F464299

General Info

Members Datasets Scaffolds Average Seq Length
565 304 1131 326

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0021790|Ga0495643_0021790_616_1725
Length 369
Sequence LLNDLYNLKPVFFDKICIDFKKLIKIKIKVKFIHSLKIIIKNMEYRKLGNSELEISAITFGAWAAGGWMWGSTDRNEAIEAIKASYDVGVTSIDTAPIYGQGTSEEIVGEAIKDLSRDKVQILTKFGMRWDLAKGDFGFNSFKNNGDAIDVYKYAGKESIIYECEQSLKRLGTDYIDLYQIHWPDSTTPIDETFEAVSRLIEQGKVRFAGVCNYDAQQMAEAEKTLKLVSNQIPFSMVNRGIEEETLPYCIENNKSILAYSPLERGLLTGKIYNGYQFQDGDHRAGHKHFQPEFIEKTNQLLDKIKPIADEHKATLGQLVLRWTLERPGITIALAGARNADQAVQNAKAIEIKLSKEELTKIDELVNNF

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
155 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
156 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
233 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
234 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
235 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
236 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
237 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
238 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
239 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
240 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
246 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
254 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
255 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
256 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
267 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
268 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
269 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
270 2738541302 Pedobacter sp. CF074 Isolate Unclassified
271 2739367656 Pedobacter sp. CF523 Isolate Unclassified
272 2739367663 Pedobacter sp. YR510 Isolate Unclassified
273 2818991437 Pedobacter terrae 518 Isolate Unclassified
274 2818991444 Filimonas endophytica 3197 Isolate Unclassified
275 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
276 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
277 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
278 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
279 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
280 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
281 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
282 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
283 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
284 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
285 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
286 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
287 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
288 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
289 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
290 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
291 2914759650 Rhizosphaericola mali Isolate Rhizosphere
292 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
293 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
294 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
295 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
296 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
297 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
298 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
299 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
300 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
301 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
302 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
303 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
304 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.2
Nodule 0
Rhizoplane 0.35
Rhizosphere 81.24
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0021790 3300046522 Bacteria 3668
2 JGI24740J21852_10000909 3300001979 Bacteria 13118
3 JGI24737J22298_10000042 3300001990 Bacteria 37008
4 JGI24735J21928_10000014 3300002067 Bacteria 186670
5 JGI25162J39368_1000022 3300002737 Bacteria 239510
6 JGI25154J39366_1000012 3300002738 Bacteria 287601
7 JGI25157J39369_1002623 3300002741 Bacteria 4256
8 JGI25153J46596_10001521 3300003215 Bacteria 13807
9 JGI25153J46596_10030563 3300003215 Bacteria 1830
10 rootH1_10005053 3300003316 Bacteria 4688
11 rootH1_10047104 3300003316 Bacteria 9319
12 rootH1_10060934 3300003316 Bacteria 17837
13 rootH2_10014568 3300003320 Bacteria 37185
14 rootH2_10022576 3300003320 Unclassified 2292
15 rootH2_10053678 3300003320 Bacteria 12869
16 rootH2_10174705 3300003320 Bacteria 1137
17 rootH2_10236519 3300003320 Unclassified 1647
18 rootH2_10238860 3300003320 Bacteria 1459
19 rootH2_10254709 3300003320 Bacteria 2505
20 rootL2_10194357 3300003322 Bacteria 2753
21 rootH1_10000912 3300003316 Bacteria 6959
22 rootH1_10000912 3300003323 Bacteria 9325
23 rootH1_10011906 3300003323 Bacteria 17140
24 rootH1_10015343 3300003323 Bacteria 22999
25 rootH1_10022668 3300003323 Bacteria 1587
26 rootH1_10065401 3300003323 Unclassified 2234
27 rootH1_10135166 3300003323 Bacteria 2295
28 JGI25160J50197_1001408 3300003354 Bacteria 12060
29 JGI25160J50197_1006219 3300003354 Bacteria 4858
30 JGI25160J50197_1012895 3300003354 Bacteria 2876
31 Ga0055535_1002678 3300003761 Bacteria 5816
32 Ga0055526_1019645 3300003771 Bacteria 2451
33 Ga0055528_1001024 3300003790 Bacteria 18512
34 Ga0055530_10001218 3300003791 Bacteria 19831
35 Ga0055531_10000357 3300003794 Bacteria 44649
36 Ga0065165_1000228 3300005262 Bacteria 98736
37 Ga0065714_10007188 3300005288 Bacteria 3165
38 Ga0065714_10064558 3300005288 Bacteria 36374
39 Ga0065714_10064685 3300005288 Bacteria 23720
40 Ga0065714_10092946 3300005288 Bacteria 1836
41 Ga0065704_10073776 3300005289 Bacteria 6797
42 Ga0065707_10009107 3300005295 Bacteria 3253
43 Ga0070683_100002306 3300005329 Bacteria 15135
44 Ga0070683_100006786 3300005329 Bacteria 9622
45 Ga0070683_100015970 3300005329 Bacteria 6606
46 Ga0070690_100111042 3300005330 Bacteria 1829
47 Ga0070690_100199829 3300005330 Bacteria 1390
48 Ga0070670_100021498 3300005331 Bacteria 5550
49 Ga0070670_100054482 3300005331 Bacteria 3434
50 Ga0068869_100017033 3300005334 Bacteria 4916
51 Ga0068869_100028430 3300005334 Bacteria 3907
52 Ga0068869_100179633 3300005334 Unclassified 1659
53 Ga0068869_100186980 3300005334 Bacteria 1627
54 Ga0070666_10046889 3300005335 Bacteria 2900
55 Ga0070666_10047617 3300005335 Bacteria 2879
56 Ga0070682_100014729 3300005337 Bacteria 4523
57 Ga0068868_100007315 3300005338 Bacteria 7858
58 Ga0070660_100020228 3300005339 Bacteria 4889
59 Ga0070689_100005751 3300005340 Bacteria 8503
60 Ga0070689_100106487 3300005340 Unclassified 2225
61 Ga0070691_10031184 3300005341 Unclassified 2499
62 Ga0070691_10189475 3300005341 Bacteria 1075
63 Ga0070661_100000802 3300005344 Bacteria 22567
64 Ga0070661_100009511 3300005344 Bacteria 6733
65 Ga0070661_100050878 3300005344 Bacteria 3032
66 Ga0070661_100139188 3300005344 Bacteria 1828
67 Ga0070668_100276119 3300005347 Unclassified 1402
68 Ga0070669_100006078 3300005353 Bacteria 8714
69 Ga0070675_100002109 3300005354 Bacteria 14701
70 Ga0070675_100210102 3300005354 Unclassified 1691
71 Ga0070674_100147798 3300005356 Bacteria 1770
72 Ga0070673_100003054 3300005364 Bacteria 10359
73 Ga0070673_100112282 3300005364 Bacteria 2262
74 Ga0070688_100037062 3300005365 Unclassified 2970
75 Ga0070659_100022729 3300005366 Bacteria 4790
76 Ga0070667_100170840 3300005367 Bacteria 1919
77 Ga0070701_10119718 3300005438 Bacteria 1482
78 Ga0070700_100018102 3300005441 Bacteria 4045
79 Ga0070663_100004079 3300005455 Bacteria 8534
80 Ga0070663_100043477 3300005455 Bacteria 3162
81 Ga0070678_100302267 3300005456 Bacteria 1360
82 Ga0070662_100016770 3300005457 Bacteria 4924
83 Ga0070662_100024520 3300005457 Bacteria 4157
84 Ga0068867_100037726 3300005459 Bacteria 3514
85 Ga0070685_10025998 3300005466 Bacteria 3225
86 Ga0070684_100000772 3300005535 Bacteria 22197
87 Ga0070684_100004165 3300005535 Bacteria 10957
88 Ga0070684_100207626 3300005535 Bacteria 1785
89 Ga0068853_100000221 3300005539 Bacteria 40294
90 Ga0068853_100001075 3300005539 Bacteria 19291
91 Ga0070672_100039555 3300005543 Bacteria 3613
92 Ga0070665_100000001 3300005548 Bacteria 1083363
93 Ga0070665_100194688 3300005548 Unclassified 2028
94 Ga0068855_100007948 3300005563 Bacteria 12817
95 Ga0068855_100023148 3300005563 Bacteria 7444
96 Ga0068855_100033805 3300005563 Bacteria 6100
97 Ga0068855_100035233 3300005563 Bacteria 5961
98 Ga0068855_100063792 3300005563 Bacteria 4298
99 Ga0070664_100000505 3300005564 Bacteria 29592
100 Ga0070664_100004719 3300005564 Bacteria 10933
101 Ga0068857_100001366 3300005577 Bacteria 19225
102 Ga0068857_100008009 3300005577 Bacteria 9115
103 Ga0068857_100133251 3300005577 Bacteria 2242
104 Ga0068854_100103001 3300005578 Bacteria 2142
105 Ga0068854_100143748 3300005578 Bacteria 1833
106 Ga0068856_100006256 3300005614 Bacteria 11688
107 Ga0068856_100190443 3300005614 Bacteria 2065
108 Ga0068852_100014969 3300005616 Bacteria 5996
109 Ga0068852_100040745 3300005616 Bacteria 3921
110 Ga0068852_100075513 3300005616 Bacteria 2973
111 Ga0068852_100089662 3300005616 Unclassified 2749
112 Ga0068859_100047563 3300005617 Bacteria 4310
113 Ga0068859_100293501 3300005617 Unclassified 1719
114 Ga0068864_100178408 3300005618 Unclassified 1940
115 Ga0068864_100517558 3300005618 Bacteria 1150
116 Ga0068866_10045689 3300005718 Bacteria 2198
117 Ga0068861_100038817 3300005719 Bacteria 3550
118 Ga0068870_10027862 3300005840 Bacteria 2830
119 Ga0068858_100039810 3300005842 Bacteria 4357
120 Ga0068862_100009062 3300005844 Bacteria 8240
121 Ga0075366_10063410 3300006195 Bacteria 2197
122 Ga0075366_10113063 3300006195 Bacteria 1634
123 Ga0068865_100031844 3300006881 Bacteria 3519
124 Ga0097620_100047568 3300006931 Bacteria 4310
125 Ga0097620_100293523 3300006931 Unclassified 1719
126 Ga0105244_10005167 3300009036 Bacteria 8747
127 Ga0105240_10000074 3300009093 Bacteria 199611
128 Ga0105240_10000598 3300009093 Bacteria 67006
129 Ga0105240_10000626 3300009093 Bacteria 65179
130 Ga0105240_10046632 3300009093 Bacteria 5490
131 Ga0105240_10049831 3300009093 Bacteria 5283
132 Ga0105240_10064747 3300009093 Bacteria 4541
133 Ga0105240_10089362 3300009093 Bacteria 3768
134 Ga0105240_10120518 3300009093 Bacteria 3159
135 Ga0105240_10208513 3300009093 Bacteria 2285
136 Ga0111539_10005613 3300009094 Bacteria 16226
137 Ga0105245_10265861 3300009098 Bacteria 1671
138 Ga0105241_10001201 3300009174 Bacteria 19815
139 Ga0105241_10005621 3300009174 Bacteria 9251
140 Ga0105241_10128316 3300009174 Bacteria 2050
141 Ga0105241_10268337 3300009174 Bacteria 1453
142 Ga0105237_10000755 3300009545 Bacteria 44312
143 Ga0105237_10003416 3300009545 Bacteria 18881
144 Ga0105237_10003671 3300009545 Bacteria 18080
145 Ga0105237_10005269 3300009545 Bacteria 14628
146 Ga0105237_10017271 3300009545 Bacteria 7480
147 Ga0105237_10034771 3300009545 Bacteria 5100
148 Ga0105237_10043473 3300009545 Bacteria 4525
149 Ga0105237_10181761 3300009545 Bacteria 2103
150 Ga0105237_10434593 3300009545 Bacteria 1318
151 Ga0105237_10560317 3300009545 Bacteria 1149
152 Ga0105238_10016556 3300009551 Bacteria 7463
153 Ga0105238_10045789 3300009551 Bacteria 4419
154 Ga0105249_10168771 3300009553 Bacteria 2120
155 Ga0105249_10204203 3300009553 Bacteria 1935
156 Ga0105239_10000887 3300010375 Bacteria 42411
157 Ga0105239_10009010 3300010375 Bacteria 11295
158 Ga0105239_10009893 3300010375 Bacteria 10711
159 Ga0105239_10010680 3300010375 Bacteria 10270
160 Ga0105239_10012494 3300010375 Bacteria 9459
161 Ga0105239_10068748 3300010375 Bacteria 3893
162 Ga0105239_10113490 3300010375 Bacteria 3005
163 Ga0105239_10156444 3300010375 Bacteria 2545
164 Ga0105239_10173188 3300010375 Bacteria 2414
165 Ga0105239_10294072 3300010375 Bacteria 1829
166 Ga0105239_10372322 3300010375 Unclassified 1614
167 Ga0157373_10000028 3300013100 Bacteria 132569
168 Ga0157373_10142070 3300013100 Bacteria 1688
169 Ga0157371_10000296 3300013102 Bacteria 66267
170 Ga0157371_10001612 3300013102 Bacteria 23130
171 Ga0157371_10018212 3300013102 Bacteria 5197
172 Ga0157371_10067722 3300013102 Bacteria 2527
173 Ga0157371_10135080 3300013102 Bacteria 1756
174 Ga0157371_10160213 3300013102 Bacteria 1607
175 Ga0157370_10000383 3300013104 Bacteria 55670
176 Ga0157370_10024155 3300013104 Bacteria 6024
177 Ga0157370_10027807 3300013104 Bacteria 5574
178 Ga0157370_10047960 3300013104 Bacteria 4093
179 Ga0157370_10063597 3300013104 Bacteria 3495
180 Ga0157370_10072977 3300013104 Bacteria 3238
181 Ga0157370_10179644 3300013104 Bacteria 1967
182 Ga0157370_10465677 3300013104 Bacteria 1161
183 Ga0157369_10000164 3300013105 Bacteria 94229
184 Ga0157369_10003409 3300013105 Bacteria 18845
185 Ga0157369_10005014 3300013105 Bacteria 15509
186 Ga0157369_10027687 3300013105 Bacteria 6279
187 Ga0157369_10054459 3300013105 Bacteria 4320
188 Ga0157369_10127803 3300013105 Bacteria 2693
189 Ga0157369_10281565 3300013105 Bacteria 1732
190 Ga0157374_10000001 3300013296 Bacteria 1077351
191 Ga0157374_10007884 3300013296 Bacteria 9090
192 Ga0163162_10000065 3300013306 Bacteria 102191
193 Ga0163162_10006247 3300013306 Bacteria 11551
194 Ga0163162_10011416 3300013306 Bacteria 8663
195 Ga0163162_10035248 3300013306 Bacteria 4982
196 Ga0163162_10075010 3300013306 Bacteria 3442
197 Ga0163162_10076045 3300013306 Bacteria 3419
198 Ga0163162_10126086 3300013306 Bacteria 2666
199 Ga0157372_10000010 3300013307 Bacteria 300658
200 Ga0157372_10002015 3300013307 Bacteria 22086
201 Ga0157372_10008435 3300013307 Bacteria 10940
202 Ga0157372_10015090 3300013307 Bacteria 8269
203 Ga0157372_10122732 3300013307 Bacteria 2985
204 Ga0157372_10226144 3300013307 Bacteria 2169
205 Ga0157375_10000313 3300013308 Bacteria 43467
206 Ga0157375_10010283 3300013308 Bacteria 8233
207 Ga0157375_10026718 3300013308 Bacteria 5385
208 Ga0157375_10197583 3300013308 Bacteria 2166
209 Ga0157375_10446316 3300013308 Bacteria 1459
210 Ga0163163_10008995 3300014325 Bacteria 8899
211 Ga0163163_10102466 3300014325 Bacteria 2886
212 Ga0163163_10341600 3300014325 Unclassified 1552
213 Ga0157380_10002002 3300014326 Bacteria 13580
214 Ga0157380_10002204 3300014326 Bacteria 13099
215 Ga0182008_10000011 3300014497 Bacteria 297770
216 Ga0182008_10000167 3300014497 Bacteria 51397
217 Ga0157377_10002686 3300014745 Bacteria 7898
218 Ga0157377_10006329 3300014745 Bacteria 5639
219 Ga0157377_10020715 3300014745 Bacteria 3450
220 Ga0157377_10130274 3300014745 Unclassified 1535
221 Ga0157379_10021385 3300014968 Bacteria 5727
222 Ga0157376_10018256 3300014969 Bacteria 5372
223 Ga0157376_10019970 3300014969 Bacteria 5174
224 Ga0157376_10096530 3300014969 Bacteria 2573
225 Ga0157376_10194995 3300014969 Unclassified 1860
226 Ga0182006_1000351 3300015261 Bacteria 38720
227 Ga0182006_1000546 3300015261 Bacteria 28457
228 Ga0182007_10000005 3300015262 Bacteria 442702
229 Ga0182005_1000126 3300015265 Bacteria 53914
230 Ga0183373_1002 3300015682 Bacteria 990153
231 Ga0163161_10000539 3300017792 Bacteria 30832
232 Ga0163161_10014139 3300017792 Bacteria 5558
233 Ga0163161_10045003 3300017792 Bacteria 3181
234 Ga0163161_10045496 3300017792 Bacteria 3166
235 Ga0163161_10057670 3300017792 Bacteria 2821
236 Ga0163161_10072486 3300017792 Bacteria 2522
237 Ga0163161_10381493 3300017792 Bacteria 1127
238 Ga0209437_100024 3300025233 Bacteria 592878
239 Ga0209258_100098 3300025242 Bacteria 215216
240 Ga0209646_1000009 3300025246 Bacteria 652154
241 Ga0209026_1000197 3300025250 Bacteria 84123
242 Ga0209148_1000120 3300025254 Bacteria 186836
243 Ga0209455_1004216 3300025272 Bacteria 4793
244 Ga0209673_1000016 3300025273 Bacteria 506202
245 Ga0209564_1006770 3300025295 Bacteria 6070
246 Ga0209564_1008008 3300025295 Bacteria 5305
247 Ga0209564_1033005 3300025295 Bacteria 1547
248 Ga0209758_1007651 3300025297 Bacteria 7285
249 Ga0209758_1008975 3300025297 Bacteria 6331
250 Ga0209050_1000124 3300025298 Bacteria 194022
251 Ga0207426_1000019 3300025302 Bacteria 558579
252 Ga0207426_1001572 3300025302 Bacteria 18424
253 Ga0207426_1003785 3300025302 Bacteria 7853
254 Ga0207426_1015343 3300025302 Bacteria 2780
255 Ga0209257_1000013 3300025304 Bacteria 1047305
256 Ga0209257_1004094 3300025304 Bacteria 11673
257 Ga0207697_10019450 3300025315 Bacteria 2782
258 Ga0207710_10000402 3300025900 Bacteria 28743
259 Ga0207647_10108042 3300025904 Bacteria 1646
260 Ga0207647_10109719 3300025904 Bacteria 1632
261 Ga0207685_10044892 3300025905 Bacteria 1673
262 Ga0207645_10018056 3300025907 Bacteria 4650
263 Ga0207645_10021325 3300025907 Bacteria 4225
264 Ga0207643_10018405 3300025908 Bacteria 3825
265 Ga0207654_10016460 3300025911 Bacteria 3851
266 Ga0207654_10018719 3300025911 Unclassified 3639
267 Ga0207695_10000071 3300025913 Bacteria 315568
268 Ga0207695_10000084 3300025913 Bacteria 282392
269 Ga0207695_10000323 3300025913 Bacteria 114265
270 Ga0207695_10003292 3300025913 Bacteria 22934
271 Ga0207695_10008989 3300025913 Bacteria 12432
272 Ga0207695_10019711 3300025913 Bacteria 7756
273 Ga0207695_10021372 3300025913 Bacteria 7384
274 Ga0207695_10051258 3300025913 Bacteria 4336
275 Ga0207695_10069338 3300025913 Bacteria 3608
276 Ga0207695_10098375 3300025913 Bacteria 2925
277 Ga0207671_10002316 3300025914 Bacteria 20539
278 Ga0207671_10002632 3300025914 Bacteria 18878
279 Ga0207671_10003305 3300025914 Bacteria 16215
280 Ga0207671_10015269 3300025914 Bacteria 6027
281 Ga0207671_10023392 3300025914 Bacteria 4660
282 Ga0207671_10049821 3300025914 Bacteria 3101
283 Ga0207671_10163937 3300025914 Bacteria 1722
284 Ga0207671_10188304 3300025914 Bacteria 1608
285 Ga0207649_10001160 3300025920 Bacteria 15873
286 Ga0207649_10007972 3300025920 Bacteria 5762
287 Ga0207652_10096068 3300025921 Bacteria 2611
288 Ga0207681_10006598 3300025923 Bacteria 7127
289 Ga0207681_10052908 3300025923 Bacteria 2755
290 Ga0207694_10025815 3300025924 Bacteria 4466
291 Ga0207694_10037736 3300025924 Bacteria 3713
292 Ga0207650_10181671 3300025925 Bacteria 1676
293 Ga0207659_10044949 3300025926 Bacteria 3110
294 Ga0207690_10131266 3300025932 Bacteria 1834
295 Ga0207706_10028043 3300025933 Bacteria 5030
296 Ga0207706_10047114 3300025933 Bacteria 3815
297 Ga0207706_10057817 3300025933 Bacteria 3416
298 Ga0207686_10034306 3300025934 Bacteria 3036
299 Ga0207669_10105865 3300025937 Bacteria 1872
300 Ga0207704_10071969 3300025938 Unclassified 2196
301 Ga0207691_10043667 3300025940 Bacteria 4129
302 Ga0207691_10313882 3300025940 Unclassified 1345
303 Ga0207689_10023441 3300025942 Bacteria 5181
304 Ga0207689_10038084 3300025942 Bacteria 3984
305 Ga0207689_10104476 3300025942 Bacteria 2327
306 Ga0207689_10160634 3300025942 Bacteria 1852
307 Ga0207661_10000929 3300025944 Bacteria 19227
308 Ga0207661_10003201 3300025944 Bacteria 11343
309 Ga0207661_10006780 3300025944 Bacteria 8110
310 Ga0207661_10086409 3300025944 Bacteria 2603
311 Ga0207679_10000232 3300025945 Bacteria 43046
312 Ga0207679_10006857 3300025945 Bacteria 7217
313 Ga0207679_10111968 3300025945 Unclassified 2156
314 Ga0207667_10000700 3300025949 Bacteria 43461
315 Ga0207667_10016862 3300025949 Bacteria 8239
316 Ga0207667_10019514 3300025949 Bacteria 7565
317 Ga0207651_10104366 3300025960 Unclassified 2112
318 Ga0207651_10256122 3300025960 Bacteria 1434
319 Ga0207712_10031639 3300025961 Bacteria 3566
320 Ga0207640_10015517 3300025981 Bacteria 4412
321 Ga0207658_10084729 3300025986 Bacteria 2440
322 Ga0207677_10061708 3300026023 Unclassified 2597
323 Ga0207677_10099914 3300026023 Unclassified 2132
324 Ga0207703_10187578 3300026035 Unclassified 1829
325 Ga0207639_10001620 3300026041 Bacteria 15141
326 Ga0207639_10008760 3300026041 Bacteria 6951
327 Ga0207678_10003893 3300026067 Bacteria 13425
328 Ga0207702_10095614 3300026078 Bacteria 2611
329 Ga0207648_10001472 3300026089 Bacteria 25920
330 Ga0207648_10114753 3300026089 Unclassified 2367
331 Ga0207648_10143068 3300026089 Bacteria 2109
332 Ga0207674_10004099 3300026116 Bacteria 17649
333 Ga0207674_10009679 3300026116 Bacteria 10985
334 Ga0207674_10018299 3300026116 Bacteria 7618
335 Ga0207674_10174999 3300026116 Bacteria 2099
336 Ga0207675_100000507 3300026118 Bacteria 37845
337 Ga0207675_100109623 3300026118 Bacteria 2605
338 Ga0207675_100413044 3300026118 Bacteria 1332
339 Ga0207683_10009631 3300026121 Bacteria 8233
340 Ga0207698_10037738 3300026142 Bacteria 3562
341 Ga0207698_10161193 3300026142 Unclassified 1962
342 Ga0207428_10011632 3300027907 Bacteria 7767
343 Ga0268266_10000049 3300028379 Bacteria 307763
344 Ga0268266_10087352 3300028379 Unclassified 2728
345 Ga0268266_10156777 3300028379 Unclassified 2057
346 Ga0265336_10008325 3300028666 Bacteria 3644
347 Ga0307517_10072141 3300028786 Bacteria 3082
348 Ga0307515_10000001 3300028794 Bacteria 4259510
349 Ga0307515_10000057 3300028794 Bacteria 261695
350 Ga0265338_10060857 3300028800 Bacteria 3312
351 Ga0316176_1131516 3300030732 Bacteria 7794
352 Ga0316183_1119247 3300030742 Bacteria 31382
353 Ga0316181_1277597 3300030744 Bacteria 16645
354 Ga0265327_10010692 3300031251 Bacteria 6414
355 Ga0265327_10012845 3300031251 Bacteria 5611
356 Ga0265316_10131388 3300031344 Unclassified 1886
357 Ga0307408_100000652 3300031548 Bacteria 29132
358 Ga0307408_100002469 3300031548 Bacteria 12967
359 Ga0307408_100010676 3300031548 Bacteria 6057
360 Ga0316576_10008737 3300031727 Bacteria 6487
361 Ga0316576_10158651 3300031727 Unclassified 1706
362 Ga0316576_10173346 3300031727 Bacteria 1628
363 Ga0316576_10175389 3300031727 Bacteria 1617
364 Ga0316578_10143502 3300031728 Unclassified 1438
365 Ga0307516_10002463 3300031730 Bacteria 24737
366 Ga0307405_10000009 3300031731 Bacteria 259388
367 Ga0307405_10064210 3300031731 Bacteria 2332
368 Ga0316577_10160475 3300031733 Bacteria 1268
369 Ga0307407_10000001 3300031903 Bacteria 570048
370 Ga0307412_10006672 3300031911 Bacteria 6543
371 Ga0307412_10049819 3300031911 Bacteria 2761
372 Ga0307416_100000026 3300032002 Bacteria 172622
373 Ga0307416_100139228 3300032002 Bacteria 2202
374 Ga0307414_10078496 3300032004 Unclassified 2407
375 Ga0316580_10017265 3300032139 Bacteria 2218
376 Ga0307510_10000217 3300033180 Bacteria 51069
377 Ga0373943_0053168 3300035170 Bacteria 1999
378 Ga0316584_0003441 3300036712 Bacteria 10274
379 Ga0316584_0017257 3300036712 Bacteria 5186
380 Ga0316584_0272203 3300036712 Bacteria 1232
381 Ga0395899_0000122 3300037312 Bacteria 123909
382 Ga0395899_0001366 3300037312 Bacteria 20911
383 Ga0395898_0000092 3300037466 Bacteria 235647
384 Ga0400489_82418 3300039093 Bacteria 2550
385 Ga0439431_0000264 3300041997 Bacteria 10760
386 Ga0439431_0020240 3300041997 Bacteria 1588
387 Ga0439445_0001255 3300042004 Bacteria 5494
388 Ga0439445_0012153 3300042004 Bacteria 2065
389 Ga0439449_0013451 3300042007 Bacteria 3080
390 Ga0439462_0001300 3300042015 Bacteria 5491
391 Ga0451577_0015166 3300042876 Bacteria 7172
392 Ga0451577_0015970 3300042876 Bacteria 6967
393 Ga0451577_0029962 3300042876 Bacteria 4916
394 Ga0466969_0021459 3300044656 Bacteria 3339
395 Ga0466972_0000014 3300044658 Bacteria 216776
396 Ga0466972_0003478 3300044658 Bacteria 7814
397 Ga0453683_0000045 3300044673 Bacteria 211088
398 Ga0453683_0000065 3300044673 Bacteria 166630
399 Ga0453683_0009674 3300044673 Bacteria 6428
400 Ga0453683_0040034 3300044673 Bacteria 2944
401 Ga0466965_0017189 3300044683 Bacteria 3454
402 Ga0466965_0058971 3300044683 Bacteria 1915
403 Ga0466966_0015916 3300044684 Bacteria 4970
404 Ga0466961_0005768 3300044693 Bacteria 7837
405 Ga0466964_0087437 3300044706 Bacteria 1350
406 Ga0453684_0000139 3300044712 Bacteria 320330
407 Ga0453684_0001715 3300044712 Bacteria 58849
408 Ga0453684_0009535 3300044712 Bacteria 16959
409 Ga0453684_0015427 3300044712 Bacteria 12089
410 Ga0453684_0039853 3300044712 Bacteria 6391
411 Ga0453684_0041296 3300044712 Bacteria 6243
412 Ga0453684_0418672 3300044712 Bacteria 1497
413 Ga0453684_0430841 3300044712 Bacteria 1471
414 Ga0466971_0000017 3300044719 Bacteria 82541
415 Ga0466971_0022892 3300044719 Bacteria 2785
416 Ga0466968_0036113 3300044735 Bacteria 2070
417 Ga0466968_0072231 3300044735 Bacteria 1504
418 Ga0466970_0000497 3300044765 Bacteria 19350
419 Ga0466957_0004508 3300044842 Bacteria 7773
420 Ga0466957_0386269 3300044842 Bacteria 955
421 Ga0466959_0044132 3300045049 Bacteria 3285
422 Ga0451576_0000175 3300045051 Bacteria 161976
423 Ga0451576_0000332 3300045051 Bacteria 114268
424 Ga0451576_0028168 3300045051 Bacteria 6023
425 Ga0451576_0031235 3300045051 Bacteria 5681
426 Ga0451576_0031754 3300045051 Bacteria 5629
427 Ga0451576_0040834 3300045051 Bacteria 4907
428 Ga0451576_0049254 3300045051 Bacteria 4421
429 Ga0451576_0307657 3300045051 Bacteria 1658
430 Ga0451576_0494651 3300045051 Bacteria 1285
431 Ga0495627_014110 3300046453 Bacteria 2797
432 Ga0495638_0087190 3300046460 Bacteria 1886
433 Ga0495650_0000003 3300046471 Bacteria 900730
434 Ga0495650_0000036 3300046471 Bacteria 400633
435 Ga0495585_0000085 3300046492 Bacteria 97836
436 Ga0495607_0048433 3300046501 Unclassified 2485
437 Ga0495607_0108255 3300046501 Bacteria 1477
438 Ga0495606_0000145 3300046507 Bacteria 122857
439 Ga0495606_0007477 3300046507 Bacteria 9762
440 Ga0495606_0051107 3300046507 Bacteria 2699
441 Ga0495610_0000501 3300046512 Bacteria 39971
442 Ga0495610_0002148 3300046512 Bacteria 16763
443 Ga0495616_0000925 3300046513 Bacteria 21108
444 Ga0495616_0002395 3300046513 Bacteria 12476
445 Ga0495632_0008321 3300046519 Bacteria 6385
446 Ga0495644_0029151 3300046523 Bacteria 2086
447 Ga0495648_0003858 3300046524 Bacteria 12999
448 Ga0495663_0000792 3300046525 Bacteria 10811
449 Ga0495587_0019759 3300046536 Bacteria 4165
450 Ga0495609_0000134 3300046538 Bacteria 79757
451 Ga0495633_0000008 3300046558 Bacteria 301830
452 Ga0495633_0000059 3300046558 Bacteria 147552
453 Ga0495633_0018245 3300046558 Bacteria 3568
454 Ga0495611_0000090 3300046648 Bacteria 63531
455 Ga0495625_0000005 3300046660 Bacteria 596135
456 Ga0495625_0004302 3300046660 Bacteria 13547
457 Ga0495625_0014249 3300046660 Bacteria 6356
458 Ga0495625_0060198 3300046660 Bacteria 2691
459 Ga0495625_0159923 3300046660 Bacteria 1510
460 Ga0495661_0000563 3300046665 Bacteria 38406
461 Ga0495661_0006086 3300046665 Bacteria 8503
462 Ga0495671_0085546 3300046692 Bacteria 1545
463 Ga0495649_0000003 3300046694 Bacteria 880817
464 Ga0495672_0033244 3300047320 Bacteria 3197
465 Ga0495687_053978 3300047443 Bacteria 1689
466 Ga0495686_0000004 3300047472 Bacteria 869019
467 Ga0495686_0000367 3300047472 Bacteria 73112
468 Ga0495686_0000416 3300047472 Bacteria 67601
469 Ga0495686_0193243 3300047472 Bacteria 1172
470 Ga0496115_0267909 3300048918 Bacteria 1404
471 Ga0496121_0000007 3300048924 Bacteria 942516
472 Ga0496125_0003355 3300048928 Bacteria 19500
473 Ga0496126_0043806 3300048929 Bacteria 4126
474 Ga0495678_020300 3300049459 Bacteria 2946
475 Ga0495678_021013 3300049459 Bacteria 2881
476 Ga0501298_003226 3300049521 Bacteria 2522
477 Ga0501031_0001157 3300049568 Bacteria 16042
478 Ga0501033_0000271 3300049570 Bacteria 50065
479 Ga0501034_0049620 3300049571 Bacteria 4234
480 Ga0501037_0000116 3300049573 Bacteria 74682
481 Ga0501038_0000976 3300049574 Bacteria 25655
482 Ga0501038_0023894 3300049574 Bacteria 5459
483 Ga0501043_0000342 3300049579 Bacteria 42181
484 Ga0501043_0009056 3300049579 Bacteria 7831
485 Ga0501047_0001211 3300049581 Bacteria 25605
486 Ga0501047_0124423 3300049581 Bacteria 2459
487 Ga0501047_0212029 3300049581 Unclassified 1795
488 Ga0501072_0167356 3300049588 Bacteria 1754
489 Ga0501201_004618 3300049651 Bacteria 1279
490 Ga0501206_004609 3300049653 Bacteria 1758
491 Ga0501207_010837 3300049654 Bacteria 1349
492 Ga0501223_001164 3300049663 Bacteria 6195
493 Ga0501224_000321 3300049664 Bacteria 5610
494 Ga0501243_000295 3300049675 Bacteria 6449
495 Ga0501259_003357 3300049688 Bacteria 2558
496 Ga0501221_002035 3300049704 Bacteria 3367
497 Ga0501245_002439 3300049708 Bacteria 2483
498 Ga0501080_0159161 3300049742 Bacteria 2086
499 Ga0501241_015421 3300049758 Bacteria 1390
500 Ga0501035_0001096 3300049822 Bacteria 28396
501 Ga0501044_0001911 3300049823 Bacteria 24112
502 Ga0501212_008926 3300049851 Bacteria 1402
503 Ga0501284_00021 3300050005 Bacteria 89729
504 nmdc:mga0k408_145968_c1 3300050493 Bacteria 1408
505 nmdc:mga0k408_183016_c1 3300050493 Bacteria 1250
506 nmdc:mga08y16_44554_c1 3300050511 Bacteria 4648
507 Ga0500644_0000456 3300053088 Bacteria 18680
508 Ga0500581_101317 3300053089 Bacteria 1416
509 Ga0500583_0000188 3300053092 Bacteria 24682
510 Ga0500583_0027729 3300053092 Bacteria 2448
511 Ga0500651_0017407 3300053093 Bacteria 4434
512 Ga0500556_0074638 3300053104 Bacteria 1273
513 Ga0500562_000095 3300053108 Bacteria 35281
514 Ga0500569_000462 3300053109 Bacteria 6680
515 Ga0500607_133289 3300053121 Bacteria 1181
516 Ga0500652_030512 3300053131 Bacteria 2109
517 Ga0500658_0042859 3300053134 Bacteria 1820
518 Ga0500568_0000236 3300053139 Bacteria 47278
519 Ga0500577_0002874 3300053142 Bacteria 4434
520 Ga0500616_0031050 3300053153 Bacteria 2929
521 Ga0500622_0000110 3300053156 Bacteria 83911
522 Ga0500622_0001046 3300053156 Bacteria 23113
523 Ga0500622_0004430 3300053156 Bacteria 8826
524 Ga0500624_000158 3300053157 Bacteria 27895
525 Ga0500645_036127 3300053730 Bacteria 1470
526 Ga0466962_0000031 3300061719 Bacteria 68489
527 2524005864 2523533629 Bacteria 2982326
528 2587942854 2585428115 Bacteria 4420269
529 2588233411 2585428187 Bacteria 4629388
530 2599477720 2599185184 Bacteria 6430550
531 2738854996 2738541302 Bacteria 5944758
532 2739614805 2739367656 Bacteria 5152243
533 2739646254 2739367663 Bacteria 5040914
534 2819547352 2818991437 Bacteria 5805520
535 2819590940 2818991444 Bacteria 6968812
536 2821138240 2821136567 Bacteria 8080116
537 2842727663 2842722452 Bacteria 6263924
538 2842905518 2842903701 Bacteria 6986368
539 2842911132 2842909656 Bacteria 6185908
540 2849283086 2849281842 Bacteria 6065644
541 2857631930 2857627736 Bacteria 5625397
542 2881248749 2881247448 Bacteria 3717788
543 2884796379 2884791551 Bacteria 8511252
544 2890738902 2890737413 Bacteria 4269751
545 2896088552 2896085136 Bacteria 6129793
546 2896321177 2896317667 Bacteria 4606601
547 2898714728 2898713307 Bacteria 4110805
548 2904447818 2904445276 Bacteria 5310396
549 2904469036 2904467357 Bacteria 8057758
550 2910249689 2910245624 Bacteria 6935613
551 2911140970 2911138879 Bacteria 5811561
552 2914763161 2914759650 Bacteria 4701441
553 2919441677 2919437846 Bacteria 6199444
554 2928079636 2928078545 Bacteria 6534839
555 2928147887 2928147474 Bacteria 6512076
556 2929156048 2929154850 Bacteria 6753285
557 2929158225 2929154850 Bacteria 6753285
558 2929242919 2929239360 Bacteria 7745570
559 2929924401 2929921140 Bacteria 8649150
560 2932086738 2932082852 Bacteria 6563563
561 2954020208 2954016120 Bacteria 6446024
562 2958515497 2958512119 Bacteria 4528530
563 2965320390 2965320100 Bacteria 3975600
564 2977246152 2977243572 Bacteria 4374394
565 3003234179 3003233435 Bacteria 4458031
566 8003155371 8003151029 Bacteria 8187759
567 Ga0495643_0021790
568 JGI24740J21852_10000909
569 JGI24737J22298_10000042
570 JGI24735J21928_10000014
571 JGI25162J39368_1000022
572 JGI25154J39366_1000012
573 JGI25157J39369_1002623
574 JGI25153J46596_10001521
575 JGI25153J46596_10030563
576 rootH1_10005053
577 rootH1_10047104
578 rootH1_10060934
579 rootH2_10014568
580 rootH2_10022576
581 rootH2_10053678
582 rootH2_10174705
583 rootH2_10236519
584 rootH2_10238860
585 rootH2_10254709
586 rootL2_10194357
587 rootH1_10000912
588 rootH1_10011906
589 rootH1_10015343
590 rootH1_10022668
591 rootH1_10065401
592 rootH1_10135166
593 JGI25160J50197_1001408
594 JGI25160J50197_1006219
595 JGI25160J50197_1012895
596 Ga0055535_1002678
597 Ga0055526_1019645
598 Ga0055528_1001024
599 Ga0055530_10001218
600 Ga0055531_10000357
601 Ga0065165_1000228
602 Ga0065714_10007188
603 Ga0065714_10064558
604 Ga0065714_10064685
605 Ga0065714_10092946
606 Ga0065704_10073776
607 Ga0065707_10009107
608 Ga0070683_100002306
609 Ga0070683_100006786
610 Ga0070683_100015970
611 Ga0070690_100111042
612 Ga0070690_100199829
613 Ga0070670_100021498
614 Ga0070670_100054482
615 Ga0068869_100017033
616 Ga0068869_100028430
617 Ga0068869_100179633
618 Ga0068869_100186980
619 Ga0070666_10046889
620 Ga0070666_10047617
621 Ga0070682_100014729
622 Ga0068868_100007315
623 Ga0070660_100020228
624 Ga0070689_100005751
625 Ga0070689_100106487
626 Ga0070691_10031184
627 Ga0070691_10189475
628 Ga0070661_100000802
629 Ga0070661_100009511
630 Ga0070661_100050878
631 Ga0070661_100139188
632 Ga0070668_100276119
633 Ga0070669_100006078
634 Ga0070675_100002109
635 Ga0070675_100210102
636 Ga0070674_100147798
637 Ga0070673_100003054
638 Ga0070673_100112282
639 Ga0070688_100037062
640 Ga0070659_100022729
641 Ga0070667_100170840
642 Ga0070701_10119718
643 Ga0070700_100018102
644 Ga0070663_100004079
645 Ga0070663_100043477
646 Ga0070678_100302267
647 Ga0070662_100016770
648 Ga0070662_100024520
649 Ga0068867_100037726
650 Ga0070685_10025998
651 Ga0070684_100000772
652 Ga0070684_100004165
653 Ga0070684_100207626
654 Ga0068853_100000221
655 Ga0068853_100001075
656 Ga0070672_100039555
657 Ga0070665_100000001
658 Ga0070665_100194688
659 Ga0068855_100007948
660 Ga0068855_100023148
661 Ga0068855_100033805
662 Ga0068855_100035233
663 Ga0068855_100063792
664 Ga0070664_100000505
665 Ga0070664_100004719
666 Ga0068857_100001366
667 Ga0068857_100008009
668 Ga0068857_100133251
669 Ga0068854_100103001
670 Ga0068854_100143748
671 Ga0068856_100006256
672 Ga0068856_100190443
673 Ga0068852_100014969
674 Ga0068852_100040745
675 Ga0068852_100075513
676 Ga0068852_100089662
677 Ga0068859_100047563
678 Ga0068859_100293501
679 Ga0068864_100178408
680 Ga0068864_100517558
681 Ga0068866_10045689
682 Ga0068861_100038817
683 Ga0068870_10027862
684 Ga0068858_100039810
685 Ga0068862_100009062
686 Ga0075366_10063410
687 Ga0075366_10113063
688 Ga0068865_100031844
689 Ga0097620_100047568
690 Ga0097620_100293523
691 Ga0105244_10005167
692 Ga0105240_10000074
693 Ga0105240_10000598
694 Ga0105240_10000626
695 Ga0105240_10046632
696 Ga0105240_10049831
697 Ga0105240_10064747
698 Ga0105240_10089362
699 Ga0105240_10120518
700 Ga0105240_10208513
701 Ga0111539_10005613
702 Ga0105245_10265861
703 Ga0105241_10001201
704 Ga0105241_10005621
705 Ga0105241_10128316
706 Ga0105241_10268337
707 Ga0105237_10000755
708 Ga0105237_10003416
709 Ga0105237_10003671
710 Ga0105237_10005269
711 Ga0105237_10017271
712 Ga0105237_10034771
713 Ga0105237_10043473
714 Ga0105237_10181761
715 Ga0105237_10434593
716 Ga0105237_10560317
717 Ga0105238_10016556
718 Ga0105238_10045789
719 Ga0105249_10168771
720 Ga0105249_10204203
721 Ga0105239_10000887
722 Ga0105239_10009010
723 Ga0105239_10009893
724 Ga0105239_10010680
725 Ga0105239_10012494
726 Ga0105239_10068748
727 Ga0105239_10113490
728 Ga0105239_10156444
729 Ga0105239_10173188
730 Ga0105239_10294072
731 Ga0105239_10372322
732 Ga0157373_10000028
733 Ga0157373_10142070
734 Ga0157371_10000296
735 Ga0157371_10001612
736 Ga0157371_10018212
737 Ga0157371_10067722
738 Ga0157371_10135080
739 Ga0157371_10160213
740 Ga0157370_10000383
741 Ga0157370_10024155
742 Ga0157370_10027807
743 Ga0157370_10047960
744 Ga0157370_10063597
745 Ga0157370_10072977
746 Ga0157370_10179644
747 Ga0157370_10465677
748 Ga0157369_10000164
749 Ga0157369_10003409
750 Ga0157369_10005014
751 Ga0157369_10027687
752 Ga0157369_10054459
753 Ga0157369_10127803
754 Ga0157369_10281565
755 Ga0157374_10000001
756 Ga0157374_10007884
757 Ga0163162_10000065
758 Ga0163162_10006247
759 Ga0163162_10011416
760 Ga0163162_10035248
761 Ga0163162_10075010
762 Ga0163162_10076045
763 Ga0163162_10126086
764 Ga0157372_10000010
765 Ga0157372_10002015
766 Ga0157372_10008435
767 Ga0157372_10015090
768 Ga0157372_10122732
769 Ga0157372_10226144
770 Ga0157375_10000313
771 Ga0157375_10010283
772 Ga0157375_10026718
773 Ga0157375_10197583
774 Ga0157375_10446316
775 Ga0163163_10008995
776 Ga0163163_10102466
777 Ga0163163_10341600
778 Ga0157380_10002002
779 Ga0157380_10002204
780 Ga0182008_10000011
781 Ga0182008_10000167
782 Ga0157377_10002686
783 Ga0157377_10006329
784 Ga0157377_10020715
785 Ga0157377_10130274
786 Ga0157379_10021385
787 Ga0157376_10018256
788 Ga0157376_10019970
789 Ga0157376_10096530
790 Ga0157376_10194995
791 Ga0182006_1000351
792 Ga0182006_1000546
793 Ga0182007_10000005
794 Ga0182005_1000126
795 Ga0183373_1002
796 Ga0163161_10000539
797 Ga0163161_10014139
798 Ga0163161_10045003
799 Ga0163161_10045496
800 Ga0163161_10057670
801 Ga0163161_10072486
802 Ga0163161_10381493
803 Ga0209437_100024
804 Ga0209258_100098
805 Ga0209646_1000009
806 Ga0209026_1000197
807 Ga0209148_1000120
808 Ga0209455_1004216
809 Ga0209673_1000016
810 Ga0209564_1006770
811 Ga0209564_1008008
812 Ga0209564_1033005
813 Ga0209758_1007651
814 Ga0209758_1008975
815 Ga0209050_1000124
816 Ga0207426_1000019
817 Ga0207426_1001572
818 Ga0207426_1003785
819 Ga0207426_1015343
820 Ga0209257_1000013
821 Ga0209257_1004094
822 Ga0207697_10019450
823 Ga0207710_10000402
824 Ga0207647_10108042
825 Ga0207647_10109719
826 Ga0207685_10044892
827 Ga0207645_10018056
828 Ga0207645_10021325
829 Ga0207643_10018405
830 Ga0207654_10016460
831 Ga0207654_10018719
832 Ga0207695_10000071
833 Ga0207695_10000084
834 Ga0207695_10000323
835 Ga0207695_10003292
836 Ga0207695_10008989
837 Ga0207695_10019711
838 Ga0207695_10021372
839 Ga0207695_10051258
840 Ga0207695_10069338
841 Ga0207695_10098375
842 Ga0207671_10002316
843 Ga0207671_10002632
844 Ga0207671_10003305
845 Ga0207671_10015269
846 Ga0207671_10023392
847 Ga0207671_10049821
848 Ga0207671_10163937
849 Ga0207671_10188304
850 Ga0207649_10001160
851 Ga0207649_10007972
852 Ga0207652_10096068
853 Ga0207681_10006598
854 Ga0207681_10052908
855 Ga0207694_10025815
856 Ga0207694_10037736
857 Ga0207650_10181671
858 Ga0207659_10044949
859 Ga0207690_10131266
860 Ga0207706_10028043
861 Ga0207706_10047114
862 Ga0207706_10057817
863 Ga0207686_10034306
864 Ga0207669_10105865
865 Ga0207704_10071969
866 Ga0207691_10043667
867 Ga0207691_10313882
868 Ga0207689_10023441
869 Ga0207689_10038084
870 Ga0207689_10104476
871 Ga0207689_10160634
872 Ga0207661_10000929
873 Ga0207661_10003201
874 Ga0207661_10006780
875 Ga0207661_10086409
876 Ga0207679_10000232
877 Ga0207679_10006857
878 Ga0207679_10111968
879 Ga0207667_10000700
880 Ga0207667_10016862
881 Ga0207667_10019514
882 Ga0207651_10104366
883 Ga0207651_10256122
884 Ga0207712_10031639
885 Ga0207640_10015517
886 Ga0207658_10084729
887 Ga0207677_10061708
888 Ga0207677_10099914
889 Ga0207703_10187578
890 Ga0207639_10001620
891 Ga0207639_10008760
892 Ga0207678_10003893
893 Ga0207702_10095614
894 Ga0207648_10001472
895 Ga0207648_10114753
896 Ga0207648_10143068
897 Ga0207674_10004099
898 Ga0207674_10009679
899 Ga0207674_10018299
900 Ga0207674_10174999
901 Ga0207675_100000507
902 Ga0207675_100109623
903 Ga0207675_100413044
904 Ga0207683_10009631
905 Ga0207698_10037738
906 Ga0207698_10161193
907 Ga0207428_10011632
908 Ga0268266_10000049
909 Ga0268266_10087352
910 Ga0268266_10156777
911 Ga0265336_10008325
912 Ga0307517_10072141
913 Ga0307515_10000001
914 Ga0307515_10000057
915 Ga0265338_10060857
916 Ga0316176_1131516
917 Ga0316183_1119247
918 Ga0316181_1277597
919 Ga0265327_10010692
920 Ga0265327_10012845
921 Ga0265316_10131388
922 Ga0307408_100000652
923 Ga0307408_100002469
924 Ga0307408_100010676
925 Ga0316576_10008737
926 Ga0316576_10158651
927 Ga0316576_10173346
928 Ga0316576_10175389
929 Ga0316578_10143502
930 Ga0307516_10002463
931 Ga0307405_10000009
932 Ga0307405_10064210
933 Ga0316577_10160475
934 Ga0307407_10000001
935 Ga0307412_10006672
936 Ga0307412_10049819
937 Ga0307416_100000026
938 Ga0307416_100139228
939 Ga0307414_10078496
940 Ga0316580_10017265
941 Ga0307510_10000217
942 Ga0373943_0053168
943 Ga0316584_0003441
944 Ga0316584_0017257
945 Ga0316584_0272203
946 Ga0395899_0000122
947 Ga0395899_0001366
948 Ga0395898_0000092
949 Ga0400489_82418
950 Ga0439431_0000264
951 Ga0439431_0020240
952 Ga0439445_0001255
953 Ga0439445_0012153
954 Ga0439449_0013451
955 Ga0439462_0001300
956 Ga0451577_0015166
957 Ga0451577_0015970
958 Ga0451577_0029962
959 Ga0466969_0021459
960 Ga0466972_0000014
961 Ga0466972_0003478
962 Ga0453683_0000045
963 Ga0453683_0000065
964 Ga0453683_0009674
965 Ga0453683_0040034
966 Ga0466965_0017189
967 Ga0466965_0058971
968 Ga0466966_0015916
969 Ga0466961_0005768
970 Ga0466964_0087437
971 Ga0453684_0000139
972 Ga0453684_0001715
973 Ga0453684_0009535
974 Ga0453684_0015427
975 Ga0453684_0039853
976 Ga0453684_0041296
977 Ga0453684_0418672
978 Ga0453684_0430841
979 Ga0466971_0000017
980 Ga0466971_0022892
981 Ga0466968_0036113
982 Ga0466968_0072231
983 Ga0466970_0000497
984 Ga0466957_0004508
985 Ga0466957_0386269
986 Ga0466959_0044132
987 Ga0451576_0000175
988 Ga0451576_0000332
989 Ga0451576_0028168
990 Ga0451576_0031235
991 Ga0451576_0031754
992 Ga0451576_0040834
993 Ga0451576_0049254
994 Ga0451576_0307657
995 Ga0451576_0494651
996 Ga0495627_014110
997 Ga0495638_0087190
998 Ga0495650_0000003
999 Ga0495650_0000036
1000 Ga0495585_0000085
1001 Ga0495607_0048433
1002 Ga0495607_0108255
1003 Ga0495606_0000145
1004 Ga0495606_0007477
1005 Ga0495606_0051107
1006 Ga0495610_0000501
1007 Ga0495610_0002148
1008 Ga0495616_0000925
1009 Ga0495616_0002395
1010 Ga0495632_0008321
1011 Ga0495644_0029151
1012 Ga0495648_0003858
1013 Ga0495663_0000792
1014 Ga0495587_0019759
1015 Ga0495609_0000134
1016 Ga0495633_0000008
1017 Ga0495633_0000059
1018 Ga0495633_0018245
1019 Ga0495611_0000090
1020 Ga0495625_0000005
1021 Ga0495625_0004302
1022 Ga0495625_0014249
1023 Ga0495625_0060198
1024 Ga0495625_0159923
1025 Ga0495661_0000563
1026 Ga0495661_0006086
1027 Ga0495671_0085546
1028 Ga0495649_0000003
1029 Ga0495672_0033244
1030 Ga0495687_053978
1031 Ga0495686_0000004
1032 Ga0495686_0000367
1033 Ga0495686_0000416
1034 Ga0495686_0193243
1035 Ga0496115_0267909
1036 Ga0496121_0000007
1037 Ga0496125_0003355
1038 Ga0496126_0043806
1039 Ga0495678_020300
1040 Ga0495678_021013
1041 Ga0501298_003226
1042 Ga0501031_0001157
1043 Ga0501033_0000271
1044 Ga0501034_0049620
1045 Ga0501037_0000116
1046 Ga0501038_0000976
1047 Ga0501038_0023894
1048 Ga0501043_0000342
1049 Ga0501043_0009056
1050 Ga0501047_0001211
1051 Ga0501047_0124423
1052 Ga0501047_0212029
1053 Ga0501072_0167356
1054 Ga0501201_004618
1055 Ga0501206_004609
1056 Ga0501207_010837
1057 Ga0501223_001164
1058 Ga0501224_000321
1059 Ga0501243_000295
1060 Ga0501259_003357
1061 Ga0501221_002035
1062 Ga0501245_002439
1063 Ga0501080_0159161
1064 Ga0501241_015421
1065 Ga0501035_0001096
1066 Ga0501044_0001911
1067 Ga0501212_008926
1068 Ga0501284_00021
1069 nmdc:mga0k408_145968_c1
1070 nmdc:mga0k408_183016_c1
1071 nmdc:mga08y16_44554_c1
1072 Ga0500644_0000456
1073 Ga0500581_101317
1074 Ga0500583_0000188
1075 Ga0500583_0027729
1076 Ga0500651_0017407
1077 Ga0500556_0074638
1078 Ga0500562_000095
1079 Ga0500569_000462
1080 Ga0500607_133289
1081 Ga0500652_030512
1082 Ga0500658_0042859
1083 Ga0500568_0000236
1084 Ga0500577_0002874
1085 Ga0500616_0031050
1086 Ga0500622_0000110
1087 Ga0500622_0001046
1088 Ga0500622_0004430
1089 Ga0500624_000158
1090 Ga0500645_036127
1091 Ga0466962_0000031
1092 2524005864
1093 2587942854
1094 2588233411
1095 2599477720
1096 2738854996
1097 2739614805
1098 2739646254
1099 2819547352
1100 2819590940
1101 2821138240
1102 2842727663
1103 2842905518
1104 2842911132
1105 2849283086
1106 2857631930
1107 2881248749
1108 2884796379
1109 2890738902
1110 2896088552
1111 2896321177
1112 2898714728
1113 2904447818
1114 2904469036
1115 2910249689
1116 2911140970
1117 2914763161
1118 2919441677
1119 2928079636
1120 2928147887
1121 2929156048
1122 2929158225
1123 2929242919
1124 2929924401
1125 2932086738
1126 2954020208
1127 2958515497
1128 2965320390
1129 2977246152
1130 3003234179
1131 8003155371

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

57

367

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9176 2 315
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.9083 3 318
6ow0-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg 0.9081 1 315
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9066 2 315
6ovq-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw 0.9056 1 315
ID Description Score Start End Superfamily
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9279 1 319 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9195 1 319 3.20.20.100
3n2tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9083 3 318 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9064 2 315 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9008 2 315 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 0.9903 129 212 GO:0004033
GO:0005737
AF-A0A7J8U949-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9818 104 212 GO:0004033
GO:0005737
GO:0016020
AF-A0A3N5LA91-F1-model_v4 Aldo/keto reductase 0.97 107 318 GO:0005829
GO:0016491
AF-A0A7K3IUI4-F1-model_v4 Aldo/keto reductase 0.9655 1 178 GO:0005829
AF-A0A660TTQ9-F1-model_v4 Aldo/keto reductase 0.9613 1 321 GO:0005829
GO:0016491

Map