F464303

General Info

Members Datasets Scaffolds Average Seq Length
565 355 504 319

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0013013|Ga0495661_0013013_4105_5052
Length 315
Sequence MEKRALGRSGINVLPFAFGGNVFGWTADEKTSFGLLDAFVDYGFNFIDTADVYSRWVPGNKGGESETIIGNWLKQGSKRDKVVLATKVGKPMDGKKGLSKAYITKAIEDSLMRLQTDYIDLYQSHDDDKDTPLAETLETYTDLIKQGKVRAIGASNYSAARLREALQVSKDNGFARYESLQPEYNLYDREEYEKQYESLCRENNLGVITFYSLASGFLTGKYRSEADLNKSPRGEGINKYLNRRGYRILAALDKVAGEYNTTPGSIALAWVMARPGITAPIASATSVHQLKELTKAAQIELSGESITLLTTASNY

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221570 Acidovorax sp. Root568 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
18 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
19 2721755523 Delftia sp. HK171 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738543012 Acidovorax sp. CF301 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
24 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
25 2816332133 Acidovorax radicis 2721A Isolate Unclassified
26 2818991446 Variovorax sp. 1180 Isolate Unclassified
27 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
28 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
29 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
30 2842677519 Variovorax sp. R-72495 Isolate Unclassified
31 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
32 2842733646 Variovorax sp. R-72446 Isolate Unclassified
33 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
34 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
35 2885198086 Variovorax sp. 679 Isolate Unclassified
36 2885211737 Variovorax sp. 553 Isolate Unclassified
37 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
38 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
39 2899924645 Variovorax sp. 369 Isolate Unclassified
40 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
41 2904456579 Variovorax sp. 2002 Isolate Unclassified
42 2928037797 Variovorax sp. 1126 Isolate Unclassified
43 2928044640 Variovorax sp. 1128 Isolate Unclassified
44 2928051484 Variovorax sp. 1133 Isolate Unclassified
45 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
46 2928070936 Variovorax gossypii 1167 Isolate Unclassified
47 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
48 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
49 2929520902 Variovorax beijingensis 502 Isolate Unclassified
50 2932406140 Serratia sp. 2723 Isolate Rhizosphere
51 2937967321 Serratia sp. YC16 Isolate Unclassified
52 2939577877 Serratia sp. 509 Isolate Rhizosphere
53 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
54 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
55 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
56 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
57 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
64 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
65 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
66 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
69 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
70 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
71 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
72 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
73 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
78 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
82 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
83 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
84 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
85 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
86 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
87 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
219 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
247 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
248 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
251 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
252 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
253 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
256 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
257 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
258 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
259 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
260 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
261 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
264 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
265 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
317 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
318 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
336 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
337 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
338 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
339 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
340 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
341 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
342 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
343 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
347 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
350 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 640753048 Serratia proteamaculans 568 Isolate Endosphere
353 8004592986 Serratia sp. S119 Isolate Unclassified
354 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
355 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.85
Metatranscriptomes 0.35
Isolates 10.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.6
Nodule 1.24
Rhizoplane 3.01
Rhizosphere 56.81
Stem 0
Stem Tuber 0
Unclassified 14.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1002301 3300002774 Bacteria 4821
2 JGI25159J45721_1001672 3300002987 Bacteria 8991
3 JGI25159J45721_1001917 3300002987 Bacteria 8311
4 JGI25151J46595_10003212 3300003187 Bacteria 9153
5 JGI25151J46595_10006407 3300003187 Bacteria 5916
6 JGI25153J46596_10003239 3300003215 Bacteria 9153
7 rootH1_10027782 3300003323 Bacteria 4781
8 JGI25161J50226_1001619 3300003374 Bacteria 6538
9 Ga0006562J51391_1094507 3300003578 Bacteria 2610
10 Ga0006562J51391_1130105 3300003578 Bacteria 1890
11 Ga0055535_1001094 3300003761 Bacteria 16519
12 Ga0055542_1000027 3300003762 Bacteria 254819
13 Ga0055526_1005805 3300003771 Bacteria 6951
14 Ga0055537_1001222 3300003773 Bacteria 10812
15 Ga0055537_1002045 3300003773 Bacteria 7119
16 Ga0055524_1004001 3300003775 Bacteria 6951
17 Ga0055524_1004006 3300003775 Bacteria 6948
18 Ga0055536_1004940 3300003781 Bacteria 6643
19 Ga0055536_1006555 3300003781 Bacteria 5401
20 Ga0055534_1000238 3300003784 Bacteria 39258
21 Ga0055534_1001493 3300003784 Bacteria 9252
22 Ga0055534_1001510 3300003784 Bacteria 9153
23 Ga0055528_1002788 3300003790 Bacteria 9153
24 Ga0055528_1004495 3300003790 Bacteria 6712
25 Ga0055528_1011778 3300003790 Bacteria 3443
26 Ga0055530_10001348 3300003791 Bacteria 18336
27 Ga0055530_10001422 3300003791 Bacteria 17574
28 Ga0055540_1001616 3300003792 Bacteria 13119
29 Ga0055540_1003222 3300003792 Bacteria 8004
30 Ga0055540_1010688 3300003792 Bacteria 3033
31 Ga0055531_10002054 3300003794 Bacteria 13887
32 Ga0065165_1004145 3300005262 Bacteria 9301
33 Ga0065703_1019924 3300005272 Bacteria 2254
34 Ga0065714_10004820 3300005288 Bacteria 10820
35 Ga0065704_10188423 3300005289 Bacteria 1201
36 Ga0070658_10088103 3300005327 Bacteria 2556
37 Ga0070676_10002418 3300005328 Bacteria 9572
38 Ga0070683_100429532 3300005329 Bacteria 1260
39 Ga0070670_100006355 3300005331 Bacteria 10000
40 Ga0070670_100066092 3300005331 Bacteria 3102
41 Ga0068869_100016845 3300005334 Bacteria 4939
42 Ga0068869_100031902 3300005334 Bacteria 3710
43 Ga0068869_100033455 3300005334 Bacteria 3629
44 Ga0070666_10002405 3300005335 Bacteria 11320
45 Ga0068868_100003706 3300005338 Bacteria 10675
46 Ga0068868_100124010 3300005338 Bacteria 2109
47 Ga0070660_100091111 3300005339 Bacteria 2404
48 Ga0070661_100193780 3300005344 Bacteria 1550
49 Ga0070661_100201114 3300005344 Bacteria 1522
50 Ga0070669_100008394 3300005353 Bacteria 7371
51 Ga0070669_100230772 3300005353 Bacteria 1467
52 Ga0070675_100031170 3300005354 Bacteria 4309
53 Ga0070675_100040074 3300005354 Bacteria 3823
54 Ga0070675_100070491 3300005354 Bacteria 2897
55 Ga0070671_100010921 3300005355 Bacteria 7293
56 Ga0070671_100012199 3300005355 Bacteria 6916
57 Ga0070674_100002083 3300005356 Bacteria 10952
58 Ga0070673_100003618 3300005364 Bacteria 9672
59 Ga0070673_100042803 3300005364 Bacteria 3494
60 Ga0070673_100355120 3300005364 Bacteria 1302
61 Ga0070659_100014864 3300005366 Bacteria 5821
62 Ga0070659_100060678 3300005366 Bacteria 2987
63 Ga0070667_100000704 3300005367 Bacteria 32289
64 Ga0070667_100211075 3300005367 Bacteria 1725
65 Ga0070663_100045964 3300005455 Bacteria 3086
66 Ga0070678_100008953 3300005456 Bacteria 6030
67 Ga0070678_100016273 3300005456 Bacteria 4752
68 Ga0070678_100032929 3300005456 Bacteria 3593
69 Ga0070662_100001568 3300005457 Bacteria 14134
70 Ga0070662_100012451 3300005457 Bacteria 5642
71 Ga0070662_100027647 3300005457 Bacteria 3940
72 Ga0070662_100053455 3300005457 Bacteria 2923
73 Ga0068867_100003310 3300005459 Bacteria 11351
74 Ga0068867_100010203 3300005459 Bacteria 6625
75 Ga0070684_100179894 3300005535 Bacteria 1922
76 Ga0068853_100003807 3300005539 Bacteria 11561
77 Ga0068853_100010853 3300005539 Bacteria 7380
78 Ga0068853_100320949 3300005539 Bacteria 1436
79 Ga0070672_100002369 3300005543 Bacteria 11933
80 Ga0070672_100007542 3300005543 Bacteria 7391
81 Ga0070672_100017976 3300005543 Bacteria 5100
82 Ga0070665_100088829 3300005548 Bacteria 3096
83 Ga0068855_100051011 3300005563 Bacteria 4874
84 Ga0070664_100003355 3300005564 Bacteria 12948
85 Ga0070664_100052960 3300005564 Bacteria 3439
86 Ga0068857_100015530 3300005577 Bacteria 6652
87 Ga0068854_100135965 3300005578 Bacteria 1881
88 Ga0068854_100157963 3300005578 Bacteria 1754
89 Ga0068852_100059134 3300005616 Bacteria 3323
90 Ga0068859_100019868 3300005617 Bacteria 6744
91 Ga0068859_100218447 3300005617 Bacteria 1994
92 Ga0068864_100012237 3300005618 Bacteria 7090
93 Ga0068864_100039169 3300005618 Bacteria 4050
94 Ga0068864_100159054 3300005618 Bacteria 2052
95 Ga0068861_100005261 3300005719 Bacteria 8725
96 Ga0068861_100072266 3300005719 Bacteria 2676
97 Ga0068851_10018636 3300005834 Bacteria 3346
98 Ga0068851_10120288 3300005834 Bacteria 1410
99 Ga0068863_100004117 3300005841 Bacteria 14372
100 Ga0068863_100039467 3300005841 Bacteria 4491
101 Ga0068863_100172358 3300005841 Bacteria 2076
102 Ga0068863_100239654 3300005841 Bacteria 1751
103 Ga0068858_100008391 3300005842 Bacteria 9937
104 Ga0068858_100074829 3300005842 Bacteria 3145
105 Ga0068860_100017641 3300005843 Bacteria 6955
106 Ga0068862_100135171 3300005844 Bacteria 2185
107 Ga0075365_10006402 3300006038 Bacteria 6479
108 Ga0075363_100015111 3300006048 Bacteria 3787
109 Ga0075363_100127509 3300006048 Bacteria 1426
110 Ga0075364_10009723 3300006051 Bacteria 5780
111 Ga0075364_10047953 3300006051 Bacteria 2783
112 Ga0075364_10121967 3300006051 Bacteria 1745
113 Ga0075432_10003950 3300006058 Bacteria 5053
114 Ga0075362_10065514 3300006177 Bacteria 1650
115 Ga0075367_10060832 3300006178 Bacteria 2253
116 Ga0075366_10012524 3300006195 Bacteria 4812
117 Ga0075366_10133949 3300006195 Bacteria 1496
118 Ga0097621_100038353 3300006237 Bacteria 3844
119 Ga0075370_10001047 3300006353 Bacteria 11498
120 Ga0075370_10026096 3300006353 Bacteria 3234
121 Ga0075370_10051980 3300006353 Bacteria 2324
122 Ga0068871_100083388 3300006358 Bacteria 2651
123 Ga0097620_100019867 3300006931 Bacteria 6744
124 Ga0097620_100218452 3300006931 Bacteria 1994
125 Ga0079104_1000007 3300006946 Bacteria 390531
126 Ga0079104_1002938 3300006946 Bacteria 8446
127 Ga0099826_10005293 3300006948 Bacteria 9213
128 Ga0105251_10000160 3300009011 Bacteria 68873
129 Ga0105251_10000245 3300009011 Bacteria 54760
130 Ga0105251_10002163 3300009011 Bacteria 15759
131 Ga0105244_10001915 3300009036 Bacteria 16163
132 Ga0105244_10002722 3300009036 Bacteria 13216
133 Ga0105250_10002671 3300009092 Bacteria 8838
134 Ga0105250_10118172 3300009092 Bacteria 1089
135 Ga0105240_10127430 3300009093 Bacteria 3057
136 Ga0105240_10425312 3300009093 Bacteria 1491
137 Ga0105245_10161423 3300009098 Bacteria 2127
138 Ga0105245_10209111 3300009098 Bacteria 1877
139 Ga0105247_10000069 3300009101 Bacteria 116730
140 Ga0105243_10000527 3300009148 Bacteria 38948
141 Ga0105243_10013309 3300009148 Bacteria 6221
142 Ga0105243_10023262 3300009148 Bacteria 4716
143 Ga0105241_10000011 3300009174 Bacteria 243033
144 Ga0105242_10005022 3300009176 Bacteria 10221
145 Ga0105248_10047609 3300009177 Bacteria 4809
146 Ga0105248_10385755 3300009177 Bacteria 1577
147 Ga0105237_10240781 3300009545 Bacteria 1810
148 Ga0157373_10027562 3300013100 Bacteria 4099
149 Ga0157373_10037241 3300013100 Bacteria 3488
150 Ga0157374_10071534 3300013296 Bacteria 3270
151 Ga0157374_10154679 3300013296 Bacteria 2231
152 Ga0163162_10041320 3300013306 Bacteria 4613
153 Ga0163162_10175605 3300013306 Bacteria 2268
154 Ga0163162_10795717 3300013306 Bacteria 1063
155 Ga0157372_10028646 3300013307 Bacteria 6080
156 Ga0157375_10005659 3300013308 Bacteria 10875
157 Ga0157375_10079537 3300013308 Bacteria 3314
158 Ga0157375_10280324 3300013308 Bacteria 1830
159 Ga0163163_10084600 3300014325 Bacteria 3178
160 Ga0157380_10005275 3300014326 Bacteria 9033
161 Ga0182008_10001938 3300014497 Bacteria 13360
162 Ga0182008_10003595 3300014497 Bacteria 9279
163 Ga0182008_10006037 3300014497 Bacteria 6814
164 Ga0182008_10009482 3300014497 Bacteria 5251
165 Ga0157377_10003608 3300014745 Bacteria 7010
166 Ga0157379_10004639 3300014968 Bacteria 11791
167 Ga0157379_10018238 3300014968 Bacteria 6185
168 Ga0157379_10076887 3300014968 Bacteria 2989
169 Ga0182006_1001492 3300015261 Bacteria 14052
170 Ga0182007_10001047 3300015262 Bacteria 15155
171 Ga0182005_1050276 3300015265 Bacteria 1133
172 Ga0163161_10000005 3300017792 Bacteria 327860
173 Ga0163161_10000065 3300017792 Bacteria 108321
174 Ga0163161_10009786 3300017792 Bacteria 6643
175 Ga0163161_10027711 3300017792 Bacteria 4020
176 Ga0163161_10136508 3300017792 Bacteria 1854
177 Ga0209672_100563 3300025228 Bacteria 19696
178 Ga0209147_101025 3300025229 Bacteria 11908
179 Ga0209258_100048 3300025242 Bacteria 365881
180 Ga0207425_1000275 3300025245 Bacteria 37897
181 Ga0207425_1001625 3300025245 Bacteria 9068
182 Ga0209148_1000040 3300025254 Bacteria 473531
183 Ga0209129_1000007 3300025258 Bacteria 771325
184 Ga0209565_1000085 3300025263 Bacteria 153075
185 Ga0209565_1000105 3300025263 Bacteria 122895
186 Ga0209565_1001643 3300025263 Bacteria 9391
187 Ga0209673_1000739 3300025273 Bacteria 45015
188 Ga0209673_1000794 3300025273 Bacteria 42072
189 Ga0209673_1001648 3300025273 Bacteria 19319
190 Ga0209673_1002152 3300025273 Bacteria 14596
191 Ga0209130_1000172 3300025284 Bacteria 93199
192 Ga0209130_1000329 3300025284 Bacteria 54511
193 Ga0209675_1000083 3300025291 Bacteria 153075
194 Ga0209675_1001275 3300025291 Bacteria 15058
195 Ga0209675_1001400 3300025291 Bacteria 13998
196 Ga0209675_1003832 3300025291 Bacteria 6936
197 Ga0209676_1000004 3300025292 Bacteria 1138360
198 Ga0209676_1001472 3300025292 Bacteria 21882
199 Ga0209025_1000111 3300025294 Bacteria 218982
200 Ga0209025_1003136 3300025294 Bacteria 16165
201 Ga0209025_1009274 3300025294 Bacteria 6891
202 Ga0209025_1018926 3300025294 Bacteria 3866
203 Ga0209564_1000153 3300025295 Bacteria 166910
204 Ga0209564_1000337 3300025295 Bacteria 90545
205 Ga0209758_1000025 3300025297 Bacteria 586687
206 Ga0209758_1003925 3300025297 Bacteria 12968
207 Ga0209050_1000002 3300025298 Bacteria 1792849
208 Ga0209050_1000412 3300025298 Bacteria 79647
209 Ga0209050_1003041 3300025298 Bacteria 12935
210 Ga0209256_1000425 3300025299 Bacteria 66308
211 Ga0209256_1001308 3300025299 Bacteria 26755
212 Ga0207426_1000001 3300025302 Bacteria 1341301
213 Ga0207426_1000028 3300025302 Bacteria 483955
214 Ga0209051_1000002 3300025303 Bacteria 1631846
215 Ga0209051_1000150 3300025303 Bacteria 132005
216 Ga0209051_1000268 3300025303 Bacteria 87155
217 Ga0209051_1030908 3300025303 Bacteria 2070
218 Ga0209257_1000002 3300025304 Bacteria 1767052
219 Ga0209257_1000275 3300025304 Bacteria 116952
220 Ga0209257_1003064 3300025304 Bacteria 15069
221 Ga0207656_10020715 3300025321 Bacteria 2616
222 Ga0207696_1000039 3300025711 Bacteria 324954
223 Ga0207655_1000078 3300025728 Bacteria 219360
224 Ga0207655_1000936 3300025728 Bacteria 30274
225 Ga0207713_1000095 3300025735 Bacteria 145778
226 Ga0207713_1000248 3300025735 Bacteria 68881
227 Ga0207713_1007817 3300025735 Bacteria 6236
228 Ga0207710_10000026 3300025900 Bacteria 307644
229 Ga0207680_10005119 3300025903 Bacteria 6250
230 Ga0207645_10001701 3300025907 Bacteria 17857
231 Ga0207645_10003951 3300025907 Bacteria 11066
232 Ga0207643_10072022 3300025908 Bacteria 1990
233 Ga0207643_10112817 3300025908 Bacteria 1603
234 Ga0207654_10000012 3300025911 Bacteria 243044
235 Ga0207695_10195958 3300025913 Bacteria 1936
236 Ga0207671_10104908 3300025914 Bacteria 2144
237 Ga0207657_10248338 3300025919 Bacteria 1419
238 Ga0207681_10001915 3300025923 Bacteria 13327
239 Ga0207681_10028047 3300025923 Bacteria 3645
240 Ga0207681_10176884 3300025923 Bacteria 1622
241 Ga0207681_10347761 3300025923 Bacteria 1186
242 Ga0207694_10165034 3300025924 Bacteria 1791
243 Ga0207650_10001268 3300025925 Bacteria 18324
244 Ga0207659_10007870 3300025926 Bacteria 6589
245 Ga0207659_10030120 3300025926 Bacteria 3704
246 Ga0207659_10213866 3300025926 Bacteria 1547
247 Ga0207687_10216999 3300025927 Bacteria 1504
248 Ga0207644_10018779 3300025931 Bacteria 4682
249 Ga0207644_10039452 3300025931 Bacteria 3333
250 Ga0207644_10110811 3300025931 Bacteria 2075
251 Ga0207690_10101840 3300025932 Bacteria 2052
252 Ga0207706_10010789 3300025933 Bacteria 8340
253 Ga0207706_10013403 3300025933 Bacteria 7454
254 Ga0207706_10090982 3300025933 Bacteria 2683
255 Ga0207686_10013047 3300025934 Bacteria 4588
256 Ga0207709_10000193 3300025935 Bacteria 81025
257 Ga0207709_10000815 3300025935 Bacteria 24134
258 Ga0207709_10023429 3300025935 Bacteria 3513
259 Ga0207669_10003488 3300025937 Bacteria 6802
260 Ga0207669_10148012 3300025937 Bacteria 1640
261 Ga0207704_10009676 3300025938 Bacteria 4664
262 Ga0207691_10012729 3300025940 Bacteria 8059
263 Ga0207691_10014538 3300025940 Bacteria 7508
264 Ga0207691_10103610 3300025940 Bacteria 2537
265 Ga0207691_10113800 3300025940 Bacteria 2404
266 Ga0207691_10137124 3300025940 Bacteria 2157
267 Ga0207689_10000169 3300025942 Bacteria 57089
268 Ga0207689_10033478 3300025942 Bacteria 4270
269 Ga0207689_10096495 3300025942 Bacteria 2428
270 Ga0207679_10058648 3300025945 Bacteria 2853
271 Ga0207679_10254093 3300025945 Bacteria 1496
272 Ga0207667_10025900 3300025949 Bacteria 6416
273 Ga0207667_10043414 3300025949 Bacteria 4771
274 Ga0207651_10031449 3300025960 Bacteria 3393
275 Ga0207712_10001833 3300025961 Bacteria 14012
276 Ga0207668_10033809 3300025972 Bacteria 3389
277 Ga0207658_10000319 3300025986 Bacteria 48401
278 Ga0207658_10000336 3300025986 Bacteria 47108
279 Ga0207658_10193592 3300025986 Bacteria 1692
280 Ga0207677_10126370 3300026023 Bacteria 1933
281 Ga0207677_10148077 3300026023 Bacteria 1807
282 Ga0207703_10000866 3300026035 Bacteria 29661
283 Ga0207703_10041846 3300026035 Bacteria 3673
284 Ga0207639_10049794 3300026041 Bacteria 3178
285 Ga0207639_10088328 3300026041 Bacteria 2473
286 Ga0207639_10286129 3300026041 Bacteria 1452
287 Ga0207678_10066914 3300026067 Bacteria 3084
288 Ga0207678_10171266 3300026067 Bacteria 1854
289 Ga0207708_10044572 3300026075 Bacteria 3380
290 Ga0207641_10105586 3300026088 Bacteria 2488
291 Ga0207641_10164498 3300026088 Bacteria 2019
292 Ga0207648_10005619 3300026089 Bacteria 12603
293 Ga0207648_10061941 3300026089 Bacteria 3262
294 Ga0207648_10183558 3300026089 Bacteria 1852
295 Ga0207676_10365622 3300026095 Bacteria 1338
296 Ga0207674_10028128 3300026116 Bacteria 5937
297 Ga0207675_100002188 3300026118 Bacteria 19420
298 Ga0207675_100012833 3300026118 Bacteria 7825
299 Ga0207683_10008144 3300026121 Bacteria 8966
300 Ga0207683_10051541 3300026121 Bacteria 3606
301 Ga0207683_10093516 3300026121 Bacteria 2679
302 Ga0207683_10167565 3300026121 Bacteria 1988
303 Ga0207698_10015587 3300026142 Bacteria 5095
304 Ga0209281_1000020 3300027111 Bacteria 575972
305 Ga0209281_1000315 3300027111 Bacteria 86052
306 Ga0209282_1006872 3300027666 Bacteria 7099
307 Ga0268266_10007234 3300028379 Bacteria 10040
308 Ga0268264_10001554 3300028381 Bacteria 21267
309 Ga0268264_10057685 3300028381 Bacteria 3248
310 Ga0268264_10115515 3300028381 Bacteria 2358
311 Ga0307517_10000671 3300028786 Bacteria 58755
312 Ga0307517_10163755 3300028786 Bacteria 1484
313 Ga0307515_10000398 3300028794 Bacteria 105087
314 Ga0307515_10036077 3300028794 Bacteria 8015
315 Ga0307515_10221760 3300028794 Bacteria 1707
316 Ga0307515_10272714 3300028794 Bacteria 1410
317 Ga0307512_10074569 3300030522 Bacteria 2490
318 Ga0307512_10119862 3300030522 Bacteria 1696
319 Ga0307513_10317910 3300031456 Bacteria 1316
320 Ga0307513_10346445 3300031456 Bacteria 1235
321 Ga0307509_10000041 3300031507 Bacteria 182302
322 Ga0307509_10085522 3300031507 Bacteria 3245
323 Ga0307509_10088275 3300031507 Bacteria 3183
324 Ga0307408_100021890 3300031548 Bacteria 4334
325 Ga0307408_100116104 3300031548 Bacteria 2065
326 Ga0307508_10088449 3300031616 Bacteria 2681
327 Ga0307514_10000384 3300031649 Bacteria 101117
328 Ga0307514_10064361 3300031649 Bacteria 2781
329 Ga0307514_10077514 3300031649 Bacteria 2472
330 Ga0307516_10006738 3300031730 Bacteria 13428
331 Ga0307405_10188146 3300031731 Bacteria 1488
332 Ga0307518_10115606 3300031838 Bacteria 1906
333 Ga0307406_10001910 3300031901 Bacteria 11355
334 Ga0307412_10019012 3300031911 Bacteria 4149
335 Ga0307412_10269268 3300031911 Bacteria 1332
336 Ga0307411_10008863 3300032005 Bacteria 5243
337 Ga0307411_10286119 3300032005 Bacteria 1314
338 Ga0307510_10031904 3300033180 Bacteria 5942
339 Ga0307510_10052365 3300033180 Bacteria 4304
340 Ga0373932_0067632 3300035112 Bacteria 1100
341 Ga0373931_0037257 3300035691 Bacteria 2539
342 Ga0373931_0049439 3300035691 Bacteria 2233
343 Ga0373933_0039769 3300035724 Bacteria 2768
344 Ga0373937_0049070 3300036401 Bacteria 3866
345 Ga0373925_0044453 3300037068 Bacteria 3298
346 Ga0395900_0041114 3300037418 Bacteria 4767
347 Ga0395905_0061230 3300037471 Bacteria 3520
348 Ga0395905_0385987 3300037471 Bacteria 1295
349 Ga0395901_0163432 3300038443 Bacteria 2338
350 Ga0436365_1804558 3300039437 Bacteria 4403
351 Ga0439436_0006478 3300041404 Bacteria 3594
352 Ga0439447_005267 3300041407 Bacteria 4317
353 Ga0439466_0003403 3300041411 Bacteria 6172
354 Ga0439466_0013561 3300041411 Bacteria 2982
355 Ga0439465_0000712 3300041413 Bacteria 10232
356 Ga0439465_0008347 3300041413 Bacteria 3269
357 Ga0439431_0002353 3300041997 Bacteria 4180
358 Ga0439431_0008122 3300041997 Bacteria 2353
359 Ga0439433_0038139 3300041999 Bacteria 1114
360 Ga0439442_004069 3300042002 Bacteria 2900
361 Ga0439442_006940 3300042002 Bacteria 2274
362 Ga0439432_000606 3300042006 Bacteria 13478
363 Ga0439449_0002472 3300042007 Bacteria 7225
364 Ga0439452_000862 3300042010 Bacteria 14047
365 Ga0439457_002355 3300042014 Bacteria 5422
366 Ga0439462_0006005 3300042015 Bacteria 3006
367 Ga0450906_000430 3300042145 Bacteria 8707
368 Ga0450910_003057 3300042147 Bacteria 2208
369 Ga0439446_0004107 3300042156 Bacteria 3670
370 Ga0439446_0017696 3300042156 Bacteria 1993
371 Ga0450908_001174 3300042184 Bacteria 5071
372 Ga0439434_0001058 3300042435 Bacteria 7985
373 Ga0439434_0001092 3300042435 Bacteria 7857
374 Ga0450918_007281 3300042531 Bacteria 1961
375 Ga0453683_0197176 3300044673 Bacteria 1278
376 Ga0495627_000086 3300046453 Bacteria 111555
377 Ga0495627_004247 3300046453 Bacteria 6048
378 Ga0495592_0000028 3300046454 Bacteria 132590
379 Ga0495638_0071908 3300046460 Bacteria 2115
380 Ga0495582_0073993 3300046473 Bacteria 1886
381 Ga0495610_0018669 3300046512 Bacteria 3907
382 Ga0495616_0024125 3300046513 Bacteria 3265
383 Ga0495620_0006408 3300046515 Bacteria 6469
384 Ga0495630_0026345 3300046517 Bacteria 4304
385 Ga0495631_0002075 3300046518 Bacteria 11654
386 Ga0495637_0000813 3300046520 Bacteria 20603
387 Ga0495654_0055841 3300046530 Bacteria 1910
388 Ga0495621_0008005 3300046539 Bacteria 3150
389 Ga0495633_0000704 3300046558 Bacteria 30526
390 Ga0495656_0017190 3300046615 Bacteria 2757
391 Ga0495625_0000436 3300046660 Bacteria 62756
392 Ga0495625_0094615 3300046660 Bacteria 2061
393 Ga0495625_0192655 3300046660 Bacteria 1349
394 Ga0495661_0013013 3300046665 Bacteria 5605
395 Ga0495588_0025000 3300046674 Bacteria 2972
396 Ga0495588_0043387 3300046674 Bacteria 2301
397 Ga0495647_0014787 3300046681 Bacteria 2724
398 Ga0495658_0021825 3300046683 Bacteria 3380
399 Ga0495658_0098318 3300046683 Bacteria 1743
400 Ga0495613_0196957 3300046689 Bacteria 1422
401 Ga0495624_0007203 3300046690 Bacteria 7824
402 Ga0495670_0014693 3300046691 Bacteria 3851
403 Ga0495671_0003738 3300046692 Bacteria 9258
404 Ga0495589_0000032 3300046794 Bacteria 167736
405 Ga0495676_0015888 3300047321 Bacteria 6690
406 Ga0495676_0021618 3300047321 Bacteria 5613
407 Ga0495680_0086877 3300047322 Bacteria 2353
408 Ga0495684_0062759 3300047471 Bacteria 2826
409 Ga0495593_0028737 3300047673 Bacteria 3053
410 Ga0495614_0006658 3300048089 Bacteria 5172
411 Ga0496100_0176063 3300048903 Bacteria 1544
412 Ga0496101_0044399 3300048904 Bacteria 3180
413 Ga0496101_0052670 3300048904 Bacteria 2935
414 Ga0496102_0143142 3300048905 Bacteria 2243
415 Ga0496105_0228407 3300048908 Bacteria 1513
416 Ga0496106_0012295 3300048909 Bacteria 6317
417 Ga0496107_0094258 3300048910 Bacteria 2190
418 Ga0496108_0031835 3300048911 Bacteria 4378
419 Ga0496108_0584712 3300048911 Bacteria 973
420 Ga0496109_0175510 3300048912 Bacteria 2011
421 Ga0496111_0077713 3300048914 Bacteria 2420
422 Ga0496114_0170439 3300048917 Bacteria 1897
423 Ga0496114_0338353 3300048917 Bacteria 1331
424 Ga0496115_0059410 3300048918 Bacteria 3079
425 Ga0496116_0000007 3300048919 Bacteria 795464
426 Ga0496117_0006437 3300048920 Bacteria 11885
427 Ga0496117_0031905 3300048920 Bacteria 4014
428 Ga0496117_0096214 3300048920 Bacteria 1889
429 Ga0496118_0004930 3300048921 Bacteria 15491
430 Ga0496118_0009889 3300048921 Bacteria 9537
431 Ga0496118_0115910 3300048921 Bacteria 1762
432 Ga0496119_0004951 3300048922 Bacteria 13017
433 Ga0496119_0005544 3300048922 Bacteria 12020
434 Ga0496119_0018943 3300048922 Bacteria 5098
435 Ga0496120_0000494 3300048923 Bacteria 61684
436 Ga0496120_0000636 3300048923 Bacteria 52284
437 Ga0496121_0100218 3300048924 Bacteria 2236
438 Ga0496122_0000592 3300048925 Bacteria 74496
439 Ga0496122_0052837 3300048925 Bacteria 3070
440 Ga0496123_0000656 3300048926 Bacteria 57313
441 Ga0496123_0100753 3300048926 Bacteria 1682
442 Ga0496124_0000049 3300048927 Bacteria 269753
443 Ga0496124_0043730 3300048927 Bacteria 3848
444 Ga0496124_0167122 3300048927 Bacteria 1708
445 Ga0496125_0008806 3300048928 Bacteria 10495
446 Ga0496125_0061223 3300048928 Bacteria 3020
447 Ga0496126_0088363 3300048929 Bacteria 2730
448 Ga0501249_001764 3300049679 Bacteria 4406
449 Ga0501225_0004773 3300049705 Bacteria 4016
450 Ga0501262_000262 3300049759 Bacteria 6380
451 Ga0501035_0021126 3300049822 Bacteria 5984
452 nmdc:mga03683_21797_c1 3300050489 Bacteria 2476
453 nmdc:mga03683_2781_c1 3300050489 Bacteria 2033
454 nmdc:mga03683_89709_c1 3300050489 Bacteria 1339
455 nmdc:mga03n38_14111_c1 3300050490 Bacteria 3055
456 nmdc:mga03n38_17188_c1 3300050490 Bacteria 2828
457 nmdc:mga03n38_7506_c1 3300050490 Bacteria 3862
458 nmdc:mga00v17_13671_c1 3300050491 Bacteria 4512
459 nmdc:mga00v17_50123_c1 3300050491 Bacteria 2535
460 nmdc:mga00v17_58069_c1 3300050491 Bacteria 2369
461 nmdc:mga0yw44_2444_c1 3300050492 Bacteria 7923
462 nmdc:mga0k408_166751_c1 3300050493 Bacteria 1312
463 nmdc:mga0k408_203511_c1 3300050493 Bacteria 1182
464 nmdc:mga0k408_268541_c1 3300050493 Bacteria 1018
465 nmdc:mga0k408_2988_c1 3300050493 Bacteria 8964
466 nmdc:mga0k408_42720_c1 3300050493 Bacteria 2611
467 nmdc:mga0k408_45942_c1 3300050493 Bacteria 2521
468 nmdc:mga06z11_65157_c1 3300050494 Bacteria 1911
469 nmdc:mga07m45_109094_c1 3300050496 Bacteria 1593
470 nmdc:mga07m45_1225_c1 3300050496 Bacteria 11621
471 Ga0495601_0015291 3300053077 Bacteria 4638
472 Ga0500610_0037561 3300053079 Bacteria 2493
473 Ga0500610_0070942 3300053079 Bacteria 1816
474 Ga0495619_0094281 3300053085 Bacteria 2030
475 Ga0500578_0020678 3300053086 Bacteria 4231
476 Ga0500643_009454 3300053087 Bacteria 3724
477 Ga0500644_0035535 3300053088 Bacteria 1615
478 Ga0500644_0052163 3300053088 Bacteria 1407
479 Ga0500651_0000042 3300053093 Bacteria 87895
480 Ga0500566_0032189 3300053094 Bacteria 3057
481 Ga0500562_002843 3300053108 Bacteria 4315
482 Ga0500571_000385 3300053110 Bacteria 17471
483 Ga0500593_000583 3300053117 Bacteria 14023
484 Ga0500594_0002799 3300053118 Bacteria 3798
485 Ga0500594_0027652 3300053118 Bacteria 1470
486 Ga0500597_008136 3300053120 Bacteria 3606
487 Ga0500607_001690 3300053121 Bacteria 19265
488 Ga0500607_006536 3300053121 Bacteria 7343
489 Ga0500608_023755 3300053122 Bacteria 2856
490 Ga0500655_000421 3300053133 Bacteria 8865
491 Ga0500658_0001425 3300053134 Bacteria 9620
492 Ga0500658_0001604 3300053134 Bacteria 9037
493 Ga0500559_0000141 3300053136 Bacteria 56026
494 Ga0500559_0001807 3300053136 Bacteria 11716
495 Ga0500559_0002630 3300053136 Bacteria 9164
496 Ga0500559_0020197 3300053136 Bacteria 2816
497 Ga0500568_0003106 3300053139 Bacteria 9467
498 Ga0500574_000180 3300053141 Bacteria 7443
499 Ga0500577_0076093 3300053142 Bacteria 1328
500 Ga0500622_0001173 3300053156 Bacteria 21675
501 Ga0500634_0016455 3300053161 Bacteria 3945
502 Ga0500634_0048123 3300053161 Bacteria 2301
503 Ga0500638_005934 3300053162 Bacteria 4938
504 Ga0500636_0078315 3300053177 Bacteria 1908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0584712 Ga0496108_0584712_20_889 289
2 3300025923 Ga0207681_10028047 Ga0207681_100280473 294
3 3300048925 Ga0496122_0000592 Ga0496122_0000592_66842_67798 294
4 3300048926 Ga0496123_0000656 Ga0496123_0000656_32233_33189 294
5 3300048927 Ga0496124_0043730 Ga0496124_0043730_960_1916 294
6 3300015265 Ga0182005_1050276 Ga0182005_10502761 295
7 3300053118 Ga0500594_0027652 Ga0500594_0027652_450_1415 295
8 3300053136 Ga0500559_0001807 Ga0500559_0001807_4502_5467 295
9 3300005328 Ga0070676_10002418 Ga0070676_1000241810 296
10 3300005331 Ga0070670_100006355 Ga0070670_1000063552 296
11 3300005334 Ga0068869_100031902 Ga0068869_1000319023 296
12 3300005338 Ga0068868_100003706 Ga0068868_1000037065 296
13 3300005353 Ga0070669_100230772 Ga0070669_1002307721 296
14 3300005354 Ga0070675_100031170 Ga0070675_1000311702 296
15 3300005364 Ga0070673_100003618 Ga0070673_1000036184 296
16 3300005457 Ga0070662_100053455 Ga0070662_1000534553 296
17 3300005459 Ga0068867_100010203 Ga0068867_1000102033 296
18 3300005543 Ga0070672_100007542 Ga0070672_1000075429 296
19 3300005577 Ga0068857_100015530 Ga0068857_1000155307 296
20 3300053136 Ga0500559_0020197 Ga0500559_0020197_295_1260 296
21 3300025907 Ga0207645_10001701 Ga0207645_1000170111 297
22 3300025908 Ga0207643_10072022 Ga0207643_100720222 297
23 3300025923 Ga0207681_10347761 Ga0207681_103477611 297
24 3300025926 Ga0207659_10030120 Ga0207659_100301202 297
25 3300025933 Ga0207706_10090982 Ga0207706_100909822 297
26 3300025940 Ga0207691_10012729 Ga0207691_100127292 297
27 3300025942 Ga0207689_10096495 Ga0207689_100964952 297
28 3300025960 Ga0207651_10031449 Ga0207651_100314492 297
29 3300025986 Ga0207658_10193592 Ga0207658_101935922 297
30 3300026089 Ga0207648_10005619 Ga0207648_100056195 297
31 3300026116 Ga0207674_10028128 Ga0207674_100281285 297
32 3300026121 Ga0207683_10167565 Ga0207683_101675653 297
33 3300050493 nmdc:mga0k408_203511_c1 nmdc:mga0k408_203511_c1_165_1121 297
34 3300025925 Ga0207650_10001268 Ga0207650_1000126816 298
35 3300025926 Ga0207659_10007870 Ga0207659_100078704 298
36 3300025940 Ga0207691_10137124 Ga0207691_101371242 298
37 3300026095 Ga0207676_10365622 Ga0207676_103656222 298
38 3300025908 Ga0207643_10112817 Ga0207643_101128171 299
39 3300003323 rootH1_10027782 rootH1_100277824 300
40 3300033180 Ga0307510_10031904 Ga0307510_100319045 306
41 3300035112 Ga0373932_0067632 Ga0373932_0067632_57_1016 306
42 3300035691 Ga0373931_0037257 Ga0373931_0037257_974_1933 306
43 3300028379 Ga0268266_10007234 Ga0268266_100072349 309
44 iso_pu_bacteria 2888373701 2888377152 312
45 3300049822 Ga0501035_0021126 Ga0501035_0021126_2331_3272 313
46 iso_pu_bacteria 2506520007 2506579845 313
47 iso_pu_bacteria 2506520008 2506584984 313
48 iso_pu_bacteria 2508501071 2508853616 313
49 iso_pu_bacteria 2643221609 2644060635 313
50 iso_pu_bacteria 2643221611 2644073956 313
51 iso_pu_bacteria 2654587920 2656275504 313
52 iso_pu_bacteria 2687453601 2689446367 313
53 iso_pu_bacteria 2738543012 2739242656 313
54 iso_pu_bacteria 2772190666 2772440264 313
55 iso_pu_bacteria 2806310673 2807179926 313
56 iso_pu_bacteria 2816332133 2816473023 313
57 iso_pu_bacteria 2869551831 2869555723 313
58 iso_pu_bacteria 2888366609 2888370363 313
59 iso_pu_bacteria 2932406140 2932409263 313
60 iso_pu_bacteria 2937967321 2937971997 313
61 iso_pu_bacteria 2939577877 2939580791 313
62 iso_pu_bacteria 640753048 640939102 313
63 iso_pu_bacteria 8004592986 8004594564 313
64 iso_pu_bacteria 8015394850 8015395740 313
65 iso_pu_bacteria 8055693939 8055697130 313
66 iso_pu_bacteria 2643221570 2643865706 314
67 iso_pu_bacteria 2643221652 2644294416 314
68 iso_pu_bacteria 2842733646 2842735300 314
69 iso_pu_bacteria 2990710928 2990712576 314
70 3300005367 Ga0070667_100000704 Ga0070667_10000070418 315
71 3300005456 Ga0070678_100032929 Ga0070678_1000329294 315
72 3300005548 Ga0070665_100088829 Ga0070665_1000888292 315
73 3300005617 Ga0068859_100019868 Ga0068859_1000198688 315
74 3300005841 Ga0068863_100172358 Ga0068863_1001723583 315
75 3300006931 Ga0097620_100019867 Ga0097620_1000198678 315
76 3300009098 Ga0105245_10161423 Ga0105245_101614232 315
77 3300025986 Ga0207658_10000319 Ga0207658_1000031933 315
78 3300026023 Ga0207677_10126370 Ga0207677_101263703 315
79 3300028381 Ga0268264_10115515 Ga0268264_101155152 315
80 3300028786 Ga0307517_10163755 Ga0307517_101637552 315
81 3300028794 Ga0307515_10036077 Ga0307515_100360776 315
82 3300031507 Ga0307509_10088275 Ga0307509_100882754 315
83 3300031616 Ga0307508_10088449 Ga0307508_100884492 315
84 3300031649 Ga0307514_10064361 Ga0307514_100643611 315
85 3300031838 Ga0307518_10115606 Ga0307518_101156062 315
86 3300046665 Ga0495661_0013013 Ga0495661_0013013_4105_5052 315
87 3300046683 Ga0495658_0021825 Ga0495658_0021825_1454_2401 315
88 3300046683 Ga0495658_0098318 Ga0495658_0098318_693_1640 315
89 3300050493 nmdc:mga0k408_268541_c1 nmdc:mga0k408_268541_c1_12_959 315
90 3300050493 nmdc:mga0k408_2988_c1 nmdc:mga0k408_2988_c1_6199_7146 315
91 3300053161 Ga0500634_0048123 Ga0500634_0048123_409_1365 315
92 iso_pu_bacteria 2643221654 2644304219 315
93 iso_pu_bacteria 2928115317 2928118566 315
94 3300005367 Ga0070667_100211075 Ga0070667_1002110752 316
95 3300006195 Ga0075366_10133949 Ga0075366_101339491 316
96 3300006353 Ga0075370_10051980 Ga0075370_100519802 316
97 3300009545 Ga0105237_10240781 Ga0105237_102407812 316
98 3300028786 Ga0307517_10000671 Ga0307517_1000067129 316
99 3300028794 Ga0307515_10221760 Ga0307515_102217603 316
100 3300030522 Ga0307512_10074569 Ga0307512_100745693 316
101 3300030522 Ga0307512_10119862 Ga0307512_101198622 316
102 3300031507 Ga0307509_10000041 Ga0307509_10000041120 316
103 3300031507 Ga0307509_10085522 Ga0307509_100855223 316
104 3300033180 Ga0307510_10052365 Ga0307510_100523653 316
105 3300037068 Ga0373925_0044453 Ga0373925_0044453_1413_2420 316
106 3300046454 Ga0495592_0000028 Ga0495592_0000028_108742_109692 316
107 3300046460 Ga0495638_0071908 Ga0495638_0071908_765_1715 316
108 3300046473 Ga0495582_0073993 Ga0495582_0073993_483_1433 316
109 3300046517 Ga0495630_0026345 Ga0495630_0026345_1528_2478 316
110 3300046690 Ga0495624_0007203 Ga0495624_0007203_5189_6139 316
111 3300047321 Ga0495676_0015888 Ga0495676_0015888_3071_4021 316
112 3300047673 Ga0495593_0028737 Ga0495593_0028737_772_1722 316
113 3300050493 nmdc:mga0k408_166751_c1 nmdc:mga0k408_166751_c1_197_1147 316
114 3300053088 Ga0500644_0035535 Ga0500644_0035535_34_984 316
115 3300053118 Ga0500594_0002799 Ga0500594_0002799_144_1094 316
116 3300053136 Ga0500559_0000141 Ga0500559_0000141_9437_10387 316
117 3300053156 Ga0500622_0001173 Ga0500622_0001173_1141_2091 316
118 3300053177 Ga0500636_0078315 Ga0500636_0078315_403_1353 316
119 3300005272 Ga0065703_1019924 Ga0065703_10199243 317
120 3300005331 Ga0070670_100066092 Ga0070670_1000660922 317
121 3300005355 Ga0070671_100012199 Ga0070671_1000121993 317
122 3300005456 Ga0070678_100008953 Ga0070678_1000089536 317
123 3300005841 Ga0068863_100239654 Ga0068863_1002396542 317
124 3300006237 Ga0097621_100038353 Ga0097621_1000383532 317
125 3300006358 Ga0068871_100083388 Ga0068871_1000833882 317
126 3300006946 Ga0079104_1002938 Ga0079104_10029383 317
127 3300009011 Ga0105251_10000245 Ga0105251_1000024537 317
128 3300009036 Ga0105244_10001915 Ga0105244_1000191510 317
129 3300013296 Ga0157374_10154679 Ga0157374_101546792 317
130 3300017792 Ga0163161_10000005 Ga0163161_1000000580 317
131 3300025711 Ga0207696_1000039 Ga0207696_1000039215 317
132 3300025728 Ga0207655_1000078 Ga0207655_100007818 317
133 3300025735 Ga0207713_1000095 Ga0207713_100009543 317
134 3300025735 Ga0207713_1000248 Ga0207713_100024848 317
135 3300025735 Ga0207713_1007817 Ga0207713_10078177 317
136 3300025900 Ga0207710_10000026 Ga0207710_10000026196 317
137 3300025911 Ga0207654_10000012 Ga0207654_1000001266 317
138 3300025931 Ga0207644_10018779 Ga0207644_100187795 317
139 3300026088 Ga0207641_10105586 Ga0207641_101055862 317
140 3300026121 Ga0207683_10008144 Ga0207683_100081442 317
141 3300027111 Ga0209281_1000315 Ga0209281_100031547 317
142 3300028794 Ga0307515_10000398 Ga0307515_1000039868 317
143 3300028794 Ga0307515_10272714 Ga0307515_102727142 317
144 3300031730 Ga0307516_10006738 Ga0307516_100067387 317
145 3300046530 Ga0495654_0055841 Ga0495654_0055841_717_1670 317
146 3300046660 Ga0495625_0094615 Ga0495625_0094615_874_1845 317
147 3300046794 Ga0495589_0000032 Ga0495589_0000032_71838_72791 317
148 3300048922 Ga0496119_0004951 Ga0496119_0004951_244_1197 317
149 3300048922 Ga0496119_0005544 Ga0496119_0005544_10824_11777 317
150 3300048923 Ga0496120_0000494 Ga0496120_0000494_29863_30816 317
151 3300048923 Ga0496120_0000636 Ga0496120_0000636_20578_21531 317
152 3300048927 Ga0496124_0000049 Ga0496124_0000049_60918_61871 317
153 3300053088 Ga0500644_0052163 Ga0500644_0052163_95_1051 317
154 3300053108 Ga0500562_002843 Ga0500562_002843_1801_2757 317
155 3300053142 Ga0500577_0076093 Ga0500577_0076093_310_1266 317
156 iso_pu_bacteria 2643221628 2644159411 317
157 iso_pu_bacteria 2842677519 2842679070 317
158 iso_pu_bacteria 2885192300 2885197496 317
159 iso_pu_bacteria 2904449895 2904456254 317
160 iso_pu_bacteria 2904456579 2904457610 317
161 iso_pu_bacteria 2929520902 2929527345 317
162 iso_pu_bacteria 2945909444 2945911330 317
163 iso_pu_bacteria 2945945610 2945947340 317
164 iso_pu_bacteria 2945984333 2945986382 317
165 3300006048 Ga0075363_100127509 Ga0075363_1001275092 318
166 3300009011 Ga0105251_10000160 Ga0105251_1000016048 318
167 3300009011 Ga0105251_10002163 Ga0105251_100021639 318
168 3300009092 Ga0105250_10002671 Ga0105250_100026716 318
169 3300009101 Ga0105247_10000069 Ga0105247_1000006950 318
170 3300009174 Ga0105241_10000011 Ga0105241_1000001166 318
171 3300013100 Ga0157373_10027562 Ga0157373_100275623 318
172 3300014497 Ga0182008_10001938 Ga0182008_100019383 318
173 3300017792 Ga0163161_10136508 Ga0163161_101365082 318
174 3300031731 Ga0307405_10188146 Ga0307405_101881462 318
175 3300037418 Ga0395900_0041114 Ga0395900_0041114_344_1300 318
176 3300037471 Ga0395905_0061230 Ga0395905_0061230_2311_3267 318
177 3300038443 Ga0395901_0163432 Ga0395901_0163432_699_1655 318
178 3300044673 Ga0453683_0197176 Ga0453683_0197176_219_1181 318
179 3300046453 Ga0495627_000086 Ga0495627_000086_94249_95214 318
180 3300048919 Ga0496116_0000007 Ga0496116_0000007_579360_580325 318
181 3300048920 Ga0496117_0006437 Ga0496117_0006437_3029_3994 318
182 3300048921 Ga0496118_0004930 Ga0496118_0004930_2186_3151 318
183 3300048922 Ga0496119_0018943 Ga0496119_0018943_2276_3241 318
184 iso_pu_bacteria 2738541277 2738717478 318
185 iso_pu_bacteria 2738543019 2739278164 318
186 3300005327 Ga0070658_10088103 Ga0070658_100881032 319
187 3300005329 Ga0070683_100429532 Ga0070683_1004295322 319
188 3300005334 Ga0068869_100033455 Ga0068869_1000334552 319
189 3300005339 Ga0070660_100091111 Ga0070660_1000911112 319
190 3300005344 Ga0070661_100193780 Ga0070661_1001937802 319
191 3300005344 Ga0070661_100201114 Ga0070661_1002011142 319
192 3300005354 Ga0070675_100070491 Ga0070675_1000704912 319
193 3300005355 Ga0070671_100010921 Ga0070671_1000109212 319
194 3300005364 Ga0070673_100042803 Ga0070673_1000428032 319
195 3300005364 Ga0070673_100355120 Ga0070673_1003551202 319
196 3300005366 Ga0070659_100014864 Ga0070659_1000148642 319
197 3300005455 Ga0070663_100045964 Ga0070663_1000459642 319
198 3300005457 Ga0070662_100001568 Ga0070662_10000156811 319
199 3300005535 Ga0070684_100179894 Ga0070684_1001798942 319
200 3300005539 Ga0068853_100010853 Ga0068853_1000108537 319
201 3300005539 Ga0068853_100320949 Ga0068853_1003209492 319
202 3300005543 Ga0070672_100017976 Ga0070672_1000179764 319
203 3300005564 Ga0070664_100052960 Ga0070664_1000529602 319
204 3300005578 Ga0068854_100135965 Ga0068854_1001359651 319
205 3300005616 Ga0068852_100059134 Ga0068852_1000591342 319
206 3300005617 Ga0068859_100218447 Ga0068859_1002184472 319
207 3300005618 Ga0068864_100012237 Ga0068864_1000122374 319
208 3300005618 Ga0068864_100159054 Ga0068864_1001590542 319
209 3300005719 Ga0068861_100072266 Ga0068861_1000722662 319
210 3300005834 Ga0068851_10018636 Ga0068851_100186362 319
211 3300005834 Ga0068851_10120288 Ga0068851_101202882 319
212 3300005841 Ga0068863_100039467 Ga0068863_1000394672 319
213 3300005842 Ga0068858_100074829 Ga0068858_1000748294 319
214 3300005843 Ga0068860_100017641 Ga0068860_1000176414 319
215 3300006177 Ga0075362_10065514 Ga0075362_100655142 319
216 3300006931 Ga0097620_100218452 Ga0097620_1002184522 319
217 3300009177 Ga0105248_10047609 Ga0105248_100476095 319
218 3300009177 Ga0105248_10385755 Ga0105248_103857552 319
219 3300013296 Ga0157374_10071534 Ga0157374_100715344 319
220 3300013306 Ga0163162_10041320 Ga0163162_100413204 319
221 3300013306 Ga0163162_10175605 Ga0163162_101756052 319
222 3300013307 Ga0157372_10028646 Ga0157372_100286464 319
223 3300013308 Ga0157375_10079537 Ga0157375_100795375 319
224 3300013308 Ga0157375_10280324 Ga0157375_102803242 319
225 3300014325 Ga0163163_10084600 Ga0163163_100846002 319
226 3300014326 Ga0157380_10005275 Ga0157380_100052751 319
227 3300014745 Ga0157377_10003608 Ga0157377_100036086 319
228 3300014968 Ga0157379_10018238 Ga0157379_100182382 319
229 3300014968 Ga0157379_10076887 Ga0157379_100768874 319
230 3300017792 Ga0163161_10027711 Ga0163161_100277114 319
231 3300025321 Ga0207656_10020715 Ga0207656_100207153 319
232 3300025919 Ga0207657_10248338 Ga0207657_102483382 319
233 3300025923 Ga0207681_10176884 Ga0207681_101768842 319
234 3300025926 Ga0207659_10213866 Ga0207659_102138661 319
235 3300025931 Ga0207644_10039452 Ga0207644_100394522 319
236 3300025931 Ga0207644_10110811 Ga0207644_101108111 319
237 3300025932 Ga0207690_10101840 Ga0207690_101018402 319
238 3300025940 Ga0207691_10103610 Ga0207691_101036103 319
239 3300025940 Ga0207691_10113800 Ga0207691_101138002 319
240 3300025942 Ga0207689_10000169 Ga0207689_1000016949 319
241 3300025945 Ga0207679_10058648 Ga0207679_100586482 319
242 3300025945 Ga0207679_10254093 Ga0207679_102540932 319
243 3300025949 Ga0207667_10025900 Ga0207667_100259006 319
244 3300026023 Ga0207677_10148077 Ga0207677_101480772 319
245 3300026035 Ga0207703_10041846 Ga0207703_100418465 319
246 3300026041 Ga0207639_10088328 Ga0207639_100883282 319
247 3300026067 Ga0207678_10066914 Ga0207678_100669142 319
248 3300026067 Ga0207678_10171266 Ga0207678_101712662 319
249 3300026088 Ga0207641_10164498 Ga0207641_101644982 319
250 3300026089 Ga0207648_10183558 Ga0207648_101835582 319
251 3300026118 Ga0207675_100002188 Ga0207675_10000218812 319
252 3300026121 Ga0207683_10093516 Ga0207683_100935162 319
253 3300028381 Ga0268264_10057685 Ga0268264_100576851 319
254 3300031548 Ga0307408_100116104 Ga0307408_1001161042 319
255 3300035691 Ga0373931_0049439 Ga0373931_0049439_776_1735 319
256 3300035724 Ga0373933_0039769 Ga0373933_0039769_819_1778 319
257 3300036401 Ga0373937_0049070 Ga0373937_0049070_2524_3483 319
258 3300039437 Ga0436365_1804558 Ga0436365_1804558_2492_3451 319
259 3300041997 Ga0439431_0008122 Ga0439431_0008122_1156_2133 319
260 3300046558 Ga0495633_0000704 Ga0495633_0000704_8403_9365 319
261 3300046615 Ga0495656_0017190 Ga0495656_0017190_79_1128 319
262 3300046681 Ga0495647_0014787 Ga0495647_0014787_1068_2027 319
263 3300046689 Ga0495613_0196957 Ga0495613_0196957_247_1206 319
264 3300047322 Ga0495680_0086877 Ga0495680_0086877_33_992 319
265 3300047471 Ga0495684_0062759 Ga0495684_0062759_42_1001 319
266 3300048903 Ga0496100_0176063 Ga0496100_0176063_488_1447 319
267 3300048904 Ga0496101_0052670 Ga0496101_0052670_1631_2590 319
268 3300048908 Ga0496105_0228407 Ga0496105_0228407_265_1224 319
269 3300048909 Ga0496106_0012295 Ga0496106_0012295_4915_5874 319
270 3300048910 Ga0496107_0094258 Ga0496107_0094258_692_1651 319
271 3300048911 Ga0496108_0031835 Ga0496108_0031835_2268_3227 319
272 3300048912 Ga0496109_0175510 Ga0496109_0175510_224_1183 319
273 3300048914 Ga0496111_0077713 Ga0496111_0077713_824_1783 319
274 3300048918 Ga0496115_0059410 Ga0496115_0059410_638_1597 319
275 3300049679 Ga0501249_001764 Ga0501249_001764_2966_3925 319
276 3300049759 Ga0501262_000262 Ga0501262_000262_2141_3100 319
277 3300053077 Ga0495601_0015291 Ga0495601_0015291_751_1710 319
278 3300053085 Ga0495619_0094281 Ga0495619_0094281_757_1716 319
279 3300053161 Ga0500634_0016455 Ga0500634_0016455_609_1568 319
280 iso_pu_bacteria 2513020051 2513226704 319
281 iso_pu_bacteria 2643221658 2644329339 319
282 iso_pu_bacteria 2643221672 2644401214 319
283 iso_pu_bacteria 2842718218 2842719546 319
284 iso_pu_bacteria 2928084124 2928088250 319
285 iso_pu_bacteria 2974320154 2974323395 319
286 3300005334 Ga0068869_100016845 Ga0068869_1000168454 320
287 3300005335 Ga0070666_10002405 Ga0070666_100024054 320
288 3300005338 Ga0068868_100124010 Ga0068868_1001240102 320
289 3300005353 Ga0070669_100008394 Ga0070669_1000083946 320
290 3300005354 Ga0070675_100040074 Ga0070675_1000400744 320
291 3300005356 Ga0070674_100002083 Ga0070674_1000020834 320
292 3300005456 Ga0070678_100016273 Ga0070678_1000162733 320
293 3300005457 Ga0070662_100027647 Ga0070662_1000276472 320
294 3300005459 Ga0068867_100003310 Ga0068867_1000033104 320
295 3300005543 Ga0070672_100002369 Ga0070672_1000023694 320
296 3300005618 Ga0068864_100039169 Ga0068864_1000391694 320
297 3300005719 Ga0068861_100005261 Ga0068861_1000052616 320
298 3300005841 Ga0068863_100004117 Ga0068863_1000041172 320
299 3300005842 Ga0068858_100008391 Ga0068858_1000083918 320
300 3300006051 Ga0075364_10121967 Ga0075364_101219672 320
301 3300009148 Ga0105243_10023262 Ga0105243_100232624 320
302 3300009176 Ga0105242_10005022 Ga0105242_100050228 320
303 3300013308 Ga0157375_10005659 Ga0157375_1000565911 320
304 3300014968 Ga0157379_10004639 Ga0157379_100046394 320
305 3300017792 Ga0163161_10009786 Ga0163161_100097864 320
306 3300025903 Ga0207680_10005119 Ga0207680_100051195 320
307 3300025907 Ga0207645_10003951 Ga0207645_100039517 320
308 3300025923 Ga0207681_10001915 Ga0207681_100019158 320
309 3300025933 Ga0207706_10013403 Ga0207706_100134036 320
310 3300025934 Ga0207686_10013047 Ga0207686_100130472 320
311 3300025935 Ga0207709_10023429 Ga0207709_100234294 320
312 3300025937 Ga0207669_10003488 Ga0207669_100034882 320
313 3300025938 Ga0207704_10009676 Ga0207704_100096762 320
314 3300025940 Ga0207691_10014538 Ga0207691_100145386 320
315 3300025942 Ga0207689_10033478 Ga0207689_100334783 320
316 3300025961 Ga0207712_10001833 Ga0207712_100018339 320
317 3300025972 Ga0207668_10033809 Ga0207668_100338094 320
318 3300025986 Ga0207658_10000336 Ga0207658_1000033614 320
319 3300026035 Ga0207703_10000866 Ga0207703_100008669 320
320 3300026075 Ga0207708_10044572 Ga0207708_100445723 320
321 3300026089 Ga0207648_10061941 Ga0207648_100619414 320
322 3300026118 Ga0207675_100012833 Ga0207675_1000128336 320
323 3300026121 Ga0207683_10051541 Ga0207683_100515414 320
324 3300026142 Ga0207698_10015587 Ga0207698_100155874 320
325 3300028381 Ga0268264_10001554 Ga0268264_1000155410 320
326 3300031649 Ga0307514_10000384 Ga0307514_100003849 320
327 3300050491 nmdc:mga00v17_58069_c1 nmdc:mga00v17_58069_c1_329_1402 320
328 3300053086 Ga0500578_0020678 Ga0500578_0020678_2022_2996 320
329 iso_pu_bacteria 2599185214 2599625035 320
330 iso_pu_bacteria 2599185226 2599673047 320
331 iso_pu_bacteria 2599185227 2599682503 320
332 iso_pu_bacteria 2599185229 2599694655 320
333 iso_pu_bacteria 2818991446 2819596989 320
334 iso_pu_bacteria 2831265667 2831266071 320
335 iso_pu_bacteria 2838054893 2838057800 320
336 iso_pu_bacteria 2885198086 2885203731 320
337 iso_pu_bacteria 2885211737 2885216919 320
338 iso_pu_bacteria 2899924645 2899930269 320
339 iso_pu_bacteria 2928037797 2928039382 320
340 iso_pu_bacteria 2928044640 2928045013 320
341 iso_pu_bacteria 2928051484 2928052814 320
342 iso_pu_bacteria 2928064002 2928064513 320
343 iso_pu_bacteria 2928070936 2928075072 320
344 3300003784 Ga0055534_1000238 Ga0055534_10002381 321
345 3300003790 Ga0055528_1004495 Ga0055528_10044958 321
346 3300003792 Ga0055540_1010688 Ga0055540_10106882 321
347 3300005288 Ga0065714_10004820 Ga0065714_100048208 321
348 3300005289 Ga0065704_10188423 Ga0065704_101884232 321
349 3300005844 Ga0068862_100135171 Ga0068862_1001351713 321
350 3300006038 Ga0075365_10006402 Ga0075365_100064024 321
351 3300006048 Ga0075363_100015111 Ga0075363_1000151113 321
352 3300006051 Ga0075364_10009723 Ga0075364_100097236 321
353 3300006058 Ga0075432_10003950 Ga0075432_100039506 321
354 3300006178 Ga0075367_10060832 Ga0075367_100608323 321
355 3300006195 Ga0075366_10012524 Ga0075366_100125245 321
356 3300006353 Ga0075370_10001047 Ga0075370_100010475 321
357 3300006353 Ga0075370_10026096 Ga0075370_100260964 321
358 3300006948 Ga0099826_10005293 Ga0099826_1000529311 321
359 3300017792 Ga0163161_10000065 Ga0163161_1000006518 321
360 3300025263 Ga0209565_1000085 Ga0209565_10000851 321
361 3300025273 Ga0209673_1000739 Ga0209673_10007391 321
362 3300025273 Ga0209673_1001648 Ga0209673_100164812 321
363 3300025291 Ga0209675_1000083 Ga0209675_10000831 321
364 3300025294 Ga0209025_1018926 Ga0209025_10189262 321
365 3300025303 Ga0209051_1000268 Ga0209051_100026857 321
366 3300025303 Ga0209051_1030908 Ga0209051_10309082 321
367 3300025937 Ga0207669_10148012 Ga0207669_101480123 321
368 3300027666 Ga0209282_1006872 Ga0209282_10068721 321
369 3300031456 Ga0307513_10317910 Ga0307513_103179102 321
370 3300031548 Ga0307408_100021890 Ga0307408_1000218906 321
371 3300031649 Ga0307514_10077514 Ga0307514_100775144 321
372 3300031901 Ga0307406_10001910 Ga0307406_1000191013 321
373 3300031911 Ga0307412_10019012 Ga0307412_100190124 321
374 3300031911 Ga0307412_10269268 Ga0307412_102692682 321
375 3300032005 Ga0307411_10008863 Ga0307411_100088632 321
376 3300032005 Ga0307411_10286119 Ga0307411_102861192 321
377 3300041404 Ga0439436_0006478 Ga0439436_0006478_1740_2705 321
378 3300041407 Ga0439447_005267 Ga0439447_005267_2095_3069 321
379 3300041411 Ga0439466_0003403 Ga0439466_0003403_1237_2211 321
380 3300041411 Ga0439466_0013561 Ga0439466_0013561_1178_2143 321
381 3300041413 Ga0439465_0000712 Ga0439465_0000712_3844_4818 321
382 3300041413 Ga0439465_0008347 Ga0439465_0008347_995_1960 321
383 3300041997 Ga0439431_0002353 Ga0439431_0002353_1369_2343 321
384 3300041999 Ga0439433_0038139 Ga0439433_0038139_112_1086 321
385 3300042002 Ga0439442_004069 Ga0439442_004069_1801_2775 321
386 3300042002 Ga0439442_006940 Ga0439442_006940_1211_2176 321
387 3300042006 Ga0439432_000606 Ga0439432_000606_4016_4990 321
388 3300042007 Ga0439449_0002472 Ga0439449_0002472_2885_3859 321
389 3300042010 Ga0439452_000862 Ga0439452_000862_2804_3778 321
390 3300042014 Ga0439457_002355 Ga0439457_002355_2548_3522 321
391 3300042015 Ga0439462_0006005 Ga0439462_0006005_377_1351 321
392 3300042145 Ga0450906_000430 Ga0450906_000430_2734_3699 321
393 3300042147 Ga0450910_003057 Ga0450910_003057_1109_2074 321
394 3300042156 Ga0439446_0004107 Ga0439446_0004107_1126_2100 321
395 3300042156 Ga0439446_0017696 Ga0439446_0017696_895_1860 321
396 3300042184 Ga0450908_001174 Ga0450908_001174_796_1761 321
397 3300042435 Ga0439434_0001058 Ga0439434_0001058_6220_7194 321
398 3300042435 Ga0439434_0001092 Ga0439434_0001092_5095_6060 321
399 3300042531 Ga0450918_007281 Ga0450918_007281_323_1288 321
400 3300046453 Ga0495627_004247 Ga0495627_004247_1033_1998 321
401 3300046515 Ga0495620_0006408 Ga0495620_0006408_3048_4013 321
402 3300046520 Ga0495637_0000813 Ga0495637_0000813_13522_14487 321
403 3300046660 Ga0495625_0000436 Ga0495625_0000436_30618_31583 321
404 3300046660 Ga0495625_0192655 Ga0495625_0192655_73_1038 321
405 3300046674 Ga0495588_0025000 Ga0495588_0025000_177_1142 321
406 3300046691 Ga0495670_0014693 Ga0495670_0014693_1965_2930 321
407 3300046692 Ga0495671_0003738 Ga0495671_0003738_6010_6975 321
408 3300049705 Ga0501225_0004773 Ga0501225_0004773_2963_3928 321
409 3300050489 nmdc:mga03683_21797_c1 nmdc:mga03683_21797_c1_841_1806 321
410 3300050489 nmdc:mga03683_2781_c1 nmdc:mga03683_2781_c1_834_1799 321
411 3300050489 nmdc:mga03683_89709_c1 nmdc:mga03683_89709_c1_41_1006 321
412 3300050490 nmdc:mga03n38_17188_c1 nmdc:mga03n38_17188_c1_446_1411 321
413 3300050490 nmdc:mga03n38_7506_c1 nmdc:mga03n38_7506_c1_2668_3633 321
414 3300050491 nmdc:mga00v17_13671_c1 nmdc:mga00v17_13671_c1_1067_2032 321
415 3300050492 nmdc:mga0yw44_2444_c1 nmdc:mga0yw44_2444_c1_549_1514 321
416 3300050493 nmdc:mga0k408_42720_c1 nmdc:mga0k408_42720_c1_984_1949 321
417 3300050494 nmdc:mga06z11_65157_c1 nmdc:mga06z11_65157_c1_245_1210 321
418 3300050496 nmdc:mga07m45_109094_c1 nmdc:mga07m45_109094_c1_13_978 321
419 3300050496 nmdc:mga07m45_1225_c1 nmdc:mga07m45_1225_c1_1763_2728 321
420 3300053079 Ga0500610_0037561 Ga0500610_0037561_621_1586 321
421 3300053079 Ga0500610_0070942 Ga0500610_0070942_621_1586 321
422 3300053117 Ga0500593_000583 Ga0500593_000583_5951_6916 321
423 3300053121 Ga0500607_001690 Ga0500607_001690_5848_6813 321
424 3300003578 Ga0006562J51391_1094507 Ga0006562J51391_10945073 322
425 3300005563 Ga0068855_100051011 Ga0068855_1000510114 322
426 3300009093 Ga0105240_10127430 Ga0105240_101274302 322
427 3300013100 Ga0157373_10037241 Ga0157373_100372414 322
428 3300013306 Ga0163162_10795717 Ga0163162_107957171 322
429 3300014497 Ga0182008_10009482 Ga0182008_100094824 322
430 3300025291 Ga0209675_1003832 Ga0209675_10038323 322
431 3300025294 Ga0209025_1003136 Ga0209025_100313618 322
432 3300025298 Ga0209050_1003041 Ga0209050_100304110 322
433 3300025913 Ga0207695_10195958 Ga0207695_101959582 322
434 3300025914 Ga0207671_10104908 Ga0207671_101049082 322
435 3300025949 Ga0207667_10043414 Ga0207667_100434144 322
436 3300026041 Ga0207639_10286129 Ga0207639_102861292 322
437 3300031456 Ga0307513_10346445 Ga0307513_103464452 322
438 3300046674 Ga0495588_0043387 Ga0495588_0043387_942_1910 322
439 3300048904 Ga0496101_0044399 Ga0496101_0044399_999_1967 322
440 3300048924 Ga0496121_0100218 Ga0496121_0100218_342_1310 322
441 3300048926 Ga0496123_0100753 Ga0496123_0100753_250_1218 322
442 3300048927 Ga0496124_0167122 Ga0496124_0167122_705_1673 322
443 3300048928 Ga0496125_0008806 Ga0496125_0008806_6585_7553 322
444 3300050490 nmdc:mga03n38_14111_c1 nmdc:mga03n38_14111_c1_323_1291 322
445 3300050493 nmdc:mga0k408_45942_c1 nmdc:mga0k408_45942_c1_589_1557 322
446 3300053121 Ga0500607_006536 Ga0500607_006536_2838_3806 322
447 iso_pu_bacteria 2721755523 2722883428 322
448 iso_pu_bacteria 2839138175 2839139205 322
449 3300003781 Ga0055536_1006555 Ga0055536_10065552 323
450 3300003792 Ga0055540_1001616 Ga0055540_100161611 323
451 3300003794 Ga0055531_10002054 Ga0055531_1000205411 323
452 3300005366 Ga0070659_100060678 Ga0070659_1000606784 323
453 3300005457 Ga0070662_100012451 Ga0070662_1000124517 323
454 3300005564 Ga0070664_100003355 Ga0070664_1000033557 323
455 3300005578 Ga0068854_100157963 Ga0068854_1001579633 323
456 3300006051 Ga0075364_10047953 Ga0075364_100479532 323
457 3300006946 Ga0079104_1000007 Ga0079104_1000007328 323
458 3300009036 Ga0105244_10002722 Ga0105244_1000272211 323
459 3300009092 Ga0105250_10118172 Ga0105250_101181721 323
460 3300009098 Ga0105245_10209111 Ga0105245_102091111 323
461 3300009148 Ga0105243_10000527 Ga0105243_1000052739 323
462 3300009148 Ga0105243_10013309 Ga0105243_100133093 323
463 3300014497 Ga0182008_10003595 Ga0182008_100035954 323
464 3300014497 Ga0182008_10006037 Ga0182008_100060373 323
465 3300015261 Ga0182006_1001492 Ga0182006_10014925 323
466 3300015262 Ga0182007_10001047 Ga0182007_100010478 323
467 3300025292 Ga0209676_1001472 Ga0209676_100147211 323
468 3300025298 Ga0209050_1000412 Ga0209050_100041232 323
469 3300025303 Ga0209051_1000150 Ga0209051_1000150111 323
470 3300025304 Ga0209257_1000275 Ga0209257_100027551 323
471 3300025728 Ga0207655_1000936 Ga0207655_10009364 323
472 3300025924 Ga0207694_10165034 Ga0207694_101650342 323
473 3300025927 Ga0207687_10216999 Ga0207687_102169992 323
474 3300025933 Ga0207706_10010789 Ga0207706_1001078911 323
475 3300025935 Ga0207709_10000193 Ga0207709_1000019332 323
476 3300025935 Ga0207709_10000815 Ga0207709_100008154 323
477 3300027111 Ga0209281_1000020 Ga0209281_1000020170 323
478 3300037471 Ga0395905_0385987 Ga0395905_0385987_61_1044 323
479 3300046512 Ga0495610_0018669 Ga0495610_0018669_681_1652 323
480 3300046513 Ga0495616_0024125 Ga0495616_0024125_1250_2221 323
481 3300046518 Ga0495631_0002075 Ga0495631_0002075_5484_6455 323
482 3300046539 Ga0495621_0008005 Ga0495621_0008005_1719_2690 323
483 3300047321 Ga0495676_0021618 Ga0495676_0021618_1124_2095 323
484 3300048089 Ga0495614_0006658 Ga0495614_0006658_3331_4302 323
485 3300048905 Ga0496102_0143142 Ga0496102_0143142_835_1806 323
486 3300048917 Ga0496114_0170439 Ga0496114_0170439_908_1879 323
487 3300048917 Ga0496114_0338353 Ga0496114_0338353_53_1024 323
488 3300048920 Ga0496117_0096214 Ga0496117_0096214_844_1815 323
489 3300048921 Ga0496118_0115910 Ga0496118_0115910_717_1688 323
490 3300048925 Ga0496122_0052837 Ga0496122_0052837_141_1112 323
491 3300048929 Ga0496126_0088363 Ga0496126_0088363_647_1618 323
492 3300050491 nmdc:mga00v17_50123_c1 nmdc:mga00v17_50123_c1_541_1512 323
493 3300053087 Ga0500643_009454 Ga0500643_009454_525_1496 323
494 3300053093 Ga0500651_0000042 Ga0500651_0000042_26819_27790 323
495 3300053094 Ga0500566_0032189 Ga0500566_0032189_485_1456 323
496 3300053110 Ga0500571_000385 Ga0500571_000385_10511_11482 323
497 3300053120 Ga0500597_008136 Ga0500597_008136_254_1225 323
498 3300053122 Ga0500608_023755 Ga0500608_023755_1519_2490 323
499 3300053133 Ga0500655_000421 Ga0500655_000421_2105_3076 323
500 3300053134 Ga0500658_0001425 Ga0500658_0001425_5015_5986 323
501 3300053134 Ga0500658_0001604 Ga0500658_0001604_3052_4023 323
502 3300053136 Ga0500559_0002630 Ga0500559_0002630_5675_6646 323
503 3300053139 Ga0500568_0003106 Ga0500568_0003106_2509_3480 323
504 3300053141 Ga0500574_000180 Ga0500574_000180_1302_2273 323
505 3300053162 Ga0500638_005934 Ga0500638_005934_2723_3694 323
506 3300002774 JGI25150J39212_1002301 JGI25150J39212_10023016 324
507 3300002987 JGI25159J45721_1001672 JGI25159J45721_10016724 324
508 3300002987 JGI25159J45721_1001917 JGI25159J45721_10019173 324
509 3300003187 JGI25151J46595_10003212 JGI25151J46595_100032124 324
510 3300003187 JGI25151J46595_10006407 JGI25151J46595_100064074 324
511 3300003215 JGI25153J46596_10003239 JGI25153J46596_100032394 324
512 3300003374 JGI25161J50226_1001619 JGI25161J50226_10016194 324
513 3300003578 Ga0006562J51391_1130105 Ga0006562J51391_11301052 324
514 3300003761 Ga0055535_1001094 Ga0055535_10010944 324
515 3300003762 Ga0055542_1000027 Ga0055542_100002755 324
516 3300003771 Ga0055526_1005805 Ga0055526_10058057 324
517 3300003773 Ga0055537_1001222 Ga0055537_10012227 324
518 3300003773 Ga0055537_1002045 Ga0055537_10020452 324
519 3300003775 Ga0055524_1004001 Ga0055524_10040017 324
520 3300003775 Ga0055524_1004006 Ga0055524_10040067 324
521 3300003781 Ga0055536_1004940 Ga0055536_10049404 324
522 3300003784 Ga0055534_1001493 Ga0055534_100149310 324
523 3300003784 Ga0055534_1001510 Ga0055534_100151010 324
524 3300003790 Ga0055528_1002788 Ga0055528_100278810 324
525 3300003790 Ga0055528_1011778 Ga0055528_10117784 324
526 3300003791 Ga0055530_10001348 Ga0055530_100013488 324
527 3300003791 Ga0055530_10001422 Ga0055530_1000142213 324
528 3300003792 Ga0055540_1003222 Ga0055540_10032222 324
529 3300005262 Ga0065165_1004145 Ga0065165_100414510 324
530 3300005539 Ga0068853_100003807 Ga0068853_1000038079 324
531 3300009093 Ga0105240_10425312 Ga0105240_104253122 324
532 3300025228 Ga0209672_100563 Ga0209672_10056321 324
533 3300025229 Ga0209147_101025 Ga0209147_1010255 324
534 3300025242 Ga0209258_100048 Ga0209258_100048320 324
535 3300025245 Ga0207425_1000275 Ga0207425_100027511 324
536 3300025245 Ga0207425_1001625 Ga0207425_100162510 324
537 3300025254 Ga0209148_1000040 Ga0209148_1000040320 324
538 3300025258 Ga0209129_1000007 Ga0209129_1000007208 324
539 3300025263 Ga0209565_1000105 Ga0209565_100010527 324
540 3300025263 Ga0209565_1001643 Ga0209565_100164311 324
541 3300025273 Ga0209673_1000794 Ga0209673_100079442 324
542 3300025273 Ga0209673_1002152 Ga0209673_100215215 324
543 3300025284 Ga0209130_1000172 Ga0209130_100017243 324
544 3300025284 Ga0209130_1000329 Ga0209130_100032944 324
545 3300025291 Ga0209675_1001275 Ga0209675_100127515 324
546 3300025291 Ga0209675_1001400 Ga0209675_100140015 324
547 3300025292 Ga0209676_1000004 Ga0209676_1000004959 324
548 3300025294 Ga0209025_1000111 Ga0209025_100011144 324
549 3300025294 Ga0209025_1009274 Ga0209025_10092747 324
550 3300025295 Ga0209564_1000153 Ga0209564_1000153147 324
551 3300025295 Ga0209564_1000337 Ga0209564_100033775 324
552 3300025297 Ga0209758_1000025 Ga0209758_1000025318 324
553 3300025297 Ga0209758_1003925 Ga0209758_100392510 324
554 3300025298 Ga0209050_1000002 Ga0209050_10000021469 324
555 3300025299 Ga0209256_1000425 Ga0209256_100042554 324
556 3300025299 Ga0209256_1001308 Ga0209256_10013087 324
557 3300025302 Ga0207426_1000001 Ga0207426_1000001260 324
558 3300025302 Ga0207426_1000028 Ga0207426_1000028151 324
559 3300025303 Ga0209051_1000002 Ga0209051_10000021239 324
560 3300025304 Ga0209257_1000002 Ga0209257_10000021380 324
561 3300025304 Ga0209257_1003064 Ga0209257_10030647 324
562 3300026041 Ga0207639_10049794 Ga0207639_100497942 324
563 3300048920 Ga0496117_0031905 Ga0496117_0031905_2667_3641 324
564 3300048921 Ga0496118_0009889 Ga0496118_0009889_1590_2564 324
565 3300048928 Ga0496125_0061223 Ga0496125_0061223_1487_2461 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

15

314

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9631 2 317
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9607 2 319
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9601 2 319
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9491 1 317
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9483 1 317
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.934 1 317 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9081 3 319 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9058 3 319 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8961 1 316 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8919 3 319 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A379AEJ1-F1-model_v4 Putative aldo-keto reductase 0.9944 183 317 GO:0005829
AF-A0A519EKB9-F1-model_v4 Aldo/keto reductase 0.9918 69 319 GO:0005829
GO:0016491
AF-H0FEY4-F1-model_v4 Aldo/keto reductase 0.9894 2 319 GO:0005829
AF-A0A095UK16-F1-model_v4 Alcohol dehydrogenase 0.9879 1 319 GO:0005829
AF-A0A095UK16-F1-model_v4 Alcohol dehydrogenase 0.9849 1 319 GO:0005829

Feature Viewer

pLDDT pTM Quality
93.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map