F464293

General Info

Members Datasets Scaffolds Average Seq Length
565 288 565 116

Family's Representative Sequence

Representative Sequence 3300041496|Ga0451839_1658697|Ga0451839_1658697_51_440
Length 129
Sequence VTATLLKRRNGGGASYKRAVGKARRHFRVRKNVRGSAERPRISVFRSNRGVFAQLIDDESGRTLAAVNWTEDDLKSLKRMEQASKAGQLLAERAKAAGVERAVFDRGGYQYHGRVKAFAEGVREGGLAV

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
168 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
178 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
179 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
192 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
193 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.9
Rhizosphere 90.8
Stem 0
Stem Tuber 0
Unclassified 2.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214788558 2209111006 Bacteria 740
2 Ga0070658_10135610 3300005327 Bacteria 2054
3 Ga0070676_10310769 3300005328 Bacteria 1071
4 Ga0070676_11546477 3300005328 Bacteria 512
5 Ga0070683_100026337 3300005329 Bacteria 5234
6 Ga0070683_100165138 3300005329 Bacteria 2100
7 Ga0070683_100268238 3300005329 Bacteria 1624
8 Ga0070683_100472928 3300005329 Bacteria 1197
9 Ga0070683_101094229 3300005329 Bacteria 765
10 Ga0070670_100033541 3300005331 Bacteria 4421
11 Ga0070680_100539340 3300005336 Bacteria 999
12 Ga0070680_100854024 3300005336 Bacteria 785
13 Ga0070682_100097996 3300005337 Bacteria 1930
14 Ga0070682_100226337 3300005337 Bacteria 1334
15 Ga0070682_100530400 3300005337 Bacteria 918
16 Ga0070682_101621493 3300005337 Bacteria 560
17 Ga0068868_100044025 3300005338 Bacteria 3488
18 Ga0068868_100165391 3300005338 Bacteria 1829
19 Ga0068868_100177485 3300005338 Bacteria 1766
20 Ga0068868_100328251 3300005338 Bacteria 1305
21 Ga0070660_100614225 3300005339 Bacteria 910
22 Ga0070660_100667768 3300005339 Bacteria 871
23 Ga0070660_101407188 3300005339 Bacteria 592
24 Ga0070689_100034533 3300005340 Bacteria 3858
25 Ga0070691_10046732 3300005341 Bacteria 2057
26 Ga0070691_10408502 3300005341 Bacteria 767
27 Ga0070661_101061817 3300005344 Bacteria 674
28 Ga0070692_10022707 3300005345 Bacteria 3067
29 Ga0070692_10340495 3300005345 Bacteria 929
30 Ga0070692_10533978 3300005345 Bacteria 766
31 Ga0070675_100926197 3300005354 Bacteria 799
32 Ga0070675_101676115 3300005354 Bacteria 587
33 Ga0070675_102168615 3300005354 Bacteria 512
34 Ga0070671_101097860 3300005355 Bacteria 699
35 Ga0070674_100030615 3300005356 Bacteria 3559
36 Ga0070674_100329595 3300005356 Bacteria 1226
37 Ga0070688_100323970 3300005365 Bacteria 1120
38 Ga0070688_100576041 3300005365 Bacteria 859
39 Ga0070688_100903581 3300005365 Bacteria 697
40 Ga0070659_100116007 3300005366 Bacteria 2165
41 Ga0070659_100502286 3300005366 Bacteria 1034
42 Ga0070659_101106061 3300005366 Bacteria 698
43 Ga0070667_101344892 3300005367 Bacteria 670
44 Ga0070667_101938106 3300005367 Bacteria 555
45 Ga0070714_100032487 3300005435 Bacteria 4356
46 Ga0070713_100076472 3300005436 Bacteria 2843
47 Ga0070713_102151749 3300005436 Bacteria 541
48 Ga0070701_10118602 3300005438 Bacteria 1488
49 Ga0070701_10422967 3300005438 Bacteria 849
50 Ga0070701_10578682 3300005438 Bacteria 741
51 Ga0070705_100174325 3300005440 Bacteria 1450
52 Ga0070705_101460579 3300005440 Bacteria 572
53 Ga0070700_100050208 3300005441 Bacteria 2593
54 Ga0070700_100212094 3300005441 Bacteria 1367
55 Ga0070700_100437796 3300005441 Bacteria 992
56 Ga0070700_100830494 3300005441 Bacteria 747
57 Ga0070694_100461334 3300005444 Bacteria 1005
58 Ga0070694_101330060 3300005444 Bacteria 605
59 Ga0070663_100093522 3300005455 Bacteria 2231
60 Ga0070678_100231512 3300005456 Bacteria 1541
61 Ga0070678_100249884 3300005456 Bacteria 1487
62 Ga0070678_100777902 3300005456 Bacteria 868
63 Ga0070678_100840850 3300005456 Bacteria 836
64 Ga0070662_100290847 3300005457 Bacteria 1325
65 Ga0070662_100727378 3300005457 Bacteria 841
66 Ga0070681_10028712 3300005458 Bacteria 5591
67 Ga0070681_11840570 3300005458 Bacteria 532
68 Ga0068867_100000479 3300005459 Bacteria 26567
69 Ga0068867_100266372 3300005459 Bacteria 1399
70 Ga0068867_100465074 3300005459 Bacteria 1081
71 Ga0068867_101470620 3300005459 Bacteria 634
72 Ga0070685_10016222 3300005466 Bacteria 3966
73 Ga0070685_10033786 3300005466 Bacteria 2877
74 Ga0070685_10632115 3300005466 Bacteria 774
75 Ga0070685_11522765 3300005466 Bacteria 516
76 Ga0070707_101234820 3300005468 Bacteria 713
77 Ga0070679_100337405 3300005530 Bacteria 1455
78 Ga0070679_100652922 3300005530 Bacteria 995
79 Ga0070684_100009592 3300005535 Bacteria 7629
80 Ga0070684_100073453 3300005535 Bacteria 3013
81 Ga0070684_100089974 3300005535 Bacteria 2728
82 Ga0070684_100175615 3300005535 Bacteria 1947
83 Ga0070684_100282563 3300005535 Bacteria 1520
84 Ga0070684_101325737 3300005535 Bacteria 677
85 Ga0068853_100214281 3300005539 Bacteria 1756
86 Ga0068853_101158939 3300005539 Bacteria 746
87 Ga0070672_101163351 3300005543 Bacteria 687
88 Ga0070672_101263576 3300005543 Bacteria 659
89 Ga0070686_100029765 3300005544 Bacteria 3325
90 Ga0070686_100987198 3300005544 Bacteria 690
91 Ga0070696_100805289 3300005546 Bacteria 773
92 Ga0070693_100008759 3300005547 Bacteria 5010
93 Ga0070693_100107157 3300005547 Bacteria 1712
94 Ga0070693_100683570 3300005547 Bacteria 750
95 Ga0070665_100260330 3300005548 Bacteria 1736
96 Ga0068855_100915327 3300005563 Bacteria 926
97 Ga0070664_100140035 3300005564 Bacteria 2130
98 Ga0070664_100619270 3300005564 Bacteria 1005
99 Ga0070664_101737282 3300005564 Bacteria 592
100 Ga0068857_101121497 3300005577 Bacteria 760
101 Ga0068857_102152194 3300005577 Bacteria 547
102 Ga0068854_101396687 3300005578 Bacteria 633
103 Ga0068854_101588781 3300005578 Bacteria 596
104 Ga0068856_100064277 3300005614 Bacteria 3626
105 Ga0070702_100341204 3300005615 Bacteria 1052
106 Ga0070702_100497382 3300005615 Bacteria 894
107 Ga0070702_100674749 3300005615 Bacteria 785
108 Ga0068852_100289255 3300005616 Bacteria 1582
109 Ga0068859_100206295 3300005617 Bacteria 2050
110 Ga0068859_100493347 3300005617 Bacteria 1320
111 Ga0068864_100068829 3300005618 Bacteria 3076
112 Ga0068864_100177399 3300005618 Bacteria 1946
113 Ga0068864_100652732 3300005618 Bacteria 1025
114 Ga0068864_102364994 3300005618 Bacteria 538
115 Ga0068866_10154694 3300005718 Bacteria 1332
116 Ga0068866_11107131 3300005718 Bacteria 568
117 Ga0068861_102489232 3300005719 Bacteria 521
118 Ga0068870_10407150 3300005840 Bacteria 887
119 Ga0068863_100833450 3300005841 Bacteria 921
120 Ga0068863_101187839 3300005841 Bacteria 769
121 Ga0068858_100013304 3300005842 Bacteria 7759
122 Ga0068860_100070792 3300005843 Bacteria 3316
123 Ga0068860_101015154 3300005843 Bacteria 848
124 Ga0068862_100582629 3300005844 Bacteria 1072
125 Ga0081455_10013977 3300005937 Bacteria 7890
126 Ga0081455_10050580 3300005937 Bacteria 3573
127 Ga0070717_10138672 3300006028 Bacteria 2096
128 Ga0075432_10001059 3300006058 Bacteria 8769
129 Ga0075432_10160294 3300006058 Bacteria 869
130 Ga0070715_10355246 3300006163 Bacteria 802
131 Ga0070716_100152367 3300006173 Bacteria 1489
132 Ga0070712_100700416 3300006175 Bacteria 863
133 Ga0097621_100171613 3300006237 Bacteria 1870
134 Ga0068871_100976339 3300006358 Bacteria 788
135 Ga0075428_100006916 3300006844 Bacteria 12599
136 Ga0075430_100066743 3300006846 Bacteria 3021
137 Ga0075431_100004224 3300006847 Bacteria 14071
138 Ga0075431_100630402 3300006847 Bacteria 1054
139 Ga0075431_102026320 3300006847 Bacteria 531
140 Ga0075431_102135584 3300006847 Bacteria 515
141 Ga0075433_10061868 3300006852 Bacteria 3279
142 Ga0075429_100011161 3300006880 Bacteria 7778
143 Ga0075429_100122353 3300006880 Bacteria 2275
144 Ga0075429_101533607 3300006880 Bacteria 579
145 Ga0075429_101809631 3300006880 Bacteria 530
146 Ga0068865_100024285 3300006881 Bacteria 3975
147 Ga0068865_100152686 3300006881 Bacteria 1753
148 Ga0068865_100393351 3300006881 Bacteria 1133
149 Ga0068865_100472529 3300006881 Bacteria 1040
150 Ga0068865_101107660 3300006881 Bacteria 698
151 Ga0075436_100183706 3300006914 Bacteria 1478
152 Ga0075436_100482832 3300006914 Bacteria 905
153 Ga0097620_100206294 3300006931 Bacteria 2050
154 Ga0097620_100493310 3300006931 Bacteria 1320
155 Ga0105240_11088820 3300009093 Bacteria 851
156 Ga0105240_11738300 3300009093 Bacteria 651
157 Ga0111539_10065262 3300009094 Bacteria 4302
158 Ga0111539_10589261 3300009094 Bacteria 1295
159 Ga0105245_10106734 3300009098 Bacteria 2599
160 Ga0105245_10272234 3300009098 Bacteria 1652
161 Ga0105245_10370677 3300009098 Bacteria 1423
162 Ga0105245_10925057 3300009098 Bacteria 914
163 Ga0114129_10104282 3300009147 Bacteria 3918
164 Ga0114129_10211509 3300009147 Bacteria 2621
165 Ga0105243_10015204 3300009148 Bacteria 5824
166 Ga0105243_10223874 3300009148 Bacteria 1665
167 Ga0105243_11260850 3300009148 Bacteria 755
168 Ga0105242_10004657 3300009176 Bacteria 10630
169 Ga0105242_10183321 3300009176 Bacteria 1848
170 Ga0105242_10470528 3300009176 Bacteria 1189
171 Ga0105242_10984704 3300009176 Bacteria 850
172 Ga0105248_10175727 3300009177 Bacteria 2413
173 Ga0105248_10211049 3300009177 Bacteria 2188
174 Ga0105238_10547473 3300009551 Bacteria 1161
175 Ga0105238_11416863 3300009551 Bacteria 722
176 Ga0105249_10198350 3300009553 Bacteria 1963
177 Ga0105249_10302551 3300009553 Bacteria 1605
178 Ga0105249_10735901 3300009553 Bacteria 1048
179 Ga0105239_10048544 3300010375 Bacteria 4655
180 Ga0105239_11067271 3300010375 Bacteria 929
181 Ga0105246_10485846 3300011119 Bacteria 1046
182 Ga0105246_10534281 3300011119 Bacteria 1002
183 Ga0157345_1011949 3300012498 Bacteria 778
184 Ga0157369_12331324 3300013105 Bacteria 542
185 Ga0157374_10281061 3300013296 Bacteria 1643
186 Ga0157374_12136394 3300013296 Bacteria 587
187 Ga0157378_10014133 3300013297 Bacteria 6986
188 Ga0157372_10412731 3300013307 Bacteria 1573
189 Ga0157372_11131611 3300013307 Bacteria 905
190 Ga0157375_10076560 3300013308 Bacteria 3373
191 Ga0157375_10442969 3300013308 Bacteria 1465
192 Ga0157375_10673481 3300013308 Bacteria 1189
193 Ga0163163_10160843 3300014325 Bacteria 2291
194 Ga0163163_11207070 3300014325 Bacteria 819
195 Ga0163163_11445795 3300014325 Bacteria 749
196 Ga0157380_10037399 3300014326 Bacteria 3761
197 Ga0157380_11059926 3300014326 Bacteria 847
198 Ga0157380_13347550 3300014326 Bacteria 513
199 Ga0157377_11536149 3300014745 Bacteria 531
200 Ga0157379_10047939 3300014968 Bacteria 3813
201 Ga0157379_10075804 3300014968 Bacteria 3012
202 Ga0157379_12315490 3300014968 Bacteria 535
203 Ga0157376_10082369 3300014969 Bacteria 2765
204 Ga0157376_10189630 3300014969 Bacteria 1884
205 Ga0157376_11297569 3300014969 Bacteria 758
206 Ga0163161_10192074 3300017792 Bacteria 1570
207 Ga0163161_10410596 3300017792 Bacteria 1087
208 Ga0197907_11393950 3300020069 Bacteria 2559
209 Ga0206349_1009212 3300020075 Bacteria 520
210 Ga0206352_10211361 3300020078 Bacteria 649
211 Ga0206350_11358413 3300020080 Bacteria 1101
212 Ga0206354_10092926 3300020081 Bacteria 609
213 Ga0213876_10204198 3300021384 Bacteria 1050
214 Ga0213876_10432658 3300021384 Bacteria 700
215 Ga0213876_10569760 3300021384 Bacteria 602
216 Ga0213875_10040297 3300021388 Bacteria 2199
217 Ga0207666_1002632 3300025271 Bacteria 2171
218 Ga0207697_10152268 3300025315 Bacteria 1007
219 Ga0207642_10026787 3300025899 Bacteria 2351
220 Ga0207710_10515411 3300025900 Bacteria 621
221 Ga0207688_10437116 3300025901 Bacteria 815
222 Ga0207645_10122945 3300025907 Bacteria 1686
223 Ga0207645_10159449 3300025907 Bacteria 1475
224 Ga0207643_10382390 3300025908 Bacteria 888
225 Ga0207643_10632535 3300025908 Bacteria 690
226 Ga0207705_11196101 3300025909 Bacteria 583
227 Ga0207654_10055781 3300025911 Bacteria 2289
228 Ga0207707_10020646 3300025912 Bacteria 5753
229 Ga0207707_10332626 3300025912 Bacteria 1310
230 Ga0207695_11252532 3300025913 Bacteria 622
231 Ga0207693_10579300 3300025915 Bacteria 874
232 Ga0207660_10077102 3300025917 Bacteria 2439
233 Ga0207660_10209038 3300025917 Bacteria 1527
234 Ga0207660_11059476 3300025917 Bacteria 661
235 Ga0207662_10007284 3300025918 Bacteria 6015
236 Ga0207662_10082054 3300025918 Bacteria 1969
237 Ga0207657_10032320 3300025919 Bacteria 4730
238 Ga0207657_10067330 3300025919 Bacteria 3045
239 Ga0207657_10832545 3300025919 Bacteria 712
240 Ga0207657_11006248 3300025919 Bacteria 639
241 Ga0207649_10395737 3300025920 Bacteria 1033
242 Ga0207649_10542095 3300025920 Bacteria 889
243 Ga0207652_10022071 3300025921 Bacteria 5262
244 Ga0207652_10941441 3300025921 Bacteria 761
245 Ga0207681_10810273 3300025923 Bacteria 782
246 Ga0207694_10177800 3300025924 Bacteria 1725
247 Ga0207659_10746571 3300025926 Bacteria 839
248 Ga0207687_10054197 3300025927 Bacteria 2804
249 Ga0207687_10294726 3300025927 Bacteria 1305
250 Ga0207687_10452310 3300025927 Bacteria 1065
251 Ga0207687_10723154 3300025927 Bacteria 846
252 Ga0207687_10734047 3300025927 Bacteria 840
253 Ga0207687_11429344 3300025927 Bacteria 594
254 Ga0207664_10003706 3300025929 Bacteria 10244
255 Ga0207644_10554400 3300025931 Bacteria 952
256 Ga0207690_10255835 3300025932 Bacteria 1355
257 Ga0207690_10919683 3300025932 Bacteria 726
258 Ga0207706_10083036 3300025933 Bacteria 2816
259 Ga0207706_10230165 3300025933 Bacteria 1622
260 Ga0207686_10425012 3300025934 Bacteria 1017
261 Ga0207686_11105406 3300025934 Bacteria 646
262 Ga0207709_10006045 3300025935 Bacteria 6820
263 Ga0207709_10031452 3300025935 Bacteria 3100
264 Ga0207709_10088841 3300025935 Bacteria 2013
265 Ga0207670_11203691 3300025936 Bacteria 641
266 Ga0207669_10052680 3300025937 Bacteria 2446
267 Ga0207669_10417499 3300025937 Bacteria 1055
268 Ga0207704_10159217 3300025938 Bacteria 1604
269 Ga0207704_10401882 3300025938 Bacteria 1081
270 Ga0207704_11850255 3300025938 Bacteria 519
271 Ga0207691_10132342 3300025940 Bacteria 2202
272 Ga0207691_10877032 3300025940 Bacteria 752
273 Ga0207711_10498852 3300025941 Bacteria 1134
274 Ga0207711_10764462 3300025941 Bacteria 900
275 Ga0207689_10563148 3300025942 Bacteria 957
276 Ga0207689_10856882 3300025942 Bacteria 767
277 Ga0207661_10007134 3300025944 Bacteria 7939
278 Ga0207661_10241790 3300025944 Bacteria 1602
279 Ga0207661_11247530 3300025944 Bacteria 683
280 Ga0207679_10518934 3300025945 Bacteria 1065
281 Ga0207679_10609477 3300025945 Bacteria 985
282 Ga0207679_11825537 3300025945 Bacteria 555
283 Ga0207651_10528727 3300025960 Bacteria 1023
284 Ga0207712_10137427 3300025961 Bacteria 1871
285 Ga0207712_10714360 3300025961 Bacteria 875
286 Ga0207668_10345582 3300025972 Bacteria 1242
287 Ga0207640_10407980 3300025981 Bacteria 1108
288 Ga0207640_11095752 3300025981 Bacteria 704
289 Ga0207640_12147336 3300025981 Bacteria 507
290 Ga0207658_11178024 3300025986 Bacteria 700
291 Ga0207658_12195442 3300025986 Bacteria 501
292 Ga0207677_10275788 3300026023 Bacteria 1378
293 Ga0207703_10044345 3300026035 Bacteria 3574
294 Ga0207703_10186900 3300026035 Bacteria 1832
295 Ga0207639_10084823 3300026041 Bacteria 2517
296 Ga0207678_10108230 3300026067 Bacteria 2371
297 Ga0207678_10544552 3300026067 Bacteria 1015
298 Ga0207678_10898448 3300026067 Bacteria 783
299 Ga0207708_10039177 3300026075 Bacteria 3610
300 Ga0207708_11215171 3300026075 Bacteria 659
301 Ga0207702_10109504 3300026078 Bacteria 2453
302 Ga0207641_10215750 3300026088 Bacteria 1777
303 Ga0207641_10953959 3300026088 Bacteria 853
304 Ga0207648_10002304 3300026089 Bacteria 20620
305 Ga0207676_10055322 3300026095 Bacteria 3115
306 Ga0207676_10402209 3300026095 Bacteria 1280
307 Ga0207676_10592449 3300026095 Bacteria 1064
308 Ga0207676_10778748 3300026095 Bacteria 932
309 Ga0207674_11287266 3300026116 Bacteria 701
310 Ga0207675_100013791 3300026118 Bacteria 7538
311 Ga0207675_100341998 3300026118 Bacteria 1465
312 Ga0207675_101510298 3300026118 Bacteria 692
313 Ga0207683_10055593 3300026121 Bacteria 3471
314 Ga0207683_10064538 3300026121 Bacteria 3227
315 Ga0207683_10117210 3300026121 Bacteria 2388
316 Ga0207683_10348139 3300026121 Bacteria 1360
317 Ga0207698_10111228 3300026142 Bacteria 2296
318 Ga0207698_11347927 3300026142 Bacteria 728
319 Ga0207428_10000181 3300027907 Bacteria 88299
320 Ga0207428_10019256 3300027907 Bacteria 5820
321 Ga0207428_10376334 3300027907 Bacteria 1042
322 Ga0268266_10283614 3300028379 Bacteria 1541
323 Ga0268266_11438426 3300028379 Bacteria 665
324 Ga0268266_12257481 3300028379 Bacteria 516
325 Ga0268265_10577377 3300028380 Bacteria 1071
326 Ga0268264_10070742 3300028381 Bacteria 2954
327 Ga0268264_11266214 3300028381 Bacteria 747
328 Ga0265332_10123344 3300031238 Bacteria 1088
329 Ga0265342_10012141 3300031712 Bacteria 5843
330 Ga0307405_12012937 3300031731 Bacteria 517
331 Ga0307413_11992312 3300031824 Unclassified 523
332 Ga0307407_11326529 3300031903 Bacteria 565
333 Ga0307409_102209356 3300031995 Bacteria 580
334 Ga0316593_10164191 3300032168 Unclassified 812
335 Ga0373958_0140919 3300034819 Bacteria 597
336 Ga0373952_0079765 3300035092 Bacteria 833
337 Ga0373939_0127791 3300035114 Bacteria 904
338 Ga0373960_0045682 3300035121 Bacteria 1283
339 Ga0395899_0183732 3300037312 Bacteria 1466
340 Ga0395900_0328361 3300037418 Bacteria 1508
341 Ga0395898_0000942 3300037466 Bacteria 46333
342 Ga0395898_0151036 3300037466 Bacteria 2222
343 Ga0436364_0932459 3300037853 Bacteria 3637
344 Ga0436365_0690359 3300039437 Bacteria 678
345 Ga0436365_0757678 3300039437 Bacteria 2752
346 Ga0436365_1678207 3300039437 Bacteria 1904
347 Ga0436365_1830572 3300039437 Bacteria 1452
348 Ga0436362_1029262 3300039453 Bacteria 1506
349 Ga0439436_0140355 3300041404 Bacteria 679
350 Ga0439439_0003464 3300041406 Bacteria 3480
351 Ga0439453_0055595 3300041408 Bacteria 809
352 Ga0439461_0002477 3300041410 Bacteria 2953
353 Ga0451804_0241165 3300041463 Bacteria 527
354 Ga0451807_1334824 3300041486 Bacteria 1297
355 Ga0451835_0318087 3300041492 Bacteria 1166
356 Ga0451839_1326170 3300041496 Bacteria 646
357 Ga0451839_1658697 3300041496 Bacteria 587
358 Ga0451841_0613115 3300041498 Bacteria 549
359 Ga0439431_0011116 3300041997 Bacteria 2052
360 Ga0439433_0006891 3300041999 Bacteria 2450
361 Ga0439442_037613 3300042002 Bacteria 1014
362 Ga0439445_0046164 3300042004 Bacteria 1167
363 Ga0439449_0102347 3300042007 Bacteria 1059
364 Ga0439456_080017 3300042013 Bacteria 729
365 Ga0450920_003850 3300042122 Bacteria 2614
366 Ga0450923_053382 3300042125 Bacteria 872
367 Ga0439446_0046474 3300042156 Bacteria 1289
368 Ga0439458_0041336 3300042157 Bacteria 1120
369 Ga0439434_0002488 3300042435 Bacteria 5364
370 Ga0439435_0269919 3300042436 Bacteria 577
371 Ga0450918_026981 3300042531 Bacteria 1009
372 Ga0451577_0007199 3300042876 Bacteria 10963
373 Ga0466965_0133553 3300044683 Bacteria 1288
374 Ga0466961_0271816 3300044693 Bacteria 1038
375 Ga0466961_0941297 3300044693 Bacteria 514
376 Ga0466963_0259870 3300044694 Bacteria 1219
377 Ga0466963_0300229 3300044694 Bacteria 1129
378 Ga0466963_0783701 3300044694 Bacteria 672
379 Ga0466964_0307397 3300044706 Bacteria 801
380 Ga0453684_0017333 3300044712 Bacteria 11163
381 Ga0466968_0009436 3300044735 Bacteria 3752
382 Ga0466970_0140951 3300044765 Bacteria 1328
383 Ga0466970_0194938 3300044765 Bacteria 1126
384 Ga0466957_0711270 3300044842 Bacteria 709
385 Ga0466960_0200847 3300044901 Bacteria 1089
386 Ga0466960_0698165 3300044901 Bacteria 608
387 Ga0466959_0009134 3300045049 Bacteria 7040
388 Ga0466958_0018199 3300045836 Bacteria 4073
389 Ga0466967_0005406 3300045976 Bacteria 8846
390 Ga0466967_0471141 3300045976 Bacteria 1229
391 Ga0466967_0866921 3300045976 Bacteria 897
392 Ga0466967_0914713 3300045976 Bacteria 873
393 Ga0466967_0986967 3300045976 Bacteria 838
394 Ga0495653_0944590 3300046463 Bacteria 512
395 Ga0495580_0998518 3300046472 Bacteria 534
396 Ga0495605_0137316 3300046474 Bacteria 1099
397 Ga0495596_0159182 3300046500 Bacteria 877
398 Ga0495616_0404018 3300046513 Bacteria 561
399 Ga0495637_0067382 3300046520 Bacteria 1453
400 Ga0495644_0042316 3300046523 Bacteria 1715
401 Ga0495663_0065403 3300046525 Bacteria 1149
402 Ga0495654_0332888 3300046530 Bacteria 614
403 Ga0495598_0117185 3300046537 Bacteria 899
404 Ga0495656_0139414 3300046615 Bacteria 1162
405 Ga0495611_0103611 3300046648 Bacteria 1323
406 Ga0495659_0315146 3300046664 Bacteria 663
407 Ga0495659_0325375 3300046664 Bacteria 653
408 Ga0495589_0493667 3300046794 Bacteria 559
409 Ga0495581_0627268 3300047315 Bacteria 622
410 Ga0495636_0028454 3300047318 Bacteria 2280
411 Ga0495675_0534761 3300047444 Bacteria 670
412 Ga0495602_0559276 3300048088 Bacteria 792
413 Ga0496100_0486474 3300048903 Bacteria 949
414 Ga0496101_0163659 3300048904 Bacteria 1707
415 Ga0496101_0556809 3300048904 Bacteria 907
416 Ga0496102_0020994 3300048905 Bacteria 5774
417 Ga0496102_0093608 3300048905 Bacteria 2784
418 Ga0496102_0839515 3300048905 Bacteria 841
419 Ga0496103_0067521 3300048906 Bacteria 2233
420 Ga0496104_0003461 3300048907 Bacteria 13603
421 Ga0496104_0066078 3300048907 Bacteria 3433
422 Ga0496105_0022153 3300048908 Bacteria 5146
423 Ga0496105_1250345 3300048908 Bacteria 544
424 Ga0496105_1337927 3300048908 Bacteria 521
425 Ga0496106_0005388 3300048909 Bacteria 9463
426 Ga0496106_0381361 3300048909 Bacteria 1133
427 Ga0496106_0787132 3300048909 Bacteria 755
428 Ga0496106_1525884 3300048909 Bacteria 513
429 Ga0496107_0014931 3300048910 Bacteria 5439
430 Ga0496107_0045026 3300048910 Bacteria 3173
431 Ga0496108_0092552 3300048911 Bacteria 2571
432 Ga0496108_0309845 3300048911 Bacteria 1376
433 Ga0496109_0087389 3300048912 Bacteria 2880
434 Ga0496109_0169897 3300048912 Bacteria 2045
435 Ga0496109_1639696 3300048912 Bacteria 577
436 Ga0496110_0005006 3300048913 Bacteria 10353
437 Ga0496111_0103230 3300048914 Bacteria 2096
438 Ga0496111_0399740 3300048914 Bacteria 1015
439 Ga0496111_0465455 3300048914 Bacteria 932
440 Ga0496112_1084166 3300048915 Bacteria 719
441 Ga0496112_1461625 3300048915 Bacteria 598
442 Ga0496113_0180619 3300048916 Bacteria 1673
443 Ga0496113_0462684 3300048916 Bacteria 1019
444 Ga0496113_1480645 3300048916 Bacteria 524
445 Ga0496114_0010104 3300048917 Bacteria 7507
446 Ga0496114_0038009 3300048917 Bacteria 3982
447 Ga0496114_0073477 3300048917 Bacteria 2878
448 Ga0496114_0851047 3300048917 Bacteria 792
449 Ga0496115_0044878 3300048918 Bacteria 3527
450 Ga0501031_0068501 3300049568 Bacteria 2312
451 Ga0501031_0209414 3300049568 Bacteria 1271
452 Ga0501031_0327609 3300049568 Bacteria 992
453 Ga0501034_0203447 3300049571 Bacteria 1937
454 Ga0501036_0148825 3300049572 Bacteria 1975
455 Ga0501036_0296415 3300049572 Bacteria 1353
456 Ga0501036_0704824 3300049572 Bacteria 834
457 Ga0501036_1039229 3300049572 Bacteria 670
458 Ga0501037_0223419 3300049573 Bacteria 1324
459 Ga0501037_0510216 3300049573 Bacteria 815
460 Ga0501037_0620055 3300049573 Bacteria 725
461 Ga0501038_0144467 3300049574 Bacteria 1943
462 Ga0501038_1181390 3300049574 Bacteria 556
463 Ga0501039_0007709 3300049575 Bacteria 8218
464 Ga0501039_0115948 3300049575 Bacteria 2097
465 Ga0501039_0174244 3300049575 Bacteria 1692
466 Ga0501039_1328554 3300049575 Bacteria 554
467 Ga0501040_0025481 3300049576 Bacteria 3976
468 Ga0501040_0187522 3300049576 Bacteria 1467
469 Ga0501040_0213523 3300049576 Bacteria 1372
470 Ga0501041_0067285 3300049577 Bacteria 2196
471 Ga0501041_0439854 3300049577 Bacteria 827
472 Ga0501041_0759355 3300049577 Bacteria 621
473 Ga0501041_0761458 3300049577 Bacteria 620
474 Ga0501042_0015136 3300049578 Bacteria 5275
475 Ga0501042_0118116 3300049578 Bacteria 1909
476 Ga0501042_0133118 3300049578 Bacteria 1792
477 Ga0501042_0170317 3300049578 Bacteria 1571
478 Ga0501042_0210924 3300049578 Bacteria 1401
479 Ga0501043_0217764 3300049579 Bacteria 1478
480 Ga0501043_0792996 3300049579 Bacteria 686
481 Ga0501046_0057062 3300049580 Bacteria 3064
482 Ga0501046_0521761 3300049580 Bacteria 849
483 Ga0501047_1266265 3300049581 Bacteria 551
484 Ga0501048_0015470 3300049582 Bacteria 5636
485 Ga0501048_0287913 3300049582 Bacteria 1168
486 Ga0501048_0367479 3300049582 Bacteria 1027
487 Ga0501067_0038670 3300049583 Bacteria 2649
488 Ga0501068_0029609 3300049584 Bacteria 3243
489 Ga0501068_0718064 3300049584 Bacteria 654
490 Ga0501069_0036892 3300049585 Bacteria 2697
491 Ga0501069_0795595 3300049585 Bacteria 573
492 Ga0501070_0035611 3300049586 Bacteria 4159
493 Ga0501071_0001083 3300049587 Bacteria 15121
494 Ga0501071_0556278 3300049587 Bacteria 881
495 Ga0501071_1382492 3300049587 Bacteria 544
496 Ga0501072_0016036 3300049588 Bacteria 5745
497 Ga0501072_0129945 3300049588 Bacteria 2007
498 Ga0501072_0366310 3300049588 Bacteria 1144
499 Ga0501072_0525125 3300049588 Bacteria 936
500 Ga0501072_0894644 3300049588 Bacteria 694
501 Ga0501072_1605102 3300049588 Bacteria 501
502 Ga0501074_0036342 3300049590 Bacteria 3568
503 Ga0501074_0197734 3300049590 Bacteria 1433
504 Ga0501074_0611332 3300049590 Bacteria 771
505 Ga0501075_0003018 3300049591 Bacteria 11243
506 Ga0501075_0158531 3300049591 Bacteria 1726
507 Ga0501075_0313729 3300049591 Bacteria 1195
508 Ga0501075_0482020 3300049591 Bacteria 946
509 Ga0501075_0726025 3300049591 Bacteria 756
510 Ga0501075_1068007 3300049591 Bacteria 613
511 Ga0501076_0040146 3300049592 Bacteria 3676
512 Ga0501076_0222483 3300049592 Bacteria 1542
513 Ga0501076_0521371 3300049592 Bacteria 980
514 Ga0501076_0529542 3300049592 Bacteria 971
515 Ga0501077_0001393 3300049593 Bacteria 14562
516 Ga0501077_0695744 3300049593 Bacteria 653
517 Ga0501077_0792664 3300049593 Bacteria 609
518 Ga0501079_0008393 3300049741 Bacteria 7829
519 Ga0501079_0079813 3300049741 Bacteria 2530
520 Ga0501079_0312217 3300049741 Bacteria 1230
521 Ga0501079_0350482 3300049741 Bacteria 1157
522 Ga0501079_0704837 3300049741 Bacteria 795
523 Ga0501080_0048644 3300049742 Bacteria 3946
524 Ga0501081_0004393 3300049743 Bacteria 9040
525 Ga0501081_0323816 3300049743 Bacteria 1133
526 Ga0501081_0681376 3300049743 Bacteria 771
527 Ga0501083_0051083 3300049744 Bacteria 2781
528 Ga0501035_0174832 3300049822 Bacteria 1853
529 Ga0501035_0308733 3300049822 Bacteria 1331
530 Ga0501035_0594967 3300049822 Bacteria 902
531 Ga0501044_1353658 3300049823 Bacteria 578
532 Ga0501045_0010860 3300049824 Bacteria 6381
533 Ga0501045_0111188 3300049824 Bacteria 2031
534 Ga0501045_0246640 3300049824 Bacteria 1329
535 Ga0501045_0524550 3300049824 Bacteria 879
536 nmdc:mga05p37_47021_c1 3300050507 Bacteria 5307
537 nmdc:mga05p37_48463_c1 3300050507 Bacteria 5225
538 nmdc:mga09592_45593_c1 3300050508 Bacteria 3693
539 nmdc:mga09592_939353_c1 3300050508 Bacteria 725
540 nmdc:mga0qj67_27322_c1 3300050509 Bacteria 4422
541 nmdc:mga06r32_153768_c1 3300050510 Bacteria 2280
542 nmdc:mga06r32_1653532_c1 3300050510 Bacteria 578
543 nmdc:mga08y16_125036_c1 3300050511 Bacteria 2676
544 nmdc:mga08y16_574024_c1 3300050511 Bacteria 1139
545 nmdc:mga08y16_583630_c1 3300050511 Bacteria 1128
546 nmdc:mga08y16_889200_c1 3300050511 Bacteria 878
547 nmdc:mga0n895_439122_c1 3300050512 Bacteria 1318
548 nmdc:mga0a205_62900_c1 3300050515 Bacteria 3585
549 Ga0495619_0362824 3300053085 Bacteria 1002
550 Ga0501084_0005571 3300054114 Bacteria 10338
551 Ga0501084_0237792 3300054114 Bacteria 1537
552 Ga0501084_0429719 3300054114 Bacteria 1116
553 Ga0501084_0442662 3300054114 Bacteria 1098
554 Ga0501084_1094273 3300054114 Bacteria 669
555 Ga0587101_018959 3300059623 Bacteria 970
556 Ga0501082_0021659 3300060353 Bacteria 5541
557 Ga0501082_0377070 3300060353 Bacteria 1238
558 Ga0501082_0399182 3300060353 Bacteria 1200
559 Ga0501082_0593535 3300060353 Bacteria 969
560 Ga0466962_0026051 3300061719 Bacteria 2808
561 Ga0466962_0649515 3300061719 Bacteria 539
562 Ga0530510_0032518 3300061734 Bacteria 3754
563 Ga0530510_0130624 3300061734 Bacteria 1848
564 Ga0530510_0309865 3300061734 Bacteria 1182
565 Ga0530510_1439833 3300061734 Unclassified 529

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_11992312 Ga0307413_119923121 93
2 3300006175 Ga0070712_100700416 Ga0070712_1007004162 101
3 3300025915 Ga0207693_10579300 Ga0207693_105793002 101
4 3300031903 Ga0307407_11326529 Ga0307407_113265292 101
5 3300041404 Ga0439436_0140355 Ga0439436_0140355_305_658 101
6 3300041406 Ga0439439_0003464 Ga0439439_0003464_3059_3412 101
7 3300041410 Ga0439461_0002477 Ga0439461_0002477_2526_2879 101
8 3300041997 Ga0439431_0011116 Ga0439431_0011116_662_1015 101
9 3300041999 Ga0439433_0006891 Ga0439433_0006891_520_873 101
10 3300042002 Ga0439442_037613 Ga0439442_037613_430_783 101
11 3300042004 Ga0439445_0046164 Ga0439445_0046164_772_1125 101
12 3300042007 Ga0439449_0102347 Ga0439449_0102347_295_648 101
13 3300042125 Ga0450923_053382 Ga0450923_053382_126_479 101
14 3300042156 Ga0439446_0046474 Ga0439446_0046474_582_935 101
15 3300042435 Ga0439434_0002488 Ga0439434_0002488_4562_4915 101
16 3300048915 Ga0496112_1084166 Ga0496112_1084166_122_430 101
17 3300031995 Ga0307409_102209356 Ga0307409_1022093562 102
18 3300041408 Ga0439453_0055595 Ga0439453_0055595_213_566 102
19 3300041496 Ga0451839_1326170 Ga0451839_1326170_22_339 102
20 3300042013 Ga0439456_080017 Ga0439456_080017_225_578 102
21 3300049572 Ga0501036_1039229 Ga0501036_1039229_72_425 102
22 3300049575 Ga0501039_0174244 Ga0501039_0174244_1243_1596 102
23 3300049576 Ga0501040_0187522 Ga0501040_0187522_656_1009 102
24 3300049577 Ga0501041_0761458 Ga0501041_0761458_256_609 102
25 3300049578 Ga0501042_0210924 Ga0501042_0210924_577_930 102
26 3300049580 Ga0501046_0521761 Ga0501046_0521761_475_828 102
27 3300049587 Ga0501071_0556278 Ga0501071_0556278_482_835 102
28 3300049588 Ga0501072_0366310 Ga0501072_0366310_663_1016 102
29 3300049590 Ga0501074_0611332 Ga0501074_0611332_382_735 102
30 3300049591 Ga0501075_0726025 Ga0501075_0726025_20_373 102
31 3300049592 Ga0501076_0529542 Ga0501076_0529542_437_790 102
32 3300049741 Ga0501079_0704837 Ga0501079_0704837_267_620 102
33 3300049743 Ga0501081_0323816 Ga0501081_0323816_459_812 102
34 3300049822 Ga0501035_0594967 Ga0501035_0594967_421_774 102
35 3300049824 Ga0501045_0111188 Ga0501045_0111188_219_572 102
36 3300054114 Ga0501084_0429719 Ga0501084_0429719_544_897 102
37 3300054114 Ga0501084_1094273 Ga0501084_1094273_280_633 102
38 3300060353 Ga0501082_0593535 Ga0501082_0593535_202_555 102
39 3300061734 Ga0530510_0309865 Ga0530510_0309865_150_503 102
40 3300042436 Ga0439435_0269919 Ga0439435_0269919_80_403 104
41 3300048917 Ga0496114_0851047 Ga0496114_0851047_179_547 105
42 3300044693 Ga0466961_0271816 Ga0466961_0271816_522_875 106
43 3300044693 Ga0466961_0941297 Ga0466961_0941297_40_393 106
44 3300044694 Ga0466963_0300229 Ga0466963_0300229_450_803 106
45 3300044735 Ga0466968_0009436 Ga0466968_0009436_2864_3217 106
46 3300044765 Ga0466970_0140951 Ga0466970_0140951_17_370 106
47 3300045049 Ga0466959_0009134 Ga0466959_0009134_187_540 106
48 3300045836 Ga0466958_0018199 Ga0466958_0018199_3000_3353 106
49 3300061719 Ga0466962_0026051 Ga0466962_0026051_652_1005 106
50 3300020080 Ga0206350_11358413 Ga0206350_113584133 107
51 3300037418 Ga0395900_0328361 Ga0395900_0328361_443_796 107
52 3300037466 Ga0395898_0151036 Ga0395898_0151036_1679_2032 107
53 3300039437 Ga0436365_0690359 Ga0436365_0690359_278_631 107
54 3300044694 Ga0466963_0259870 Ga0466963_0259870_400_753 108
55 3300045976 Ga0466967_0005406 Ga0466967_0005406_472_825 108
56 2209111006 2214788558 2213813822 114
57 3300005327 Ga0070658_10135610 Ga0070658_101356102 114
58 3300005328 Ga0070676_10310769 Ga0070676_103107692 114
59 3300005328 Ga0070676_11546477 Ga0070676_115464772 114
60 3300005329 Ga0070683_100026337 Ga0070683_1000263371 114
61 3300005329 Ga0070683_100165138 Ga0070683_1001651383 114
62 3300005329 Ga0070683_100268238 Ga0070683_1002682383 114
63 3300005329 Ga0070683_100472928 Ga0070683_1004729282 114
64 3300005329 Ga0070683_101094229 Ga0070683_1010942292 114
65 3300005331 Ga0070670_100033541 Ga0070670_1000335416 114
66 3300005336 Ga0070680_100539340 Ga0070680_1005393402 114
67 3300005336 Ga0070680_100854024 Ga0070680_1008540241 114
68 3300005337 Ga0070682_100097996 Ga0070682_1000979961 114
69 3300005337 Ga0070682_100226337 Ga0070682_1002263371 114
70 3300005337 Ga0070682_100530400 Ga0070682_1005304002 114
71 3300005337 Ga0070682_101621493 Ga0070682_1016214931 114
72 3300005338 Ga0068868_100044025 Ga0068868_1000440253 114
73 3300005338 Ga0068868_100165391 Ga0068868_1001653913 114
74 3300005338 Ga0068868_100177485 Ga0068868_1001774854 114
75 3300005338 Ga0068868_100328251 Ga0068868_1003282513 114
76 3300005339 Ga0070660_100614225 Ga0070660_1006142252 114
77 3300005339 Ga0070660_100667768 Ga0070660_1006677681 114
78 3300005339 Ga0070660_101407188 Ga0070660_1014071881 114
79 3300005340 Ga0070689_100034533 Ga0070689_1000345338 114
80 3300005341 Ga0070691_10046732 Ga0070691_100467324 114
81 3300005341 Ga0070691_10408502 Ga0070691_104085021 114
82 3300005344 Ga0070661_101061817 Ga0070661_1010618171 114
83 3300005345 Ga0070692_10022707 Ga0070692_100227072 114
84 3300005345 Ga0070692_10340495 Ga0070692_103404951 114
85 3300005345 Ga0070692_10533978 Ga0070692_105339782 114
86 3300005354 Ga0070675_100926197 Ga0070675_1009261971 114
87 3300005354 Ga0070675_101676115 Ga0070675_1016761151 114
88 3300005354 Ga0070675_102168615 Ga0070675_1021686151 114
89 3300005355 Ga0070671_101097860 Ga0070671_1010978602 114
90 3300005356 Ga0070674_100030615 Ga0070674_1000306155 114
91 3300005356 Ga0070674_100329595 Ga0070674_1003295952 114
92 3300005365 Ga0070688_100323970 Ga0070688_1003239702 114
93 3300005365 Ga0070688_100576041 Ga0070688_1005760412 114
94 3300005365 Ga0070688_100903581 Ga0070688_1009035812 114
95 3300005366 Ga0070659_100116007 Ga0070659_1001160072 114
96 3300005366 Ga0070659_100502286 Ga0070659_1005022862 114
97 3300005366 Ga0070659_101106061 Ga0070659_1011060612 114
98 3300005367 Ga0070667_101344892 Ga0070667_1013448922 114
99 3300005367 Ga0070667_101938106 Ga0070667_1019381061 114
100 3300005435 Ga0070714_100032487 Ga0070714_1000324875 114
101 3300005436 Ga0070713_100076472 Ga0070713_1000764724 114
102 3300005436 Ga0070713_102151749 Ga0070713_1021517491 114
103 3300005438 Ga0070701_10118602 Ga0070701_101186022 114
104 3300005438 Ga0070701_10422967 Ga0070701_104229672 114
105 3300005438 Ga0070701_10578682 Ga0070701_105786822 114
106 3300005440 Ga0070705_100174325 Ga0070705_1001743252 114
107 3300005440 Ga0070705_101460579 Ga0070705_1014605791 114
108 3300005441 Ga0070700_100050208 Ga0070700_1000502082 114
109 3300005441 Ga0070700_100212094 Ga0070700_1002120944 114
110 3300005441 Ga0070700_100437796 Ga0070700_1004377962 114
111 3300005441 Ga0070700_100830494 Ga0070700_1008304942 114
112 3300005444 Ga0070694_100461334 Ga0070694_1004613341 114
113 3300005444 Ga0070694_101330060 Ga0070694_1013300602 114
114 3300005455 Ga0070663_100093522 Ga0070663_1000935221 114
115 3300005456 Ga0070678_100231512 Ga0070678_1002315123 114
116 3300005456 Ga0070678_100249884 Ga0070678_1002498842 114
117 3300005456 Ga0070678_100777902 Ga0070678_1007779022 114
118 3300005456 Ga0070678_100840850 Ga0070678_1008408502 114
119 3300005457 Ga0070662_100290847 Ga0070662_1002908472 114
120 3300005457 Ga0070662_100727378 Ga0070662_1007273782 114
121 3300005458 Ga0070681_10028712 Ga0070681_1002871210 114
122 3300005458 Ga0070681_11840570 Ga0070681_118405701 114
123 3300005459 Ga0068867_100000479 Ga0068867_10000047929 114
124 3300005459 Ga0068867_100266372 Ga0068867_1002663722 114
125 3300005459 Ga0068867_100465074 Ga0068867_1004650742 114
126 3300005459 Ga0068867_101470620 Ga0068867_1014706201 114
127 3300005466 Ga0070685_10016222 Ga0070685_100162228 114
128 3300005466 Ga0070685_10033786 Ga0070685_100337862 114
129 3300005466 Ga0070685_10632115 Ga0070685_106321151 114
130 3300005466 Ga0070685_11522765 Ga0070685_115227652 114
131 3300005468 Ga0070707_101234820 Ga0070707_1012348202 114
132 3300005530 Ga0070679_100337405 Ga0070679_1003374052 114
133 3300005530 Ga0070679_100652922 Ga0070679_1006529222 114
134 3300005535 Ga0070684_100009592 Ga0070684_10000959212 114
135 3300005535 Ga0070684_100073453 Ga0070684_1000734536 114
136 3300005535 Ga0070684_100089974 Ga0070684_1000899747 114
137 3300005535 Ga0070684_100175615 Ga0070684_1001756152 114
138 3300005535 Ga0070684_100282563 Ga0070684_1002825632 114
139 3300005535 Ga0070684_101325737 Ga0070684_1013257371 114
140 3300005539 Ga0068853_100214281 Ga0068853_1002142813 114
141 3300005539 Ga0068853_101158939 Ga0068853_1011589391 114
142 3300005543 Ga0070672_101163351 Ga0070672_1011633512 114
143 3300005543 Ga0070672_101263576 Ga0070672_1012635762 114
144 3300005544 Ga0070686_100029765 Ga0070686_1000297652 114
145 3300005544 Ga0070686_100987198 Ga0070686_1009871982 114
146 3300005546 Ga0070696_100805289 Ga0070696_1008052892 114
147 3300005547 Ga0070693_100008759 Ga0070693_1000087597 114
148 3300005547 Ga0070693_100107157 Ga0070693_1001071573 114
149 3300005547 Ga0070693_100683570 Ga0070693_1006835702 114
150 3300005548 Ga0070665_100260330 Ga0070665_1002603302 114
151 3300005563 Ga0068855_100915327 Ga0068855_1009153272 114
152 3300005564 Ga0070664_100140035 Ga0070664_1001400351 114
153 3300005564 Ga0070664_100619270 Ga0070664_1006192702 114
154 3300005564 Ga0070664_101737282 Ga0070664_1017372822 114
155 3300005577 Ga0068857_101121497 Ga0068857_1011214972 114
156 3300005577 Ga0068857_102152194 Ga0068857_1021521942 114
157 3300005578 Ga0068854_101396687 Ga0068854_1013966872 114
158 3300005578 Ga0068854_101588781 Ga0068854_1015887812 114
159 3300005614 Ga0068856_100064277 Ga0068856_1000642776 114
160 3300005615 Ga0070702_100341204 Ga0070702_1003412042 114
161 3300005615 Ga0070702_100497382 Ga0070702_1004973822 114
162 3300005615 Ga0070702_100674749 Ga0070702_1006747491 114
163 3300005616 Ga0068852_100289255 Ga0068852_1002892552 114
164 3300005617 Ga0068859_100206295 Ga0068859_1002062954 114
165 3300005617 Ga0068859_100493347 Ga0068859_1004933472 114
166 3300005618 Ga0068864_100068829 Ga0068864_1000688292 114
167 3300005618 Ga0068864_100177399 Ga0068864_1001773992 114
168 3300005618 Ga0068864_100652732 Ga0068864_1006527322 114
169 3300005618 Ga0068864_102364994 Ga0068864_1023649941 114
170 3300005718 Ga0068866_10154694 Ga0068866_101546944 114
171 3300005718 Ga0068866_11107131 Ga0068866_111071311 114
172 3300005719 Ga0068861_102489232 Ga0068861_1024892322 114
173 3300005840 Ga0068870_10407150 Ga0068870_104071502 114
174 3300005841 Ga0068863_100833450 Ga0068863_1008334502 114
175 3300005841 Ga0068863_101187839 Ga0068863_1011878392 114
176 3300005842 Ga0068858_100013304 Ga0068858_10001330414 114
177 3300005843 Ga0068860_100070792 Ga0068860_1000707925 114
178 3300005843 Ga0068860_101015154 Ga0068860_1010151542 114
179 3300005844 Ga0068862_100582629 Ga0068862_1005826292 114
180 3300005937 Ga0081455_10013977 Ga0081455_1001397712 114
181 3300005937 Ga0081455_10050580 Ga0081455_100505805 114
182 3300006028 Ga0070717_10138672 Ga0070717_101386725 114
183 3300006058 Ga0075432_10001059 Ga0075432_1000105912 114
184 3300006058 Ga0075432_10160294 Ga0075432_101602942 114
185 3300006163 Ga0070715_10355246 Ga0070715_103552462 114
186 3300006173 Ga0070716_100152367 Ga0070716_1001523673 114
187 3300006237 Ga0097621_100171613 Ga0097621_1001716132 114
188 3300006358 Ga0068871_100976339 Ga0068871_1009763392 114
189 3300006844 Ga0075428_100006916 Ga0075428_1000069166 114
190 3300006846 Ga0075430_100066743 Ga0075430_1000667435 114
191 3300006847 Ga0075431_100004224 Ga0075431_10000422417 114
192 3300006847 Ga0075431_100630402 Ga0075431_1006304022 114
193 3300006847 Ga0075431_102026320 Ga0075431_1020263202 114
194 3300006847 Ga0075431_102135584 Ga0075431_1021355842 114
195 3300006852 Ga0075433_10061868 Ga0075433_100618685 114
196 3300006880 Ga0075429_100011161 Ga0075429_1000111615 114
197 3300006880 Ga0075429_100122353 Ga0075429_1001223532 114
198 3300006880 Ga0075429_101533607 Ga0075429_1015336072 114
199 3300006880 Ga0075429_101809631 Ga0075429_1018096312 114
200 3300006881 Ga0068865_100024285 Ga0068865_1000242853 114
201 3300006881 Ga0068865_100152686 Ga0068865_1001526864 114
202 3300006881 Ga0068865_100393351 Ga0068865_1003933513 114
203 3300006881 Ga0068865_100472529 Ga0068865_1004725292 114
204 3300006881 Ga0068865_101107660 Ga0068865_1011076602 114
205 3300006914 Ga0075436_100183706 Ga0075436_1001837062 114
206 3300006914 Ga0075436_100482832 Ga0075436_1004828322 114
207 3300006931 Ga0097620_100206294 Ga0097620_1002062942 114
208 3300006931 Ga0097620_100493310 Ga0097620_1004933102 114
209 3300009093 Ga0105240_11088820 Ga0105240_110888202 114
210 3300009093 Ga0105240_11738300 Ga0105240_117383002 114
211 3300009094 Ga0111539_10065262 Ga0111539_100652625 114
212 3300009094 Ga0111539_10589261 Ga0111539_105892613 114
213 3300009098 Ga0105245_10106734 Ga0105245_101067346 114
214 3300009098 Ga0105245_10272234 Ga0105245_102722343 114
215 3300009098 Ga0105245_10370677 Ga0105245_103706772 114
216 3300009098 Ga0105245_10925057 Ga0105245_109250572 114
217 3300009147 Ga0114129_10104282 Ga0114129_101042825 114
218 3300009147 Ga0114129_10211509 Ga0114129_102115092 114
219 3300009148 Ga0105243_10015204 Ga0105243_1001520411 114
220 3300009148 Ga0105243_10223874 Ga0105243_102238742 114
221 3300009148 Ga0105243_11260850 Ga0105243_112608502 114
222 3300009176 Ga0105242_10004657 Ga0105242_1000465712 114
223 3300009176 Ga0105242_10183321 Ga0105242_101833212 114
224 3300009176 Ga0105242_10470528 Ga0105242_104705282 114
225 3300009176 Ga0105242_10984704 Ga0105242_109847042 114
226 3300009177 Ga0105248_10175727 Ga0105248_101757273 114
227 3300009177 Ga0105248_10211049 Ga0105248_102110494 114
228 3300009551 Ga0105238_10547473 Ga0105238_105474732 114
229 3300009551 Ga0105238_11416863 Ga0105238_114168632 114
230 3300009553 Ga0105249_10198350 Ga0105249_101983504 114
231 3300009553 Ga0105249_10302551 Ga0105249_103025512 114
232 3300009553 Ga0105249_10735901 Ga0105249_107359012 114
233 3300010375 Ga0105239_10048544 Ga0105239_100485446 114
234 3300010375 Ga0105239_11067271 Ga0105239_110672712 114
235 3300011119 Ga0105246_10485846 Ga0105246_104858462 114
236 3300011119 Ga0105246_10534281 Ga0105246_105342812 114
237 3300012498 Ga0157345_1011949 Ga0157345_10119491 114
238 3300013105 Ga0157369_12331324 Ga0157369_123313242 114
239 3300013296 Ga0157374_10281061 Ga0157374_102810611 114
240 3300013296 Ga0157374_12136394 Ga0157374_121363942 114
241 3300013297 Ga0157378_10014133 Ga0157378_100141337 114
242 3300013307 Ga0157372_10412731 Ga0157372_104127312 114
243 3300013307 Ga0157372_11131611 Ga0157372_111316112 114
244 3300013308 Ga0157375_10076560 Ga0157375_100765608 114
245 3300013308 Ga0157375_10442969 Ga0157375_104429692 114
246 3300013308 Ga0157375_10673481 Ga0157375_106734812 114
247 3300014325 Ga0163163_10160843 Ga0163163_101608432 114
248 3300014325 Ga0163163_11207070 Ga0163163_112070702 114
249 3300014325 Ga0163163_11445795 Ga0163163_114457952 114
250 3300014326 Ga0157380_10037399 Ga0157380_100373993 114
251 3300014326 Ga0157380_11059926 Ga0157380_110599261 114
252 3300014326 Ga0157380_13347550 Ga0157380_133475502 114
253 3300014745 Ga0157377_11536149 Ga0157377_115361492 114
254 3300014968 Ga0157379_10047939 Ga0157379_100479393 114
255 3300014968 Ga0157379_10075804 Ga0157379_100758044 114
256 3300014968 Ga0157379_12315490 Ga0157379_123154901 114
257 3300014969 Ga0157376_10082369 Ga0157376_100823692 114
258 3300014969 Ga0157376_10189630 Ga0157376_101896302 114
259 3300014969 Ga0157376_11297569 Ga0157376_112975691 114
260 3300017792 Ga0163161_10192074 Ga0163161_101920744 114
261 3300017792 Ga0163161_10410596 Ga0163161_104105962 114
262 3300020069 Ga0197907_11393950 Ga0197907_113939502 114
263 3300020075 Ga0206349_1009212 Ga0206349_10092122 114
264 3300020078 Ga0206352_10211361 Ga0206352_102113612 114
265 3300020081 Ga0206354_10092926 Ga0206354_100929261 114
266 3300021384 Ga0213876_10204198 Ga0213876_102041982 114
267 3300021384 Ga0213876_10432658 Ga0213876_104326582 114
268 3300021384 Ga0213876_10569760 Ga0213876_105697602 114
269 3300021388 Ga0213875_10040297 Ga0213875_100402975 114
270 3300025271 Ga0207666_1002632 Ga0207666_10026322 114
271 3300025315 Ga0207697_10152268 Ga0207697_101522682 114
272 3300025899 Ga0207642_10026787 Ga0207642_100267873 114
273 3300025900 Ga0207710_10515411 Ga0207710_105154111 114
274 3300025901 Ga0207688_10437116 Ga0207688_104371162 114
275 3300025907 Ga0207645_10122945 Ga0207645_101229452 114
276 3300025907 Ga0207645_10159449 Ga0207645_101594493 114
277 3300025908 Ga0207643_10382390 Ga0207643_103823902 114
278 3300025908 Ga0207643_10632535 Ga0207643_106325352 114
279 3300025909 Ga0207705_11196101 Ga0207705_111961012 114
280 3300025911 Ga0207654_10055781 Ga0207654_100557813 114
281 3300025912 Ga0207707_10020646 Ga0207707_100206462 114
282 3300025912 Ga0207707_10332626 Ga0207707_103326262 114
283 3300025913 Ga0207695_11252532 Ga0207695_112525322 114
284 3300025917 Ga0207660_10077102 Ga0207660_100771022 114
285 3300025917 Ga0207660_10209038 Ga0207660_102090384 114
286 3300025917 Ga0207660_11059476 Ga0207660_110594762 114
287 3300025918 Ga0207662_10007284 Ga0207662_1000728410 114
288 3300025918 Ga0207662_10082054 Ga0207662_100820542 114
289 3300025919 Ga0207657_10032320 Ga0207657_1003232010 114
290 3300025919 Ga0207657_10067330 Ga0207657_100673302 114
291 3300025919 Ga0207657_10832545 Ga0207657_108325451 114
292 3300025919 Ga0207657_11006248 Ga0207657_110062482 114
293 3300025920 Ga0207649_10395737 Ga0207649_103957372 114
294 3300025920 Ga0207649_10542095 Ga0207649_105420952 114
295 3300025921 Ga0207652_10022071 Ga0207652_100220719 114
296 3300025921 Ga0207652_10941441 Ga0207652_109414412 114
297 3300025923 Ga0207681_10810273 Ga0207681_108102731 114
298 3300025924 Ga0207694_10177800 Ga0207694_101778002 114
299 3300025926 Ga0207659_10746571 Ga0207659_107465712 114
300 3300025927 Ga0207687_10054197 Ga0207687_100541974 114
301 3300025927 Ga0207687_10294726 Ga0207687_102947262 114
302 3300025927 Ga0207687_10452310 Ga0207687_104523102 114
303 3300025927 Ga0207687_10723154 Ga0207687_107231542 114
304 3300025927 Ga0207687_10734047 Ga0207687_107340472 114
305 3300025927 Ga0207687_11429344 Ga0207687_114293442 114
306 3300025929 Ga0207664_10003706 Ga0207664_1000370615 114
307 3300025931 Ga0207644_10554400 Ga0207644_105544002 114
308 3300025932 Ga0207690_10255835 Ga0207690_102558352 114
309 3300025932 Ga0207690_10919683 Ga0207690_109196832 114
310 3300025933 Ga0207706_10083036 Ga0207706_100830362 114
311 3300025933 Ga0207706_10230165 Ga0207706_102301652 114
312 3300025934 Ga0207686_10425012 Ga0207686_104250122 114
313 3300025934 Ga0207686_11105406 Ga0207686_111054062 114
314 3300025935 Ga0207709_10006045 Ga0207709_100060457 114
315 3300025935 Ga0207709_10031452 Ga0207709_100314525 114
316 3300025935 Ga0207709_10088841 Ga0207709_100888412 114
317 3300025936 Ga0207670_11203691 Ga0207670_112036912 114
318 3300025937 Ga0207669_10052680 Ga0207669_100526804 114
319 3300025937 Ga0207669_10417499 Ga0207669_104174992 114
320 3300025938 Ga0207704_10159217 Ga0207704_101592173 114
321 3300025938 Ga0207704_10401882 Ga0207704_104018822 114
322 3300025938 Ga0207704_11850255 Ga0207704_118502551 114
323 3300025940 Ga0207691_10132342 Ga0207691_101323422 114
324 3300025940 Ga0207691_10877032 Ga0207691_108770321 114
325 3300025941 Ga0207711_10498852 Ga0207711_104988522 114
326 3300025941 Ga0207711_10764462 Ga0207711_107644622 114
327 3300025942 Ga0207689_10563148 Ga0207689_105631482 114
328 3300025942 Ga0207689_10856882 Ga0207689_108568822 114
329 3300025944 Ga0207661_10007134 Ga0207661_1000713413 114
330 3300025944 Ga0207661_10241790 Ga0207661_102417903 114
331 3300025944 Ga0207661_11247530 Ga0207661_112475302 114
332 3300025945 Ga0207679_10518934 Ga0207679_105189342 114
333 3300025945 Ga0207679_10609477 Ga0207679_106094772 114
334 3300025945 Ga0207679_11825537 Ga0207679_118255372 114
335 3300025960 Ga0207651_10528727 Ga0207651_105287272 114
336 3300025961 Ga0207712_10137427 Ga0207712_101374275 114
337 3300025961 Ga0207712_10714360 Ga0207712_107143602 114
338 3300025972 Ga0207668_10345582 Ga0207668_103455822 114
339 3300025981 Ga0207640_10407980 Ga0207640_104079802 114
340 3300025981 Ga0207640_11095752 Ga0207640_110957522 114
341 3300025981 Ga0207640_12147336 Ga0207640_121473362 114
342 3300025986 Ga0207658_11178024 Ga0207658_111780242 114
343 3300025986 Ga0207658_12195442 Ga0207658_121954422 114
344 3300026023 Ga0207677_10275788 Ga0207677_102757883 114
345 3300026035 Ga0207703_10044345 Ga0207703_100443452 114
346 3300026035 Ga0207703_10186900 Ga0207703_101869003 114
347 3300026041 Ga0207639_10084823 Ga0207639_100848234 114
348 3300026067 Ga0207678_10108230 Ga0207678_101082302 114
349 3300026067 Ga0207678_10544552 Ga0207678_105445522 114
350 3300026067 Ga0207678_10898448 Ga0207678_108984482 114
351 3300026075 Ga0207708_10039177 Ga0207708_100391776 114
352 3300026075 Ga0207708_11215171 Ga0207708_112151712 114
353 3300026078 Ga0207702_10109504 Ga0207702_101095045 114
354 3300026088 Ga0207641_10215750 Ga0207641_102157504 114
355 3300026088 Ga0207641_10953959 Ga0207641_109539592 114
356 3300026089 Ga0207648_10002304 Ga0207648_100023049 114
357 3300026095 Ga0207676_10055322 Ga0207676_100553225 114
358 3300026095 Ga0207676_10402209 Ga0207676_104022093 114
359 3300026095 Ga0207676_10592449 Ga0207676_105924492 114
360 3300026095 Ga0207676_10778748 Ga0207676_107787482 114
361 3300026116 Ga0207674_11287266 Ga0207674_112872662 114
362 3300026118 Ga0207675_100013791 Ga0207675_1000137918 114
363 3300026118 Ga0207675_100341998 Ga0207675_1003419982 114
364 3300026118 Ga0207675_101510298 Ga0207675_1015102982 114
365 3300026121 Ga0207683_10055593 Ga0207683_100555935 114
366 3300026121 Ga0207683_10064538 Ga0207683_100645384 114
367 3300026121 Ga0207683_10117210 Ga0207683_101172105 114
368 3300026121 Ga0207683_10348139 Ga0207683_103481392 114
369 3300026142 Ga0207698_10111228 Ga0207698_101112282 114
370 3300026142 Ga0207698_11347927 Ga0207698_113479272 114
371 3300027907 Ga0207428_10000181 Ga0207428_1000018183 114
372 3300027907 Ga0207428_10019256 Ga0207428_100192565 114
373 3300027907 Ga0207428_10376334 Ga0207428_103763342 114
374 3300028379 Ga0268266_10283614 Ga0268266_102836142 114
375 3300028379 Ga0268266_11438426 Ga0268266_114384262 114
376 3300028379 Ga0268266_12257481 Ga0268266_122574811 114
377 3300028380 Ga0268265_10577377 Ga0268265_105773772 114
378 3300028381 Ga0268264_10070742 Ga0268264_100707424 114
379 3300028381 Ga0268264_11266214 Ga0268264_112662142 114
380 3300031238 Ga0265332_10123344 Ga0265332_101233442 114
381 3300031712 Ga0265342_10012141 Ga0265342_100121417 114
382 3300031731 Ga0307405_12012937 Ga0307405_120129372 114
383 3300032168 Ga0316593_10164191 Ga0316593_101641912 114
384 3300034819 Ga0373958_0140919 Ga0373958_0140919_222_566 114
385 3300035092 Ga0373952_0079765 Ga0373952_0079765_163_507 114
386 3300035114 Ga0373939_0127791 Ga0373939_0127791_200_568 114
387 3300035121 Ga0373960_0045682 Ga0373960_0045682_144_488 114
388 3300037312 Ga0395899_0183732 Ga0395899_0183732_282_638 114
389 3300037466 Ga0395898_0000942 Ga0395898_0000942_1093_1446 114
390 3300037853 Ga0436364_0932459 Ga0436364_0932459_1815_2168 114
391 3300039437 Ga0436365_0757678 Ga0436365_0757678_1467_1820 114
392 3300039437 Ga0436365_1678207 Ga0436365_1678207_530_883 114
393 3300039437 Ga0436365_1830572 Ga0436365_1830572_735_1103 114
394 3300039453 Ga0436362_1029262 Ga0436362_1029262_261_614 114
395 3300041463 Ga0451804_0241165 Ga0451804_0241165_112_465 114
396 3300041486 Ga0451807_1334824 Ga0451807_1334824_93_437 114
397 3300041492 Ga0451835_0318087 Ga0451835_0318087_457_810 114
398 3300041496 Ga0451839_1658697 Ga0451839_1658697_51_440 114
399 3300041498 Ga0451841_0613115 Ga0451841_0613115_171_524 114
400 3300042122 Ga0450920_003850 Ga0450920_003850_904_1254 114
401 3300042157 Ga0439458_0041336 Ga0439458_0041336_359_709 114
402 3300042531 Ga0450918_026981 Ga0450918_026981_57_413 114
403 3300042876 Ga0451577_0007199 Ga0451577_0007199_4329_4697 114
404 3300044683 Ga0466965_0133553 Ga0466965_0133553_525_878 114
405 3300044694 Ga0466963_0783701 Ga0466963_0783701_148_501 114
406 3300044706 Ga0466964_0307397 Ga0466964_0307397_324_680 114
407 3300044712 Ga0453684_0017333 Ga0453684_0017333_3807_4175 114
408 3300044765 Ga0466970_0194938 Ga0466970_0194938_747_1100 114
409 3300044842 Ga0466957_0711270 Ga0466957_0711270_204_557 114
410 3300044901 Ga0466960_0200847 Ga0466960_0200847_677_1030 114
411 3300044901 Ga0466960_0698165 Ga0466960_0698165_104_457 114
412 3300045976 Ga0466967_0471141 Ga0466967_0471141_114_464 114
413 3300045976 Ga0466967_0866921 Ga0466967_0866921_194_547 114
414 3300045976 Ga0466967_0914713 Ga0466967_0914713_200_556 114
415 3300045976 Ga0466967_0986967 Ga0466967_0986967_474_827 114
416 3300046463 Ga0495653_0944590 Ga0495653_0944590_131_499 114
417 3300046472 Ga0495580_0998518 Ga0495580_0998518_167_514 114
418 3300046474 Ga0495605_0137316 Ga0495605_0137316_197_547 114
419 3300046500 Ga0495596_0159182 Ga0495596_0159182_141_491 114
420 3300046513 Ga0495616_0404018 Ga0495616_0404018_119_469 114
421 3300046520 Ga0495637_0067382 Ga0495637_0067382_517_867 114
422 3300046523 Ga0495644_0042316 Ga0495644_0042316_105_455 114
423 3300046525 Ga0495663_0065403 Ga0495663_0065403_414_764 114
424 3300046530 Ga0495654_0332888 Ga0495654_0332888_140_490 114
425 3300046537 Ga0495598_0117185 Ga0495598_0117185_419_772 114
426 3300046615 Ga0495656_0139414 Ga0495656_0139414_355_708 114
427 3300046648 Ga0495611_0103611 Ga0495611_0103611_81_431 114
428 3300046664 Ga0495659_0315146 Ga0495659_0315146_77_442 114
429 3300046664 Ga0495659_0325375 Ga0495659_0325375_174_527 114
430 3300046794 Ga0495589_0493667 Ga0495589_0493667_15_368 114
431 3300047315 Ga0495581_0627268 Ga0495581_0627268_68_415 114
432 3300047318 Ga0495636_0028454 Ga0495636_0028454_1081_1446 114
433 3300047444 Ga0495675_0534761 Ga0495675_0534761_145_501 114
434 3300048088 Ga0495602_0559276 Ga0495602_0559276_370_726 114
435 3300048903 Ga0496100_0486474 Ga0496100_0486474_273_641 114
436 3300048904 Ga0496101_0163659 Ga0496101_0163659_570_938 114
437 3300048904 Ga0496101_0556809 Ga0496101_0556809_420_773 114
438 3300048905 Ga0496102_0020994 Ga0496102_0020994_1816_2169 114
439 3300048905 Ga0496102_0093608 Ga0496102_0093608_2321_2689 114
440 3300048905 Ga0496102_0839515 Ga0496102_0839515_311_664 114
441 3300048906 Ga0496103_0067521 Ga0496103_0067521_1338_1706 114
442 3300048907 Ga0496104_0003461 Ga0496104_0003461_12309_12677 114
443 3300048907 Ga0496104_0066078 Ga0496104_0066078_235_588 114
444 3300048908 Ga0496105_0022153 Ga0496105_0022153_4371_4739 114
445 3300048908 Ga0496105_1250345 Ga0496105_1250345_86_436 114
446 3300048908 Ga0496105_1337927 Ga0496105_1337927_40_393 114
447 3300048909 Ga0496106_0005388 Ga0496106_0005388_4465_4833 114
448 3300048909 Ga0496106_0381361 Ga0496106_0381361_14_367 114
449 3300048909 Ga0496106_0787132 Ga0496106_0787132_120_470 114
450 3300048909 Ga0496106_1525884 Ga0496106_1525884_112_480 114
451 3300048910 Ga0496107_0014931 Ga0496107_0014931_4880_5233 114
452 3300048910 Ga0496107_0045026 Ga0496107_0045026_937_1305 114
453 3300048911 Ga0496108_0092552 Ga0496108_0092552_842_1192 114
454 3300048911 Ga0496108_0309845 Ga0496108_0309845_196_564 114
455 3300048912 Ga0496109_0087389 Ga0496109_0087389_425_778 114
456 3300048912 Ga0496109_0169897 Ga0496109_0169897_1525_1893 114
457 3300048912 Ga0496109_1639696 Ga0496109_1639696_212_565 114
458 3300048913 Ga0496110_0005006 Ga0496110_0005006_9424_9792 114
459 3300048914 Ga0496111_0103230 Ga0496111_0103230_1199_1552 114
460 3300048914 Ga0496111_0399740 Ga0496111_0399740_530_898 114
461 3300048914 Ga0496111_0465455 Ga0496111_0465455_399_749 114
462 3300048915 Ga0496112_1461625 Ga0496112_1461625_35_388 114
463 3300048916 Ga0496113_0180619 Ga0496113_0180619_393_761 114
464 3300048916 Ga0496113_0462684 Ga0496113_0462684_623_976 114
465 3300048916 Ga0496113_1480645 Ga0496113_1480645_20_370 114
466 3300048917 Ga0496114_0010104 Ga0496114_0010104_564_917 114
467 3300048917 Ga0496114_0038009 Ga0496114_0038009_442_810 114
468 3300048917 Ga0496114_0073477 Ga0496114_0073477_1831_2181 114
469 3300048918 Ga0496115_0044878 Ga0496115_0044878_2782_3135 114
470 3300049568 Ga0501031_0068501 Ga0501031_0068501_1809_2153 114
471 3300049568 Ga0501031_0209414 Ga0501031_0209414_565_918 114
472 3300049568 Ga0501031_0327609 Ga0501031_0327609_421_774 114
473 3300049571 Ga0501034_0203447 Ga0501034_0203447_1469_1837 114
474 3300049572 Ga0501036_0148825 Ga0501036_0148825_1562_1906 114
475 3300049572 Ga0501036_0296415 Ga0501036_0296415_682_1035 114
476 3300049572 Ga0501036_0704824 Ga0501036_0704824_266_616 114
477 3300049573 Ga0501037_0223419 Ga0501037_0223419_849_1193 114
478 3300049573 Ga0501037_0510216 Ga0501037_0510216_259_612 114
479 3300049573 Ga0501037_0620055 Ga0501037_0620055_208_558 114
480 3300049574 Ga0501038_0144467 Ga0501038_0144467_117_461 114
481 3300049574 Ga0501038_1181390 Ga0501038_1181390_143_493 114
482 3300049575 Ga0501039_0007709 Ga0501039_0007709_2407_2751 114
483 3300049575 Ga0501039_0115948 Ga0501039_0115948_1051_1404 114
484 3300049575 Ga0501039_1328554 Ga0501039_1328554_16_369 114
485 3300049576 Ga0501040_0025481 Ga0501040_0025481_2030_2383 114
486 3300049576 Ga0501040_0213523 Ga0501040_0213523_616_969 114
487 3300049577 Ga0501041_0067285 Ga0501041_0067285_335_688 114
488 3300049577 Ga0501041_0439854 Ga0501041_0439854_167_511 114
489 3300049577 Ga0501041_0759355 Ga0501041_0759355_236_589 114
490 3300049578 Ga0501042_0015136 Ga0501042_0015136_3615_3959 114
491 3300049578 Ga0501042_0118116 Ga0501042_0118116_291_644 114
492 3300049578 Ga0501042_0133118 Ga0501042_0133118_1387_1740 114
493 3300049578 Ga0501042_0170317 Ga0501042_0170317_928_1281 114
494 3300049579 Ga0501043_0217764 Ga0501043_0217764_1056_1400 114
495 3300049579 Ga0501043_0792996 Ga0501043_0792996_305_658 114
496 3300049580 Ga0501046_0057062 Ga0501046_0057062_221_565 114
497 3300049581 Ga0501047_1266265 Ga0501047_1266265_17_361 114
498 3300049582 Ga0501048_0015470 Ga0501048_0015470_556_900 114
499 3300049582 Ga0501048_0287913 Ga0501048_0287913_522_875 114
500 3300049582 Ga0501048_0367479 Ga0501048_0367479_200_550 114
501 3300049583 Ga0501067_0038670 Ga0501067_0038670_1578_1943 114
502 3300049584 Ga0501068_0029609 Ga0501068_0029609_47_391 114
503 3300049584 Ga0501068_0718064 Ga0501068_0718064_230_583 114
504 3300049585 Ga0501069_0036892 Ga0501069_0036892_767_1111 114
505 3300049585 Ga0501069_0795595 Ga0501069_0795595_24_377 114
506 3300049586 Ga0501070_0035611 Ga0501070_0035611_2215_2559 114
507 3300049587 Ga0501071_0001083 Ga0501071_0001083_6130_6474 114
508 3300049587 Ga0501071_1382492 Ga0501071_1382492_96_449 114
509 3300049588 Ga0501072_0016036 Ga0501072_0016036_1093_1437 114
510 3300049588 Ga0501072_0129945 Ga0501072_0129945_301_654 114
511 3300049588 Ga0501072_0525125 Ga0501072_0525125_178_531 114
512 3300049588 Ga0501072_0894644 Ga0501072_0894644_37_390 114
513 3300049588 Ga0501072_1605102 Ga0501072_1605102_27_380 114
514 3300049590 Ga0501074_0036342 Ga0501074_0036342_126_470 114
515 3300049590 Ga0501074_0197734 Ga0501074_0197734_915_1268 114
516 3300049591 Ga0501075_0003018 Ga0501075_0003018_9412_9756 114
517 3300049591 Ga0501075_0158531 Ga0501075_0158531_451_804 114
518 3300049591 Ga0501075_0313729 Ga0501075_0313729_528_893 114
519 3300049591 Ga0501075_0482020 Ga0501075_0482020_555_908 114
520 3300049591 Ga0501075_1068007 Ga0501075_1068007_41_394 114
521 3300049592 Ga0501076_0040146 Ga0501076_0040146_522_866 114
522 3300049592 Ga0501076_0222483 Ga0501076_0222483_678_1031 114
523 3300049592 Ga0501076_0521371 Ga0501076_0521371_351_704 114
524 3300049593 Ga0501077_0001393 Ga0501077_0001393_5380_5724 114
525 3300049593 Ga0501077_0695744 Ga0501077_0695744_114_467 114
526 3300049593 Ga0501077_0792664 Ga0501077_0792664_132_485 114
527 3300049741 Ga0501079_0008393 Ga0501079_0008393_5517_5861 114
528 3300049741 Ga0501079_0079813 Ga0501079_0079813_1277_1630 114
529 3300049741 Ga0501079_0312217 Ga0501079_0312217_248_601 114
530 3300049741 Ga0501079_0350482 Ga0501079_0350482_208_573 114
531 3300049742 Ga0501080_0048644 Ga0501080_0048644_1864_2208 114
532 3300049743 Ga0501081_0004393 Ga0501081_0004393_1304_1648 114
533 3300049743 Ga0501081_0681376 Ga0501081_0681376_269_622 114
534 3300049744 Ga0501083_0051083 Ga0501083_0051083_2183_2527 114
535 3300049822 Ga0501035_0174832 Ga0501035_0174832_1299_1643 114
536 3300049822 Ga0501035_0308733 Ga0501035_0308733_697_1050 114
537 3300049823 Ga0501044_1353658 Ga0501044_1353658_23_367 114
538 3300049824 Ga0501045_0010860 Ga0501045_0010860_521_865 114
539 3300049824 Ga0501045_0246640 Ga0501045_0246640_313_666 114
540 3300049824 Ga0501045_0524550 Ga0501045_0524550_124_477 114
541 3300050507 nmdc:mga05p37_47021_c1 nmdc:mga05p37_47021_c1_1159_1512 114
542 3300050507 nmdc:mga05p37_48463_c1 nmdc:mga05p37_48463_c1_577_921 114
543 3300050508 nmdc:mga09592_45593_c1 nmdc:mga09592_45593_c1_770_1114 114
544 3300050508 nmdc:mga09592_939353_c1 nmdc:mga09592_939353_c1_345_698 114
545 3300050509 nmdc:mga0qj67_27322_c1 nmdc:mga0qj67_27322_c1_1795_2148 114
546 3300050510 nmdc:mga06r32_153768_c1 nmdc:mga06r32_153768_c1_1278_1622 114
547 3300050510 nmdc:mga06r32_1653532_c1 nmdc:mga06r32_1653532_c1_199_552 114
548 3300050511 nmdc:mga08y16_125036_c1 nmdc:mga08y16_125036_c1_371_715 114
549 3300050511 nmdc:mga08y16_574024_c1 nmdc:mga08y16_574024_c1_641_994 114
550 3300050511 nmdc:mga08y16_583630_c1 nmdc:mga08y16_583630_c1_519_869 114
551 3300050511 nmdc:mga08y16_889200_c1 nmdc:mga08y16_889200_c1_83_436 114
552 3300050512 nmdc:mga0n895_439122_c1 nmdc:mga0n895_439122_c1_509_862 114
553 3300050515 nmdc:mga0a205_62900_c1 nmdc:mga0a205_62900_c1_2192_2536 114
554 3300053085 Ga0495619_0362824 Ga0495619_0362824_415_762 114
555 3300054114 Ga0501084_0005571 Ga0501084_0005571_1145_1489 114
556 3300054114 Ga0501084_0237792 Ga0501084_0237792_1066_1419 114
557 3300054114 Ga0501084_0442662 Ga0501084_0442662_601_954 114
558 3300059623 Ga0587101_018959 Ga0587101_018959_410_778 114
559 3300060353 Ga0501082_0021659 Ga0501082_0021659_3679_4023 114
560 3300060353 Ga0501082_0377070 Ga0501082_0377070_274_627 114
561 3300060353 Ga0501082_0399182 Ga0501082_0399182_559_912 114
562 3300061719 Ga0466962_0649515 Ga0466962_0649515_69_422 114
563 3300061734 Ga0530510_0032518 Ga0530510_0032518_1216_1560 114
564 3300061734 Ga0530510_0130624 Ga0530510_0130624_588_941 114
565 3300061734 Ga0530510_1439833 Ga0530510_1439833_88_453 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

16

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w2e-assembly1.cif.gz_S crystal structure of elongation factor 4 (ef4/lepa) bound to the thermus thermophilus 70s ribosome 0.9546 24 114
8fr8-assembly1.cif.gz_D structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.9044 4 114
7mt3-assembly1.cif.gz_O mtb 70s with p/e trna 0.9017 4 114
4v9r-assembly2.cif.gz_DS crystal structure of antibiotic dityromycin bound to 70s ribosome 0.8917 9 114
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.8909 24 114
ID Description Score Start End Superfamily
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9639 24 114 3.30.420.100
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9639 17 114 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9568 17 114 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9464 17 114 3.30.420.100
4dhcS01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9364 24 114 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A4Q4DH48-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9836 37 114 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A1F5AYM9-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9827 25 114 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0008097
GO:1990904
AF-A0A2W6V789-F1-model_v4 deleted 0.9827 37 114
AF-A0A3E0I9V5-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.982 28 114 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A1X6X9C5-F1-model_v4 Large ribosomal subunit protein uL18 0.9809 18 114 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
92.74 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map