | Ga0105243_10015204 | Ga0105243_1001520411 | 114 |
| 220 | 3300009148 | Ga0105243_10223874 | Ga0105243_102238742 | 114 |
| 221 | 3300009148 | Ga0105243_11260850 | Ga0105243_112608502 | 114 |
| 222 | 3300009176 | Ga0105242_10004657 | Ga0105242_1000465712 | 114 |
| 223 | 3300009176 | Ga0105242_10183321 | Ga0105242_101833212 | 114 |
| 224 | 3300009176 | Ga0105242_10470528 | Ga0105242_104705282 | 114 |
| 225 | 3300009176 | Ga0105242_10984704 | Ga0105242_109847042 | 114 |
| 226 | 3300009177 | Ga0105248_10175727 | Ga0105248_101757273 | 114 |
| 227 | 3300009177 | Ga0105248_10211049 | Ga0105248_102110494 | 114 |
| 228 | 3300009551 | Ga0105238_10547473 | Ga0105238_105474732 | 114 |
| 229 | 3300009551 | Ga0105238_11416863 | Ga0105238_114168632 | 114 |
| 230 | 3300009553 | Ga0105249_10198350 | Ga0105249_101983504 | 114 |
| 231 | 3300009553 | Ga0105249_10302551 | Ga0105249_103025512 | 114 |
| 232 | 3300009553 | Ga0105249_10735901 | Ga0105249_107359012 | 114 |
| 233 | 3300010375 | Ga0105239_10048544 | Ga0105239_100485446 | 114 |
| 234 | 3300010375 | Ga0105239_11067271 | Ga0105239_110672712 | 114 |
| 235 | 3300011119 | Ga0105246_10485846 | Ga0105246_104858462 | 114 |
| 236 | 3300011119 | Ga0105246_10534281 | Ga0105246_105342812 | 114 |
| 237 | 3300012498 | Ga0157345_1011949 | Ga0157345_10119491 | 114 |
| 238 | 3300013105 | Ga0157369_12331324 | Ga0157369_123313242 | 114 |
| 239 | 3300013296 | Ga0157374_10281061 | Ga0157374_102810611 | 114 |
| 240 | 3300013296 | Ga0157374_12136394 | Ga0157374_121363942 | 114 |
| 241 | 3300013297 | Ga0157378_10014133 | Ga0157378_100141337 | 114 |
| 242 | 3300013307 | Ga0157372_10412731 | Ga0157372_104127312 | 114 |
| 243 | 3300013307 | Ga0157372_11131611 | Ga0157372_111316112 | 114 |
| 244 | 3300013308 | Ga0157375_10076560 | Ga0157375_100765608 | 114 |
| 245 | 3300013308 | Ga0157375_10442969 | Ga0157375_104429692 | 114 |
| 246 | 3300013308 | Ga0157375_10673481 | Ga0157375_106734812 | 114 |
| 247 | 3300014325 | Ga0163163_10160843 | Ga0163163_101608432 | 114 |
| 248 | 3300014325 | Ga0163163_11207070 | Ga0163163_112070702 | 114 |
| 249 | 3300014325 | Ga0163163_11445795 | Ga0163163_114457952 | 114 |
| 250 | 3300014326 | Ga0157380_10037399 | Ga0157380_100373993 | 114 |
| 251 | 3300014326 | Ga0157380_11059926 | Ga0157380_110599261 | 114 |
| 252 | 3300014326 | Ga0157380_13347550 | Ga0157380_133475502 | 114 |
| 253 | 3300014745 | Ga0157377_11536149 | Ga0157377_115361492 | 114 |
| 254 | 3300014968 | Ga0157379_10047939 | Ga0157379_100479393 | 114 |
| 255 | 3300014968 | Ga0157379_10075804 | Ga0157379_100758044 | 114 |
| 256 | 3300014968 | Ga0157379_12315490 | Ga0157379_123154901 | 114 |
| 257 | 3300014969 | Ga0157376_10082369 | Ga0157376_100823692 | 114 |
| 258 | 3300014969 | Ga0157376_10189630 | Ga0157376_101896302 | 114 |
| 259 | 3300014969 | Ga0157376_11297569 | Ga0157376_112975691 | 114 |
| 260 | 3300017792 | Ga0163161_10192074 | Ga0163161_101920744 | 114 |
| 261 | 3300017792 | Ga0163161_10410596 | Ga0163161_104105962 | 114 |
| 262 | 3300020069 | Ga0197907_11393950 | Ga0197907_113939502 | 114 |
| 263 | 3300020075 | Ga0206349_1009212 | Ga0206349_10092122 | 114 |
| 264 | 3300020078 | Ga0206352_10211361 | Ga0206352_102113612 | 114 |
| 265 | 3300020081 | Ga0206354_10092926 | Ga0206354_100929261 | 114 |
| 266 | 3300021384 | Ga0213876_10204198 | Ga0213876_102041982 | 114 |
| 267 | 3300021384 | Ga0213876_10432658 | Ga0213876_104326582 | 114 |
| 268 | 3300021384 | Ga0213876_10569760 | Ga0213876_105697602 | 114 |
| 269 | 3300021388 | Ga0213875_10040297 | Ga0213875_100402975 | 114 |
| 270 | 3300025271 | Ga0207666_1002632 | Ga0207666_10026322 | 114 |
| 271 | 3300025315 | Ga0207697_10152268 | Ga0207697_101522682 | 114 |
| 272 | 3300025899 | Ga0207642_10026787 | Ga0207642_100267873 | 114 |
| 273 | 3300025900 | Ga0207710_10515411 | Ga0207710_105154111 | 114 |
| 274 | 3300025901 | Ga0207688_10437116 | Ga0207688_104371162 | 114 |
| 275 | 3300025907 | Ga0207645_10122945 | Ga0207645_101229452 | 114 |
| 276 | 3300025907 | Ga0207645_10159449 | Ga0207645_101594493 | 114 |
| 277 | 3300025908 | Ga0207643_10382390 | Ga0207643_103823902 | 114 |
| 278 | 3300025908 | Ga0207643_10632535 | Ga0207643_106325352 | 114 |
| 279 | 3300025909 | Ga0207705_11196101 | Ga0207705_111961012 | 114 |
| 280 | 3300025911 | Ga0207654_10055781 | Ga0207654_100557813 | 114 |
| 281 | 3300025912 | Ga0207707_10020646 | Ga0207707_100206462 | 114 |
| 282 | 3300025912 | Ga0207707_10332626 | Ga0207707_103326262 | 114 |
| 283 | 3300025913 | Ga0207695_11252532 | Ga0207695_112525322 | 114 |
| 284 | 3300025917 | Ga0207660_10077102 | Ga0207660_100771022 | 114 |
| 285 | 3300025917 | Ga0207660_10209038 | Ga0207660_102090384 | 114 |
| 286 | 3300025917 | Ga0207660_11059476 | Ga0207660_110594762 | 114 |
| 287 | 3300025918 | Ga0207662_10007284 | Ga0207662_1000728410 | 114 |
| 288 | 3300025918 | Ga0207662_10082054 | Ga0207662_100820542 | 114 |
| 289 | 3300025919 | Ga0207657_10032320 | Ga0207657_1003232010 | 114 |
| 290 | 3300025919 | Ga0207657_10067330 | Ga0207657_100673302 | 114 |
| 291 | 3300025919 | Ga0207657_10832545 | Ga0207657_108325451 | 114 |
| 292 | 3300025919 | Ga0207657_11006248 | Ga0207657_110062482 | 114 |
| 293 | 3300025920 | Ga0207649_10395737 | Ga0207649_103957372 | 114 |
| 294 | 3300025920 | Ga0207649_10542095 | Ga0207649_105420952 | 114 |
| 295 | 3300025921 | Ga0207652_10022071 | Ga0207652_100220719 | 114 |
| 296 | 3300025921 | Ga0207652_10941441 | Ga0207652_109414412 | 114 |
| 297 | 3300025923 | Ga0207681_10810273 | Ga0207681_108102731 | 114 |
| 298 | 3300025924 | Ga0207694_10177800 | Ga0207694_101778002 | 114 |
| 299 | 3300025926 | Ga0207659_10746571 | Ga0207659_107465712 | 114 |
| 300 | 3300025927 | Ga0207687_10054197 | Ga0207687_100541974 | 114 |
| 301 | 3300025927 | Ga0207687_10294726 | Ga0207687_102947262 | 114 |
| 302 | 3300025927 | Ga0207687_10452310 | Ga0207687_104523102 | 114 |
| 303 | 3300025927 | Ga0207687_10723154 | Ga0207687_107231542 | 114 |
| 304 | 3300025927 | Ga0207687_10734047 | Ga0207687_107340472 | 114 |
| 305 | 3300025927 | Ga0207687_11429344 | Ga0207687_114293442 | 114 |
| 306 | 3300025929 | Ga0207664_10003706 | Ga0207664_1000370615 | 114 |
| 307 | 3300025931 | Ga0207644_10554400 | Ga0207644_105544002 | 114 |
| 308 | 3300025932 | Ga0207690_10255835 | Ga0207690_102558352 | 114 |
| 309 | 3300025932 | Ga0207690_10919683 | Ga0207690_109196832 | 114 |
| 310 | 3300025933 | Ga0207706_10083036 | Ga0207706_100830362 | 114 |
| 311 | 3300025933 | Ga0207706_10230165 | Ga0207706_102301652 | 114 |
| 312 | 3300025934 | Ga0207686_10425012 | Ga0207686_104250122 | 114 |
| 313 | 3300025934 | Ga0207686_11105406 | Ga0207686_111054062 | 114 |
| 314 | 3300025935 | Ga0207709_10006045 | Ga0207709_100060457 | 114 |
| 315 | 3300025935 | Ga0207709_10031452 | Ga0207709_100314525 | 114 |
| 316 | 3300025935 | Ga0207709_10088841 | Ga0207709_100888412 | 114 |
| 317 | 3300025936 | Ga0207670_11203691 | Ga0207670_112036912 | 114 |
| 318 | 3300025937 | Ga0207669_10052680 | Ga0207669_100526804 | 114 |
| 319 | 3300025937 | Ga0207669_10417499 | Ga0207669_104174992 | 114 |
| 320 | 3300025938 | Ga0207704_10159217 | Ga0207704_101592173 | 114 |
| 321 | 3300025938 | Ga0207704_10401882 | Ga0207704_104018822 | 114 |
| 322 | 3300025938 | Ga0207704_11850255 | Ga0207704_118502551 | 114 |
| 323 | 3300025940 | Ga0207691_10132342 | Ga0207691_101323422 | 114 |
| 324 | 3300025940 | Ga0207691_10877032 | Ga0207691_108770321 | 114 |
| 325 | 3300025941 | Ga0207711_10498852 | Ga0207711_104988522 | 114 |
| 326 | 3300025941 | Ga0207711_10764462 | Ga0207711_107644622 | 114 |
| 327 | 3300025942 | Ga0207689_10563148 | Ga0207689_105631482 | 114 |
| 328 | 3300025942 | Ga0207689_10856882 | Ga0207689_108568822 | 114 |
| 329 | 3300025944 | Ga0207661_10007134 | Ga0207661_1000713413 | 114 |
| 330 | 3300025944 | Ga0207661_10241790 | Ga0207661_102417903 | 114 |
| 331 | 3300025944 | Ga0207661_11247530 | Ga0207661_112475302 | 114 |
| 332 | 3300025945 | Ga0207679_10518934 | Ga0207679_105189342 | 114 |
| 333 | 3300025945 | Ga0207679_10609477 | Ga0207679_106094772 | 114 |
| 334 | 3300025945 | Ga0207679_11825537 | Ga0207679_118255372 | 114 |
| 335 | 3300025960 | Ga0207651_10528727 | Ga0207651_105287272 | 114 |
| 336 | 3300025961 | Ga0207712_10137427 | Ga0207712_101374275 | 114 |
| 337 | 3300025961 | Ga0207712_10714360 | Ga0207712_107143602 | 114 |
| 338 | 3300025972 | Ga0207668_10345582 | Ga0207668_103455822 | 114 |
| 339 | 3300025981 | Ga0207640_10407980 | Ga0207640_104079802 | 114 |
| 340 | 3300025981 | Ga0207640_11095752 | Ga0207640_110957522 | 114 |
| 341 | 3300025981 | Ga0207640_12147336 | Ga0207640_121473362 | 114 |
| 342 | 3300025986 | Ga0207658_11178024 | Ga0207658_111780242 | 114 |
| 343 | 3300025986 | Ga0207658_12195442 | Ga0207658_121954422 | 114 |
| 344 | 3300026023 | Ga0207677_10275788 | Ga0207677_102757883 | 114 |
| 345 | 3300026035 | Ga0207703_10044345 | Ga0207703_100443452 | 114 |
| 346 | 3300026035 | Ga0207703_10186900 | Ga0207703_101869003 | 114 |
| 347 | 3300026041 | Ga0207639_10084823 | Ga0207639_100848234 | 114 |
| 348 | 3300026067 | Ga0207678_10108230 | Ga0207678_101082302 | 114 |
| 349 | 3300026067 | Ga0207678_10544552 | Ga0207678_105445522 | 114 |
| 350 | 3300026067 | Ga0207678_10898448 | Ga0207678_108984482 | 114 |
| 351 | 3300026075 | Ga0207708_10039177 | Ga0207708_100391776 | 114 |
| 352 | 3300026075 | Ga0207708_11215171 | Ga0207708_112151712 | 114 |
| 353 | 3300026078 | Ga0207702_10109504 | Ga0207702_101095045 | 114 |
| 354 | 3300026088 | Ga0207641_10215750 | Ga0207641_102157504 | 114 |
| 355 | 3300026088 | Ga0207641_10953959 | Ga0207641_109539592 | 114 |
| 356 | 3300026089 | Ga0207648_10002304 | Ga0207648_100023049 | 114 |
| 357 | 3300026095 | Ga0207676_10055322 | Ga0207676_100553225 | 114 |
| 358 | 3300026095 | Ga0207676_10402209 | Ga0207676_104022093 | 114 |
| 359 | 3300026095 | Ga0207676_10592449 | Ga0207676_105924492 | 114 |
| 360 | 3300026095 | Ga0207676_10778748 | Ga0207676_107787482 | 114 |
| 361 | 3300026116 | Ga0207674_11287266 | Ga0207674_112872662 | 114 |
| 362 | 3300026118 | Ga0207675_100013791 | Ga0207675_1000137918 | 114 |
| 363 | 3300026118 | Ga0207675_100341998 | Ga0207675_1003419982 | 114 |
| 364 | 3300026118 | Ga0207675_101510298 | Ga0207675_1015102982 | 114 |
| 365 | 3300026121 | Ga0207683_10055593 | Ga0207683_100555935 | 114 |
| 366 | 3300026121 | Ga0207683_10064538 | Ga0207683_100645384 | 114 |
| 367 | 3300026121 | Ga0207683_10117210 | Ga0207683_101172105 | 114 |
| 368 | 3300026121 | Ga0207683_10348139 | Ga0207683_103481392 | 114 |
| 369 | 3300026142 | Ga0207698_10111228 | Ga0207698_101112282 | 114 |
| 370 | 3300026142 | Ga0207698_11347927 | Ga0207698_113479272 | 114 |
| 371 | 3300027907 | Ga0207428_10000181 | Ga0207428_1000018183 | 114 |
| 372 | 3300027907 | Ga0207428_10019256 | Ga0207428_100192565 | 114 |
| 373 | 3300027907 | Ga0207428_10376334 | Ga0207428_103763342 | 114 |
| 374 | 3300028379 | Ga0268266_10283614 | Ga0268266_102836142 | 114 |
| 375 | 3300028379 | Ga0268266_11438426 | Ga0268266_114384262 | 114 |
| 376 | 3300028379 | Ga0268266_12257481 | Ga0268266_122574811 | 114 |
| 377 | 3300028380 | Ga0268265_10577377 | Ga0268265_105773772 | 114 |
| 378 | 3300028381 | Ga0268264_10070742 | Ga0268264_100707424 | 114 |
| 379 | 3300028381 | Ga0268264_11266214 | Ga0268264_112662142 | 114 |
| 380 | 3300031238 | Ga0265332_10123344 | Ga0265332_101233442 | 114 |
| 381 | 3300031712 | Ga0265342_10012141 | Ga0265342_100121417 | 114 |
| 382 | 3300031731 | Ga0307405_12012937 | Ga0307405_120129372 | 114 |
| 383 | 3300032168 | Ga0316593_10164191 | Ga0316593_101641912 | 114 |
| 384 | 3300034819 | Ga0373958_0140919 | Ga0373958_0140919_222_566 | 114 |
| 385 | 3300035092 | Ga0373952_0079765 | Ga0373952_0079765_163_507 | 114 |
| 386 | 3300035114 | Ga0373939_0127791 | Ga0373939_0127791_200_568 | 114 |
| 387 | 3300035121 | Ga0373960_0045682 | Ga0373960_0045682_144_488 | 114 |
| 388 | 3300037312 | Ga0395899_0183732 | Ga0395899_0183732_282_638 | 114 |
| 389 | 3300037466 | Ga0395898_0000942 | Ga0395898_0000942_1093_1446 | 114 |
| 390 | 3300037853 | Ga0436364_0932459 | Ga0436364_0932459_1815_2168 | 114 |
| 391 | 3300039437 | Ga0436365_0757678 | Ga0436365_0757678_1467_1820 | 114 |
| 392 | 3300039437 | Ga0436365_1678207 | Ga0436365_1678207_530_883 | 114 |
| 393 | 3300039437 | Ga0436365_1830572 | Ga0436365_1830572_735_1103 | 114 |
| 394 | 3300039453 | Ga0436362_1029262 | Ga0436362_1029262_261_614 | 114 |
| 395 | 3300041463 | Ga0451804_0241165 | Ga0451804_0241165_112_465 | 114 |
| 396 | 3300041486 | Ga0451807_1334824 | Ga0451807_1334824_93_437 | 114 |
| 397 | 3300041492 | Ga0451835_0318087 | Ga0451835_0318087_457_810 | 114 |
| 398 | 3300041496 | Ga0451839_1658697 | Ga0451839_1658697_51_440 | 114 |
| 399 | 3300041498 | Ga0451841_0613115 | Ga0451841_0613115_171_524 | 114 |
| 400 | 3300042122 | Ga0450920_003850 | Ga0450920_003850_904_1254 | 114 |
| 401 | 3300042157 | Ga0439458_0041336 | Ga0439458_0041336_359_709 | 114 |
| 402 | 3300042531 | Ga0450918_026981 | Ga0450918_026981_57_413 | 114 |
| 403 | 3300042876 | Ga0451577_0007199 | Ga0451577_0007199_4329_4697 | 114 |
| 404 | 3300044683 | Ga0466965_0133553 | Ga0466965_0133553_525_878 | 114 |
| 405 | 3300044694 | Ga0466963_0783701 | Ga0466963_0783701_148_501 | 114 |
| 406 | 3300044706 | Ga0466964_0307397 | Ga0466964_0307397_324_680 | 114 |
| 407 | 3300044712 | Ga0453684_0017333 | Ga0453684_0017333_3807_4175 | 114 |
| 408 | 3300044765 | Ga0466970_0194938 | Ga0466970_0194938_747_1100 | 114 |
| 409 | 3300044842 | Ga0466957_0711270 | Ga0466957_0711270_204_557 | 114 |
| 410 | 3300044901 | Ga0466960_0200847 | Ga0466960_0200847_677_1030 | 114 |
| 411 | 3300044901 | Ga0466960_0698165 | Ga0466960_0698165_104_457 | 114 |
| 412 | 3300045976 | Ga0466967_0471141 | Ga0466967_0471141_114_464 | 114 |
| 413 | 3300045976 | Ga0466967_0866921 | Ga0466967_0866921_194_547 | 114 |
| 414 | 3300045976 | Ga0466967_0914713 | Ga0466967_0914713_200_556 | 114 |
| 415 | 3300045976 | Ga0466967_0986967 | Ga0466967_0986967_474_827 | 114 |
| 416 | 3300046463 | Ga0495653_0944590 | Ga0495653_0944590_131_499 | 114 |
| 417 | 3300046472 | Ga0495580_0998518 | Ga0495580_0998518_167_514 | 114 |
| 418 | 3300046474 | Ga0495605_0137316 | Ga0495605_0137316_197_547 | 114 |
| 419 | 3300046500 | Ga0495596_0159182 | Ga0495596_0159182_141_491 | 114 |
| 420 | 3300046513 | Ga0495616_0404018 | Ga0495616_0404018_119_469 | 114 |
| 421 | 3300046520 | Ga0495637_0067382 | Ga0495637_0067382_517_867 | 114 |
| 422 | 3300046523 | Ga0495644_0042316 | Ga0495644_0042316_105_455 | 114 |
| 423 | 3300046525 | Ga0495663_0065403 | Ga0495663_0065403_414_764 | 114 |
| 424 | 3300046530 | Ga0495654_0332888 | Ga0495654_0332888_140_490 | 114 |
| 425 | 3300046537 | Ga0495598_0117185 | Ga0495598_0117185_419_772 | 114 |
| 426 | 3300046615 | Ga0495656_0139414 | Ga0495656_0139414_355_708 | 114 |
| 427 | 3300046648 | Ga0495611_0103611 | Ga0495611_0103611_81_431 | 114 |
| 428 | 3300046664 | Ga0495659_0315146 | Ga0495659_0315146_77_442 | 114 |
| 429 | 3300046664 | Ga0495659_0325375 | Ga0495659_0325375_174_527 | 114 |
| 430 | 3300046794 | Ga0495589_0493667 | Ga0495589_0493667_15_368 | 114 |
| 431 | 3300047315 | Ga0495581_0627268 | Ga0495581_0627268_68_415 | 114 |
| 432 | 3300047318 | Ga0495636_0028454 | Ga0495636_0028454_1081_1446 | 114 |
| 433 | 3300047444 | Ga0495675_0534761 | Ga0495675_0534761_145_501 | 114 |
| 434 | 3300048088 | Ga0495602_0559276 | Ga0495602_0559276_370_726 | 114 |
| 435 | 3300048903 | Ga0496100_0486474 | Ga0496100_0486474_273_641 | 114 |
| 436 | 3300048904 | Ga0496101_0163659 | Ga0496101_0163659_570_938 | 114 |
| 437 | 3300048904 | Ga0496101_0556809 | Ga0496101_0556809_420_773 | 114 |
| 438 | 3300048905 | Ga0496102_0020994 | Ga0496102_0020994_1816_2169 | 114 |
| 439 | 3300048905 | Ga0496102_0093608 | Ga0496102_0093608_2321_2689 | 114 |
| 440 | 3300048905 | Ga0496102_0839515 | Ga0496102_0839515_311_664 | 114 |
| 441 | 3300048906 | Ga0496103_0067521 | Ga0496103_0067521_1338_1706 | 114 |
| 442 | 3300048907 | Ga0496104_0003461 | Ga0496104_0003461_12309_12677 | 114 |
| 443 | 3300048907 | Ga0496104_0066078 | Ga0496104_0066078_235_588 | 114 |
| 444 | 3300048908 | Ga0496105_0022153 | Ga0496105_0022153_4371_4739 | 114 |
| 445 | 3300048908 | Ga0496105_1250345 | Ga0496105_1250345_86_436 | 114 |
| 446 | 3300048908 | Ga0496105_1337927 | Ga0496105_1337927_40_393 | 114 |
| 447 | 3300048909 | Ga0496106_0005388 | Ga0496106_0005388_4465_4833 | 114 |
| 448 | 3300048909 | Ga0496106_0381361 | Ga0496106_0381361_14_367 | 114 |
| 449 | 3300048909 | Ga0496106_0787132 | Ga0496106_0787132_120_470 | 114 |
| 450 | 3300048909 | Ga0496106_1525884 | Ga0496106_1525884_112_480 | 114 |
| 451 | 3300048910 | Ga0496107_0014931 | Ga0496107_0014931_4880_5233 | 114 |
| 452 | 3300048910 | Ga0496107_0045026 | Ga0496107_0045026_937_1305 | 114 |
| 453 | 3300048911 | Ga0496108_0092552 | Ga0496108_0092552_842_1192 | 114 |
| 454 | 3300048911 | Ga0496108_0309845 | Ga0496108_0309845_196_564 | 114 |
| 455 | 3300048912 | Ga0496109_0087389 | Ga0496109_0087389_425_778 | 114 |
| 456 | 3300048912 | Ga0496109_0169897 | Ga0496109_0169897_1525_1893 | 114 |
| 457 | 3300048912 | Ga0496109_1639696 | Ga0496109_1639696_212_565 | 114 |
| 458 | 3300048913 | Ga0496110_0005006 | Ga0496110_0005006_9424_9792 | 114 |
| 459 | 3300048914 | Ga0496111_0103230 | Ga0496111_0103230_1199_1552 | 114 |
| 460 | 3300048914 | Ga0496111_0399740 | Ga0496111_0399740_530_898 | 114 |
| 461 | 3300048914 | Ga0496111_0465455 | Ga0496111_0465455_399_749 | 114 |
| 462 | 3300048915 | Ga0496112_1461625 | Ga0496112_1461625_35_388 | 114 |
| 463 | 3300048916 | Ga0496113_0180619 | Ga0496113_0180619_393_761 | 114 |
| 464 | 3300048916 | Ga0496113_0462684 | Ga0496113_0462684_623_976 | 114 |
| 465 | 3300048916 | Ga0496113_1480645 | Ga0496113_1480645_20_370 | 114 |
| 466 | 3300048917 | Ga0496114_0010104 | Ga0496114_0010104_564_917 | 114 |
| 467 | 3300048917 | Ga0496114_0038009 | Ga0496114_0038009_442_810 | 114 |
| 468 | 3300048917 | Ga0496114_0073477 | Ga0496114_0073477_1831_2181 | 114 |
| 469 | 3300048918 | Ga0496115_0044878 | Ga0496115_0044878_2782_3135 | 114 |
| 470 | 3300049568 | Ga0501031_0068501 | Ga0501031_0068501_1809_2153 | 114 |
| 471 | 3300049568 | Ga0501031_0209414 | Ga0501031_0209414_565_918 | 114 |
| 472 | 3300049568 | Ga0501031_0327609 | Ga0501031_0327609_421_774 | 114 |
| 473 | 3300049571 | Ga0501034_0203447 | Ga0501034_0203447_1469_1837 | 114 |
| 474 | 3300049572 | Ga0501036_0148825 | Ga0501036_0148825_1562_1906 | 114 |
| 475 | 3300049572 | Ga0501036_0296415 | Ga0501036_0296415_682_1035 | 114 |
| 476 | 3300049572 | Ga0501036_0704824 | Ga0501036_0704824_266_616 | 114 |
| 477 | 3300049573 | Ga0501037_0223419 | Ga0501037_0223419_849_1193 | 114 |
| 478 | 3300049573 | Ga0501037_0510216 | Ga0501037_0510216_259_612 | 114 |
| 479 | 3300049573 | Ga0501037_0620055 | Ga0501037_0620055_208_558 | 114 |
| 480 | 3300049574 | Ga0501038_0144467 | Ga0501038_0144467_117_461 | 114 |
| 481 | 3300049574 | Ga0501038_1181390 | Ga0501038_1181390_143_493 | 114 |
| 482 | 3300049575 | Ga0501039_0007709 | Ga0501039_0007709_2407_2751 | 114 |
| 483 | 3300049575 | Ga0501039_0115948 | Ga0501039_0115948_1051_1404 | 114 |
| 484 | 3300049575 | Ga0501039_1328554 | Ga0501039_1328554_16_369 | 114 |
| 485 | 3300049576 | Ga0501040_0025481 | Ga0501040_0025481_2030_2383 | 114 |
| 486 | 3300049576 | Ga0501040_0213523 | Ga0501040_0213523_616_969 | 114 |
| 487 | 3300049577 | Ga0501041_0067285 | Ga0501041_0067285_335_688 | 114 |
| 488 | 3300049577 | Ga0501041_0439854 | Ga0501041_0439854_167_511 | 114 |
| 489 | 3300049577 | Ga0501041_0759355 | Ga0501041_0759355_236_589 | 114 |
| 490 | 3300049578 | Ga0501042_0015136 | Ga0501042_0015136_3615_3959 | 114 |
| 491 | 3300049578 | Ga0501042_0118116 | Ga0501042_0118116_291_644 | 114 |
| 492 | 3300049578 | Ga0501042_0133118 | Ga0501042_0133118_1387_1740 | 114 |
| 493 | 3300049578 | Ga0501042_0170317 | Ga0501042_0170317_928_1281 | 114 |
| 494 | 3300049579 | Ga0501043_0217764 | Ga0501043_0217764_1056_1400 | 114 |
| 495 | 3300049579 | Ga0501043_0792996 | Ga0501043_0792996_305_658 | 114 |
| 496 | 3300049580 | Ga0501046_0057062 | Ga0501046_0057062_221_565 | 114 |
| 497 | 3300049581 | Ga0501047_1266265 | Ga0501047_1266265_17_361 | 114 |
| 498 | 3300049582 | Ga0501048_0015470 | Ga0501048_0015470_556_900 | 114 |
| 499 | 3300049582 | Ga0501048_0287913 | Ga0501048_0287913_522_875 | 114 |
| 500 | 3300049582 | Ga0501048_0367479 | Ga0501048_0367479_200_550 | 114 |
| 501 | 3300049583 | Ga0501067_0038670 | Ga0501067_0038670_1578_1943 | 114 |
| 502 | 3300049584 | Ga0501068_0029609 | Ga0501068_0029609_47_391 | 114 |
| 503 | 3300049584 | Ga0501068_0718064 | Ga0501068_0718064_230_583 | 114 |
| 504 | 3300049585 | Ga0501069_0036892 | Ga0501069_0036892_767_1111 | 114 |
| 505 | 3300049585 | Ga0501069_0795595 | Ga0501069_0795595_24_377 | 114 |
| 506 | 3300049586 | Ga0501070_0035611 | Ga0501070_0035611_2215_2559 | 114 |
| 507 | 3300049587 | Ga0501071_0001083 | Ga0501071_0001083_6130_6474 | 114 |
| 508 | 3300049587 | Ga0501071_1382492 | Ga0501071_1382492_96_449 | 114 |
| 509 | 3300049588 | Ga0501072_0016036 | Ga0501072_0016036_1093_1437 | 114 |
| 510 | 3300049588 | Ga0501072_0129945 | Ga0501072_0129945_301_654 | 114 |
| 511 | 3300049588 | Ga0501072_0525125 | Ga0501072_0525125_178_531 | 114 |
| 512 | 3300049588 | Ga0501072_0894644 | Ga0501072_0894644_37_390 | 114 |
| 513 | 3300049588 | Ga0501072_1605102 | Ga0501072_1605102_27_380 | 114 |
| 514 | 3300049590 | Ga0501074_0036342 | Ga0501074_0036342_126_470 | 114 |
| 515 | 3300049590 | Ga0501074_0197734 | Ga0501074_0197734_915_1268 | 114 |
| 516 | 3300049591 | Ga0501075_0003018 | Ga0501075_0003018_9412_9756 | 114 |
| 517 | 3300049591 | Ga0501075_0158531 | Ga0501075_0158531_451_804 | 114 |
| 518 | 3300049591 | Ga0501075_0313729 | Ga0501075_0313729_528_893 | 114 |
| 519 | 3300049591 | Ga0501075_0482020 | Ga0501075_0482020_555_908 | 114 |
| 520 | 3300049591 | Ga0501075_1068007 | Ga0501075_1068007_41_394 | 114 |
| 521 | 3300049592 | Ga0501076_0040146 | Ga0501076_0040146_522_866 | 114 |
| 522 | 3300049592 | Ga0501076_0222483 | Ga0501076_0222483_678_1031 | 114 |
| 523 | 3300049592 | Ga0501076_0521371 | Ga0501076_0521371_351_704 | 114 |
| 524 | 3300049593 | Ga0501077_0001393 | Ga0501077_0001393_5380_5724 | 114 |
| 525 | 3300049593 | Ga0501077_0695744 | Ga0501077_0695744_114_467 | 114 |
| 526 | 3300049593 | Ga0501077_0792664 | Ga0501077_0792664_132_485 | 114 |
| 527 | 3300049741 | Ga0501079_0008393 | Ga0501079_0008393_5517_5861 | 114 |
| 528 | 3300049741 | Ga0501079_0079813 | Ga0501079_0079813_1277_1630 | 114 |
| 529 | 3300049741 | Ga0501079_0312217 | Ga0501079_0312217_248_601 | 114 |
| 530 | 3300049741 | Ga0501079_0350482 | Ga0501079_0350482_208_573 | 114 |
| 531 | 3300049742 | Ga0501080_0048644 | Ga0501080_0048644_1864_2208 | 114 |
| 532 | 3300049743 | Ga0501081_0004393 | Ga0501081_0004393_1304_1648 | 114 |
| 533 | 3300049743 | Ga0501081_0681376 | Ga0501081_0681376_269_622 | 114 |
| 534 | 3300049744 | Ga0501083_0051083 | Ga0501083_0051083_2183_2527 | 114 |
| 535 | 3300049822 | Ga0501035_0174832 | Ga0501035_0174832_1299_1643 | 114 |
| 536 | 3300049822 | Ga0501035_0308733 | Ga0501035_0308733_697_1050 | 114 |
| 537 | 3300049823 | Ga0501044_1353658 | Ga0501044_1353658_23_367 | 114 |
| 538 | 3300049824 | Ga0501045_0010860 | Ga0501045_0010860_521_865 | 114 |
| 539 | 3300049824 | Ga0501045_0246640 | Ga0501045_0246640_313_666 | 114 |
| 540 | 3300049824 | Ga0501045_0524550 | Ga0501045_0524550_124_477 | 114 |
| 541 | 3300050507 | nmdc:mga05p37_47021_c1 | nmdc:mga05p37_47021_c1_1159_1512 | 114 |
| 542 | 3300050507 | nmdc:mga05p37_48463_c1 | nmdc:mga05p37_48463_c1_577_921 | 114 |
| 543 | 3300050508 | nmdc:mga09592_45593_c1 | nmdc:mga09592_45593_c1_770_1114 | 114 |
| 544 | 3300050508 | nmdc:mga09592_939353_c1 | nmdc:mga09592_939353_c1_345_698 | 114 |
| 545 | 3300050509 | nmdc:mga0qj67_27322_c1 | nmdc:mga0qj67_27322_c1_1795_2148 | 114 |
| 546 | 3300050510 | nmdc:mga06r32_153768_c1 | nmdc:mga06r32_153768_c1_1278_1622 | 114 |
| 547 | 3300050510 | nmdc:mga06r32_1653532_c1 | nmdc:mga06r32_1653532_c1_199_552 | 114 |
| 548 | 3300050511 | nmdc:mga08y16_125036_c1 | nmdc:mga08y16_125036_c1_371_715 | 114 |
| 549 | 3300050511 | nmdc:mga08y16_574024_c1 | nmdc:mga08y16_574024_c1_641_994 | 114 |
| 550 | 3300050511 | nmdc:mga08y16_583630_c1 | nmdc:mga08y16_583630_c1_519_869 | 114 |
| 551 | 3300050511 | nmdc:mga08y16_889200_c1 | nmdc:mga08y16_889200_c1_83_436 | 114 |
| 552 | 3300050512 | nmdc:mga0n895_439122_c1 | nmdc:mga0n895_439122_c1_509_862 | 114 |
| 553 | 3300050515 | nmdc:mga0a205_62900_c1 | nmdc:mga0a205_62900_c1_2192_2536 | 114 |
| 554 | 3300053085 | Ga0495619_0362824 | Ga0495619_0362824_415_762 | 114 |
| 555 | 3300054114 | Ga0501084_0005571 | Ga0501084_0005571_1145_1489 | 114 |
| 556 | 3300054114 | Ga0501084_0237792 | Ga0501084_0237792_1066_1419 | 114 |
| 557 | 3300054114 | Ga0501084_0442662 | Ga0501084_0442662_601_954 | 114 |
| 558 | 3300059623 | Ga0587101_018959 | Ga0587101_018959_410_778 | 114 |
| 559 | 3300060353 | Ga0501082_0021659 | Ga0501082_0021659_3679_4023 | 114 |
| 560 | 3300060353 | Ga0501082_0377070 | Ga0501082_0377070_274_627 | 114 |
| 561 | 3300060353 | Ga0501082_0399182 | Ga0501082_0399182_559_912 | 114 |
| 562 | 3300061719 | Ga0466962_0649515 | Ga0466962_0649515_69_422 | 114 |
| 563 | 3300061734 | Ga0530510_0032518 | Ga0530510_0032518_1216_1560 | 114 |
| 564 | 3300061734 | Ga0530510_0130624 | Ga0530510_0130624_588_941 | 114 |
| 565 | 3300061734 | Ga0530510_1439833 | Ga0530510_1439833_88_453 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4w2e-assembly1.cif.gz_S | crystal structure of elongation factor 4 (ef4/lepa) bound to the thermus thermophilus 70s ribosome | 0.9546 | 24 | 114 |
| 8fr8-assembly1.cif.gz_D | structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex | 0.9044 | 4 | 114 |
| 7mt3-assembly1.cif.gz_O | mtb 70s with p/e trna | 0.9017 | 4 | 114 |
| 4v9r-assembly2.cif.gz_DS | crystal structure of antibiotic dityromycin bound to 70s ribosome | 0.8917 | 9 | 114 |
| 1ily-assembly1.cif.gz_A | solution structure of ribosomal protein l18 of thermus thermophilus | 0.8909 | 24 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ddga01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9639 | 24 | 114 | 3.30.420.100 |
| 5zetP01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9639 | 17 | 114 | 3.30.420.100 |
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9568 | 17 | 114 | 3.30.420.100 |
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9464 | 17 | 114 | 3.30.420.100 |
| 4dhcS01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9364 | 24 | 114 | 3.30.420.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q4DH48-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.9836 | 37 | 114 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A1F5AYM9-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.9827 | 25 | 114 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0008097 GO:1990904 |
| AF-A0A2W6V789-F1-model_v4 | deleted | 0.9827 | 37 | 114 |
|
| AF-A0A3E0I9V5-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.982 | 28 | 114 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A1X6X9C5-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9809 | 18 | 114 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar