F464308

General Info

Members Datasets Scaffolds Average Seq Length
565 340 1130 210

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0014045|Ga0496113_0014045_4223_5011
Length 262
Sequence MERRGGFFVSLLSLATPSPSPARAGLCPSLHARRFTMSTPANFNGKLPTIDIGDTAMLLIDHQSGLFQTVADMPMTTLRANVTALAKAATQTGMPVITTASVPQGPNGPLIPEIHALAPHARYVARKGQINAWDNPDFVDAVKATGKGTLIVAGTITSVCMAFPSISAVHEGYRVFAVVDASGTYSKMAQEITLARIVQAGVVPIDTAAVLSELQQTWHRDDAQQWAEAYTQVFPPYGLLIESYLKAQEVATQHELLDSERA

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
58 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
94 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
95 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
99 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
100 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
101 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
102 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
103 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
189 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
190 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
191 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
192 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
193 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
194 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
195 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
196 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
197 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
198 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
199 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
200 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
201 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
202 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
203 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
204 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
205 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
206 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
207 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
208 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
209 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
210 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
211 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
212 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
213 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
214 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
215 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
216 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
217 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
218 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
219 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
220 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
221 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
222 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
223 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
224 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
225 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
226 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
227 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
228 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
229 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
230 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
231 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
232 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
233 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
234 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
235 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
236 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
237 2636415599 Klebsiella variicola DX120E Isolate Unclassified
238 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
239 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
240 2643221557 Ensifer sp. Root558 Isolate Unclassified
241 2643221607 Rhizobium sp. Root73 Isolate Unclassified
242 2643221610 Ensifer sp. Root74 Isolate Unclassified
243 2643221618 Ensifer sp. Root231 Isolate Unclassified
244 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
245 2643221626 Ensifer sp. Root31 Isolate Unclassified
246 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
247 2643221645 Massilia sp. Root351 Isolate Unclassified
248 2643221655 Ensifer sp. Root1252 Isolate Unclassified
249 2643221659 Ensifer sp. Root127 Isolate Unclassified
250 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
251 2643221668 Ensifer sp. Root423 Isolate Unclassified
252 2643221675 Ensifer sp. Root1298 Isolate Unclassified
253 2643221680 Ensifer sp. Root1312 Isolate Unclassified
254 2643221683 Variovorax sp. Root473 Isolate Unclassified
255 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
256 2643221695 Lysobacter sp. Root494 Isolate Unclassified
257 2643221698 Ensifer sp. Root142 Isolate Unclassified
258 2643221712 Ensifer sp. Root258 Isolate Unclassified
259 2643221723 Ensifer sp. Root278 Isolate Unclassified
260 2643221726 Ensifer sp. Root954 Isolate Unclassified
261 2643221736 Bosea sp. Root483D1 Isolate Unclassified
262 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
263 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
264 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
265 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
266 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
267 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
268 2721755523 Delftia sp. HK171 Isolate Unclassified
269 2738541280 Massilia sp. GV090 Isolate Unclassified
270 2738543024 Aminobacter sp. AP02 Isolate Unclassified
271 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
272 2751185917 Enterobacter sp. HK169 Isolate Unclassified
273 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
274 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
275 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
276 2775507074 Klebsiella sp. D5A Isolate Unclassified
277 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
278 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
279 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
280 2821118458 Enterobacter asburiae 609 Isolate Unclassified
281 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
282 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
283 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
284 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
285 2844163670 Ensifer sp. 1H6 Isolate Unclassified
286 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
287 2854911287 Brucella lupini LUP21 Isolate Unclassified
288 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
289 2858950400 Achromobacter sp. K91 Isolate Unclassified
290 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
291 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
292 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
293 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
294 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
295 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
296 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
297 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
298 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
299 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
300 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
301 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
302 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
303 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
304 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
305 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
306 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
307 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
308 2937539931 Pantoea sp. LS15 Isolate Unclassified
309 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
310 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
311 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
312 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
313 2941479691
314 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
315 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
316 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
317 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
318 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
319 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
320 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
321 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
322 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
323 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
324 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
325 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
326 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
327 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
328 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
329 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
330 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
331 640753048 Serratia proteamaculans 568 Isolate Endosphere
332 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
333 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
334 8004592986 Serratia sp. S119 Isolate Unclassified
335 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
336 8018221730 Enterobacter sp. CM29 Isolate Unclassified
337 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
338 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
339 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
340 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.04
Metatranscriptomes 0
Isolates 27.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.88
Bulb 0
Endosphere 6.37
Nodule 4.25
Rhizoplane 8.14
Rhizosphere 64.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0014045 3300048916 Bacteria 5450
2 SwRhRL2b_contig_1285905 2162886007 Bacteria 1774
3 SwRhRL2b_contig_148930 2162886007 Bacteria 809
4 SwRhRL2b_contig_1554327 2162886007 Bacteria 1175
5 SwRhRL2b_contig_3580412 2162886007 Bacteria 1173
6 JGI24739J22299_10032649 3300001989 Bacteria 1789
7 JGI24735J21928_10002402 3300002067 Bacteria 6508
8 JGI25158J39367_1002663 3300002739 Bacteria 2863
9 JGI25159J45721_1008201 3300002987 Bacteria 2897
10 rootH2_10004276 3300003320 Bacteria 38002
11 JGI25160J50197_1012751 3300003354 Bacteria 2898
12 JGI25161J50226_1004519 3300003374 Bacteria 2897
13 Ga0055526_1015775 3300003771 Bacteria 3009
14 Ga0055537_1005801 3300003773 Bacteria 3241
15 Ga0055537_1019322 3300003773 Bacteria 1061
16 Ga0055536_1000458 3300003781 Bacteria 28710
17 Ga0055536_1006139 3300003781 Bacteria 5681
18 Ga0055534_1005125 3300003784 Bacteria 3599
19 Ga0055530_10006986 3300003791 Bacteria 4873
20 Ga0055540_1000344 3300003792 Bacteria 39592
21 Ga0055531_10018220 3300003794 Bacteria 2911
22 Ga0058692_1027174 3300003856 Bacteria 1117
23 Ga0055543_1006180 3300004625 Bacteria 2935
24 Ga0065165_1015275 3300005262 Bacteria 2935
25 Ga0065703_1000278 3300005272 Bacteria 4878
26 Ga0065704_10096582 3300005289 Bacteria 2426
27 Ga0065704_10108081 3300005289 Bacteria 2035
28 Ga0065704_10110904 3300005289 Bacteria 1969
29 Ga0065704_10206317 3300005289 Bacteria 1123
30 Ga0065715_10521747 3300005293 Bacteria 763
31 Ga0070669_100002005 3300005353 Bacteria 14741
32 Ga0070673_100006037 3300005364 Bacteria 7847
33 Ga0070711_100204144 3300005439 Bacteria 1527
34 Ga0070694_100031563 3300005444 Bacteria 3473
35 Ga0070694_100044913 3300005444 Bacteria 2958
36 Ga0070706_100101310 3300005467 Bacteria 2676
37 Ga0070707_100423538 3300005468 Bacteria 1291
38 Ga0070698_100157035 3300005471 Bacteria 2220
39 Ga0070698_100587630 3300005471 Bacteria 1054
40 Ga0070699_100016974 3300005518 Bacteria 6250
41 Ga0070697_100028533 3300005536 Bacteria 4469
42 Ga0070697_100588631 3300005536 Bacteria 977
43 Ga0070695_100036228 3300005545 Bacteria 3103
44 Ga0070695_100363330 3300005545 Bacteria 1088
45 Ga0070695_100443992 3300005545 Bacteria 993
46 Ga0070696_100028212 3300005546 Bacteria 3829
47 Ga0070696_100355475 3300005546 Bacteria 1135
48 Ga0070704_100310960 3300005549 Bacteria 1316
49 Ga0070704_100394302 3300005549 Bacteria 1179
50 Ga0070704_100473166 3300005549 Bacteria 1083
51 Ga0070704_100781853 3300005549 Bacteria 852
52 Ga0068864_100712880 3300005618 Bacteria 981
53 Ga0068860_100581968 3300005843 Bacteria 1124
54 Ga0075366_10142596 3300006195 Bacteria 1449
55 Ga0075428_100288714 3300006844 Bacteria 1765
56 Ga0075428_100482024 3300006844 Bacteria 1327
57 Ga0075430_100034008 3300006846 Bacteria 4325
58 Ga0075430_100137450 3300006846 Bacteria 2035
59 Ga0075429_100495596 3300006880 Bacteria 1070
60 Ga0079104_1000004 3300006946 Bacteria 444549
61 Ga0079104_1000274 3300006946 Bacteria 67264
62 Ga0079104_1000859 3300006946 Bacteria 25180
63 Ga0079104_1001748 3300006946 Bacteria 13745
64 Ga0079104_1001872 3300006946 Bacteria 12747
65 Ga0099794_10253601 3300007265 Bacteria 907
66 Ga0105251_10000036 3300009011 Bacteria 117656
67 Ga0105251_10001816 3300009011 Bacteria 17651
68 Ga0105251_10023911 3300009011 Bacteria 3146
69 Ga0105251_10139824 3300009011 Bacteria 1096
70 Ga0105244_10000071 3300009036 Bacteria 117110
71 Ga0105244_10003937 3300009036 Bacteria 10425
72 Ga0105244_10007727 3300009036 Bacteria 6808
73 Ga0105244_10015908 3300009036 Bacteria 4303
74 Ga0105244_10031066 3300009036 Bacteria 2836
75 Ga0105250_10008380 3300009092 Bacteria 4395
76 Ga0105250_10019425 3300009092 Bacteria 2747
77 Ga0105250_10106160 3300009092 Bacteria 1148
78 Ga0111539_10000192 3300009094 Bacteria 71356
79 Ga0111539_10233533 3300009094 Bacteria 2141
80 Ga0111539_10425337 3300009094 Bacteria 1547
81 Ga0114129_10094609 3300009147 Bacteria 4138
82 Ga0114129_10377249 3300009147 Bacteria 1874
83 Ga0114129_10478367 3300009147 Bacteria 1630
84 Ga0105243_10000547 3300009148 Bacteria 37977
85 Ga0105243_10001371 3300009148 Bacteria 21570
86 Ga0105241_10000012 3300009174 Bacteria 221790
87 Ga0105241_10305655 3300009174 Bacteria 1366
88 Ga0105246_10081391 3300011119 Bacteria 2308
89 Ga0157373_10001666 3300013100 Bacteria 16962
90 Ga0157371_10005973 3300013102 Bacteria 10157
91 Ga0157371_10009152 3300013102 Bacteria 7821
92 Ga0157371_10050635 3300013102 Bacteria 2952
93 Ga0157370_10002605 3300013104 Bacteria 21684
94 Ga0157370_10034391 3300013104 Bacteria 4936
95 Ga0157370_10102224 3300013104 Bacteria 2684
96 Ga0157369_10011242 3300013105 Bacteria 10173
97 Ga0157369_10553600 3300013105 Bacteria 1189
98 Ga0182008_10034689 3300014497 Bacteria 2529
99 Ga0182008_10096785 3300014497 Bacteria 1457
100 Ga0182006_1000022 3300015261 Bacteria 275350
101 Ga0182006_1023968 3300015261 Bacteria 2522
102 Ga0182006_1107517 3300015261 Bacteria 982
103 Ga0183368_1002 3300015687 Bacteria 1865598
104 Ga0183360_10003 3300015689 Bacteria 713221
105 Ga0163161_10000001 3300017792 Bacteria 2041488
106 Ga0163161_10005131 3300017792 Bacteria 9108
107 Ga0163161_10005485 3300017792 Bacteria 8798
108 Ga0163161_10226183 3300017792 Bacteria 1450
109 Ga0163161_10325115 3300017792 Bacteria 1217
110 Ga0209436_103850 3300025208 Bacteria 3839
111 Ga0209674_100014 3300025226 Bacteria 704989
112 Ga0209565_1001783 3300025263 Bacteria 8698
113 Ga0209565_1003136 3300025263 Bacteria 5532
114 Ga0209565_1007397 3300025263 Bacteria 2966
115 Ga0209130_1004553 3300025284 Bacteria 5213
116 Ga0209675_1026834 3300025291 Bacteria 1426
117 Ga0209676_1000098 3300025292 Bacteria 234305
118 Ga0209676_1000991 3300025292 Bacteria 33666
119 Ga0209025_1000098 3300025294 Bacteria 233886
120 Ga0209564_1015709 3300025295 Bacteria 3061
121 Ga0209050_1000525 3300025298 Bacteria 63749
122 Ga0209256_1001323 3300025299 Bacteria 26472
123 Ga0209256_1014049 3300025299 Bacteria 2916
124 Ga0207426_1008869 3300025302 Bacteria 4022
125 Ga0209051_1000098 3300025303 Bacteria 165284
126 Ga0209051_1027099 3300025303 Bacteria 2291
127 Ga0209257_1000157 3300025304 Bacteria 181004
128 Ga0209257_1026748 3300025304 Bacteria 1936
129 Ga0207696_1000517 3300025711 Bacteria 32018
130 Ga0207696_1002641 3300025711 Bacteria 8646
131 Ga0207696_1007861 3300025711 Bacteria 4134
132 Ga0207696_1058933 3300025711 Bacteria 1083
133 Ga0207655_1000027 3300025728 Bacteria 444552
134 Ga0207655_1000042 3300025728 Bacteria 333039
135 Ga0207655_1000079 3300025728 Bacteria 219036
136 Ga0207655_1000423 3300025728 Bacteria 57574
137 Ga0207655_1006225 3300025728 Bacteria 7942
138 Ga0207713_1000054 3300025735 Bacteria 222042
139 Ga0207713_1008995 3300025735 Bacteria 5680
140 Ga0207713_1088244 3300025735 Bacteria 1096
141 Ga0207647_10007646 3300025904 Bacteria 7788
142 Ga0207684_10075539 3300025910 Bacteria 2864
143 Ga0207654_10000015 3300025911 Bacteria 221799
144 Ga0207681_10001080 3300025923 Bacteria 17684
145 Ga0207709_10000019 3300025935 Bacteria 402225
146 Ga0207709_10000130 3300025935 Bacteria 110843
147 Ga0207651_10016148 3300025960 Bacteria 4363
148 Ga0207668_10017411 3300025972 Bacteria 4503
149 Ga0207703_10043921 3300026035 Bacteria 3589
150 Ga0209281_1000005 3300027111 Bacteria 1242284
151 Ga0209281_1000092 3300027111 Bacteria 241437
152 Ga0209281_1000180 3300027111 Bacteria 147099
153 Ga0209281_1001380 3300027111 Bacteria 14894
154 Ga0209281_1002053 3300027111 Bacteria 9081
155 Ga0209371_1005330 3300027312 Bacteria 5159
156 Ga0209371_1010864 3300027312 Bacteria 2756
157 Ga0209282_1000011 3300027666 Bacteria 217665
158 Ga0207428_10000016 3300027907 Bacteria 327690
159 Ga0268256_1001622 3300030500 Bacteria 13019
160 Ga0268256_1010696 3300030500 Bacteria 2955
161 Ga0307405_10048028 3300031731 Bacteria 2630
162 Ga0307405_10725259 3300031731 Bacteria 826
163 Ga0307412_10000804 3300031911 Bacteria 18057
164 Ga0307412_10247750 3300031911 Bacteria 1382
165 Ga0307414_10034366 3300032004 Bacteria 3360
166 Ga0307411_10073542 3300032005 Bacteria 2326
167 Ga0439436_0007403 3300041404 Bacteria 3378
168 Ga0439438_000023 3300041405 Bacteria 101913
169 Ga0439438_007690 3300041405 Bacteria 3654
170 Ga0439447_008361 3300041407 Bacteria 3209
171 Ga0439466_0011365 3300041411 Bacteria 3294
172 Ga0439432_006057 3300042006 Bacteria 4338
173 Ga0439452_000931 3300042010 Bacteria 13185
174 Ga0439452_006872 3300042010 Bacteria 3528
175 Ga0439452_024814 3300042010 Bacteria 1528
176 Ga0439456_000037 3300042013 Bacteria 48769
177 Ga0450900_002491 3300042136 Bacteria 1957
178 Ga0450905_000549 3300042142 Bacteria 4622
179 Ga0450907_000002 3300042146 Bacteria 147876
180 Ga0450908_001631 3300042184 Bacteria 4365
181 Ga0439434_0056810 3300042435 Bacteria 1219
182 Ga0450901_002111 3300042533 Bacteria 2198
183 Ga0466966_0023164 3300044684 Bacteria 4067
184 Ga0466961_0002373 3300044693 Bacteria 11699
185 Ga0466957_0001234 3300044842 Bacteria 13344
186 Ga0466959_0407937 3300045049 Bacteria 923
187 Ga0495617_000216 3300046452 Bacteria 35255
188 Ga0495617_002203 3300046452 Bacteria 7952
189 Ga0495617_087833 3300046452 Bacteria 1016
190 Ga0495627_000093 3300046453 Bacteria 108767
191 Ga0495627_005268 3300046453 Bacteria 5238
192 Ga0495590_0000059 3300046457 Bacteria 92114
193 Ga0495590_0011347 3300046457 Bacteria 3334
194 Ga0495590_0035443 3300046457 Bacteria 1742
195 Ga0495591_000440 3300046458 Bacteria 33847
196 Ga0495591_012568 3300046458 Bacteria 3145
197 Ga0495638_0005031 3300046460 Bacteria 9919
198 Ga0495638_0013826 3300046460 Bacteria 5479
199 Ga0495638_0014997 3300046460 Bacteria 5217
200 Ga0495638_0025543 3300046460 Bacteria 3838
201 Ga0495638_0130145 3300046460 Bacteria 1479
202 Ga0495650_0005655 3300046471 Bacteria 8030
203 Ga0495580_0132627 3300046472 Bacteria 1727
204 Ga0495605_0008041 3300046474 Bacteria 5971
205 Ga0495605_0019716 3300046474 Bacteria 3596
206 Ga0495605_0064238 3300046474 Bacteria 1749
207 Ga0495584_0000223 3300046491 Bacteria 40932
208 Ga0495584_0006021 3300046491 Bacteria 6389
209 Ga0495584_0044068 3300046491 Bacteria 2251
210 Ga0495584_0156217 3300046491 Bacteria 1159
211 Ga0495585_0000563 3300046492 Bacteria 35041
212 Ga0495585_0000650 3300046492 Bacteria 31899
213 Ga0495585_0004304 3300046492 Bacteria 9271
214 Ga0495585_0012581 3300046492 Bacteria 4985
215 Ga0495585_0030342 3300046492 Bacteria 3075
216 Ga0495585_0073277 3300046492 Bacteria 1864
217 Ga0495585_0112797 3300046492 Bacteria 1444
218 Ga0495596_0000063 3300046500 Bacteria 78140
219 Ga0495596_0016757 3300046500 Bacteria 3040
220 Ga0495607_0002226 3300046501 Bacteria 16043
221 Ga0495607_0005951 3300046501 Bacteria 8651
222 Ga0495607_0010765 3300046501 Bacteria 6124
223 Ga0495607_0013235 3300046501 Bacteria 5414
224 Ga0495607_0014501 3300046501 Bacteria 5124
225 Ga0495607_0015635 3300046501 Bacteria 4915
226 Ga0495607_0028684 3300046501 Bacteria 3431
227 Ga0495607_0063422 3300046501 Bacteria 2090
228 Ga0495607_0071589 3300046501 Bacteria 1932
229 Ga0495607_0116962 3300046501 Bacteria 1405
230 Ga0495583_0000045 3300046506 Bacteria 220503
231 Ga0495583_0000367 3300046506 Bacteria 70310
232 Ga0495583_0000857 3300046506 Bacteria 36987
233 Ga0495583_0001487 3300046506 Bacteria 23401
234 Ga0495583_0038852 3300046506 Bacteria 2246
235 Ga0495583_0048540 3300046506 Bacteria 1948
236 Ga0495606_0011012 3300046507 Bacteria 7426
237 Ga0495606_0047087 3300046507 Bacteria 2845
238 Ga0495610_0001672 3300046512 Bacteria 19510
239 Ga0495610_0001748 3300046512 Bacteria 19014
240 Ga0495616_0000770 3300046513 Bacteria 23452
241 Ga0495616_0001788 3300046513 Bacteria 14612
242 Ga0495616_0011508 3300046513 Bacteria 5064
243 Ga0495616_0024618 3300046513 Bacteria 3226
244 Ga0495616_0034422 3300046513 Bacteria 2631
245 Ga0495616_0063361 3300046513 Bacteria 1807
246 Ga0495620_0005985 3300046515 Bacteria 6737
247 Ga0495620_0077850 3300046515 Bacteria 1345
248 Ga0495631_0000938 3300046518 Bacteria 18198
249 Ga0495632_0005872 3300046519 Bacteria 8016
250 Ga0495632_0030830 3300046519 Bacteria 2779
251 Ga0495637_0000011 3300046520 Bacteria 337279
252 Ga0495643_0032741 3300046522 Bacteria 2882
253 Ga0495643_0057479 3300046522 Bacteria 2073
254 Ga0495644_0000054 3300046523 Bacteria 55331
255 Ga0495644_0000653 3300046523 Bacteria 14519
256 Ga0495644_0014571 3300046523 Bacteria 3010
257 Ga0495644_0047144 3300046523 Bacteria 1619
258 Ga0495648_0000722 3300046524 Bacteria 35218
259 Ga0495648_0004864 3300046524 Bacteria 11323
260 Ga0495648_0067541 3300046524 Bacteria 2090
261 Ga0495663_0000445 3300046525 Bacteria 15116
262 Ga0495663_0002745 3300046525 Bacteria 5215
263 Ga0495663_0006038 3300046525 Bacteria 3351
264 Ga0495642_0005182 3300046528 Bacteria 5014
265 Ga0495642_0005285 3300046528 Bacteria 4959
266 Ga0495642_0009438 3300046528 Bacteria 3735
267 Ga0495642_0025001 3300046528 Bacteria 2365
268 Ga0495654_0039098 3300046530 Bacteria 2369
269 Ga0495609_0001265 3300046538 Bacteria 17299
270 Ga0495609_0001705 3300046538 Bacteria 14247
271 Ga0495609_0003367 3300046538 Bacteria 9197
272 Ga0495609_0003873 3300046538 Bacteria 8402
273 Ga0495597_0000129 3300046542 Bacteria 68183
274 Ga0495597_0002397 3300046542 Bacteria 11945
275 Ga0495633_0000801 3300046558 Bacteria 28059
276 Ga0495633_0001694 3300046558 Bacteria 16577
277 Ga0495633_0023945 3300046558 Bacteria 3020
278 Ga0495633_0028892 3300046558 Bacteria 2699
279 Ga0495633_0078817 3300046558 Bacteria 1533
280 Ga0495656_0000033 3300046615 Bacteria 74122
281 Ga0495656_0007072 3300046615 Bacteria 3957
282 Ga0495656_0017505 3300046615 Bacteria 2735
283 Ga0495656_0043319 3300046615 Bacteria 1889
284 Ga0495668_0010888 3300046616 Bacteria 5476
285 Ga0495668_0073129 3300046616 Bacteria 1883
286 Ga0495611_0000730 3300046648 Bacteria 18498
287 Ga0495611_0001213 3300046648 Bacteria 13337
288 Ga0495611_0003970 3300046648 Bacteria 6435
289 Ga0495611_0007779 3300046648 Bacteria 4551
290 Ga0495611_0060252 3300046648 Bacteria 1724
291 Ga0495625_0001930 3300046660 Bacteria 23447
292 Ga0495625_0006238 3300046660 Bacteria 10678
293 Ga0495625_0011107 3300046660 Bacteria 7375
294 Ga0495625_0044896 3300046660 Bacteria 3197
295 Ga0495659_0001285 3300046664 Bacteria 8636
296 Ga0495659_0001462 3300046664 Bacteria 8015
297 Ga0495659_0003039 3300046664 Bacteria 5380
298 Ga0495659_0003240 3300046664 Bacteria 5218
299 Ga0495661_0018918 3300046665 Bacteria 4520
300 Ga0495661_0039857 3300046665 Bacteria 2916
301 Ga0495661_0048418 3300046665 Bacteria 2582
302 Ga0495661_0078133 3300046665 Bacteria 1915
303 Ga0495588_0002593 3300046674 Bacteria 7739
304 Ga0495588_0137095 3300046674 Bacteria 1292
305 Ga0495669_0071381 3300046684 Bacteria 1583
306 Ga0495670_0009310 3300046691 Bacteria 4833
307 Ga0495670_0052930 3300046691 Bacteria 2033
308 Ga0495671_0001967 3300046692 Bacteria 13196
309 Ga0495671_0013775 3300046692 Bacteria 4366
310 Ga0495649_0000762 3300046694 Bacteria 25913
311 Ga0495649_0001266 3300046694 Bacteria 19465
312 Ga0495649_0007289 3300046694 Bacteria 6765
313 Ga0495649_0013849 3300046694 Bacteria 4639
314 Ga0495649_0051256 3300046694 Bacteria 2238
315 Ga0495589_0002370 3300046794 Bacteria 10582
316 Ga0495589_0145744 3300046794 Bacteria 1132
317 Ga0495660_0004635 3300046810 Bacteria 8292
318 Ga0495636_0000460 3300047318 Bacteria 15097
319 Ga0495636_0008837 3300047318 Bacteria 3968
320 Ga0495636_0009485 3300047318 Bacteria 3834
321 Ga0495636_0058726 3300047318 Bacteria 1622
322 Ga0495636_0229881 3300047318 Bacteria 853
323 Ga0495672_0000027 3300047320 Bacteria 325651
324 Ga0495672_0000756 3300047320 Bacteria 35362
325 Ga0495672_0001395 3300047320 Bacteria 23771
326 Ga0495672_0006150 3300047320 Bacteria 9366
327 Ga0495672_0008381 3300047320 Bacteria 7639
328 Ga0495683_0000467 3300047323 Bacteria 31587
329 Ga0495683_0000582 3300047323 Bacteria 27553
330 Ga0495683_0013385 3300047323 Bacteria 4290
331 Ga0495683_0023864 3300047323 Bacteria 3141
332 Ga0495683_0046382 3300047323 Bacteria 2181
333 Ga0495687_000376 3300047443 Bacteria 55694
334 Ga0495687_052359 3300047443 Bacteria 1726
335 Ga0495677_0000452 3300047445 Bacteria 17481
336 Ga0495677_0001167 3300047445 Bacteria 10498
337 Ga0495677_0003548 3300047445 Bacteria 6051
338 Ga0495677_0009702 3300047445 Bacteria 3549
339 Ga0495679_000019 3300047446 Bacteria 231072
340 Ga0495679_008602 3300047446 Bacteria 4136
341 Ga0495679_013515 3300047446 Bacteria 3060
342 Ga0495679_046813 3300047446 Bacteria 1314
343 Ga0495679_055627 3300047446 Bacteria 1174
344 Ga0495685_000090 3300047447 Bacteria 32807
345 Ga0495673_0006850 3300047469 Bacteria 6644
346 Ga0495673_0138611 3300047469 Bacteria 950
347 Ga0495681_0001951 3300047470 Bacteria 15100
348 Ga0495681_0010489 3300047470 Bacteria 5605
349 Ga0495681_0015974 3300047470 Bacteria 4233
350 Ga0495681_0019819 3300047470 Bacteria 3662
351 Ga0495681_0057232 3300047470 Bacteria 1811
352 Ga0495681_0226137 3300047470 Bacteria 748
353 Ga0495686_0010283 3300047472 Bacteria 6663
354 Ga0495626_0001226 3300048091 Bacteria 21108
355 Ga0495626_0002411 3300048091 Bacteria 13024
356 Ga0496115_0000565 3300048918 Bacteria 28778
357 Ga0496116_0001419 3300048919 Bacteria 26936
358 Ga0496116_0009580 3300048919 Bacteria 8247
359 Ga0496116_0014243 3300048919 Bacteria 6361
360 Ga0496117_0014087 3300048920 Bacteria 6913
361 Ga0496118_0000629 3300048921 Bacteria 58021
362 Ga0496118_0011122 3300048921 Bacteria 8823
363 Ga0496118_0042693 3300048921 Bacteria 3575
364 Ga0496118_0051911 3300048921 Bacteria 3133
365 Ga0496119_0024996 3300048922 Bacteria 4181
366 Ga0496120_0007586 3300048923 Bacteria 8045
367 Ga0496121_0000159 3300048924 Bacteria 147049
368 Ga0496121_0004027 3300048924 Bacteria 20202
369 Ga0496121_0088361 3300048924 Bacteria 2430
370 Ga0496122_0000473 3300048925 Bacteria 83672
371 Ga0496122_0026271 3300048925 Bacteria 5024
372 Ga0496122_0128523 3300048925 Bacteria 1616
373 Ga0496123_0001289 3300048926 Bacteria 35761
374 Ga0496123_0021495 3300048926 Bacteria 5014
375 Ga0496124_0000288 3300048927 Bacteria 95203
376 Ga0496124_0035690 3300048927 Bacteria 4348
377 Ga0496124_0080197 3300048927 Bacteria 2686
378 Ga0496124_0215774 3300048927 Bacteria 1447
379 Ga0496125_0000005 3300048928 Bacteria 827598
380 Ga0496125_0002805 3300048928 Bacteria 22018
381 Ga0496125_0005473 3300048928 Bacteria 14095
382 Ga0496125_0009306 3300048928 Bacteria 10133
383 Ga0496126_0008904 3300048929 Bacteria 10747
384 Ga0496126_0164338 3300048929 Bacteria 1895
385 Ga0496126_0324392 3300048929 Bacteria 1265
386 Ga0495678_000205 3300049459 Bacteria 68873
387 Ga0495678_003121 3300049459 Bacteria 10495
388 Ga0495682_0000216 3300049460 Bacteria 45881
389 Ga0495682_0000822 3300049460 Bacteria 19491
390 Ga0495682_0003368 3300049460 Bacteria 7132
391 Ga0501032_0077214 3300049569 Bacteria 2218
392 Ga0501034_0294789 3300049571 Bacteria 1559
393 Ga0501039_0778517 3300049575 Bacteria 747
394 Ga0501047_0194341 3300049581 Bacteria 1892
395 Ga0501073_0064800 3300049589 Bacteria 2548
396 Ga0501035_0022832 3300049822 Bacteria 5745
397 Ga0501044_0000426 3300049823 Bacteria 52024
398 Ga0501044_0161300 3300049823 Bacteria 2219
399 Ga0501044_0841403 3300049823 Bacteria 795
400 nmdc:mga05p37_161565_c1 3300050507 Bacteria 2736
401 nmdc:mga05p37_338246_c1 3300050507 Bacteria 1776
402 nmdc:mga05p37_75538_c1 3300050507 Bacteria 4148
403 nmdc:mga09592_1025650_c1 3300050508 Bacteria 689
404 nmdc:mga09592_386619_c1 3300050508 Bacteria 1210
405 nmdc:mga06r32_117014_c1 3300050510 Bacteria 2627
406 nmdc:mga08y16_32_c1 3300050511 Bacteria 179220
407 nmdc:mga08y16_38900_c1 3300050511 Bacteria 4992
408 2508852081 2508501071 Bacteria 5454741
409 2512637382 2512564013 Bacteria 6286191
410 2512974395 2512875026 Bacteria 6861065
411 2513955372 2513237150 Bacteria 6553639
412 2513961401 2513237151 Bacteria 6309801
413 2514040703 2513237165 Bacteria 6771773
414 2548652015 2547132416 Bacteria 4633861
415 2554815166 2554235132 Bacteria 6772433
416 2585164246 2582581283 Bacteria 6030556
417 2599413766 2599185169 Bacteria 5441380
418 2600197202 2599185352 Bacteria 7228948
419 2601521412 2600255254 Bacteria 5281859
420 2601526436 2600255255 Bacteria 5282785
421 2601613267 2600255280 Bacteria 5292309
422 2601622168 2600255281 Bacteria 5288753
423 2601643364 2600255287 Bacteria 5210468
424 2601650205 2600255288 Bacteria 5282738
425 2601655494 2600255289 Bacteria 5281907
426 2601656741 2600255290 Bacteria 5282218
427 2601663185 2600255291 Bacteria 5217298
428 2601696144 2600255298 Bacteria 5215185
429 2601700818 2600255299 Bacteria 5218662
430 2601704539 2600255300 Bacteria 5287774
431 2601709567 2600255301 Bacteria 5280532
432 2601714579 2600255302 Bacteria 5288235
433 2601721168 2600255303 Bacteria 5219315
434 2601729518 2600255304 Bacteria 5283973
435 2601729526 2600255305 Bacteria 5282329
436 2601734543 2600255306 Bacteria 5281613
437 2601744063 2600255307 Bacteria 5439064
438 2601753378 2600255309 Bacteria 5431045
439 2602020773 2600255392 Bacteria 5437392
440 2603642927 2602042047 Bacteria 4697674
441 2603660569 2602042052 Bacteria 5215873
442 2603665842 2602042053 Bacteria 5214361
443 2603698035 2602042066 Bacteria 4423871
444 2603703536 2602042067 Bacteria 4863713
445 2603836896 2602042103 Bacteria 5284714
446 2603841973 2602042104 Bacteria 5281639
447 2603847046 2602042105 Bacteria 5282303
448 2603852116 2602042106 Bacteria 5282744
449 2603867451 2602042109 Bacteria 5152801
450 2603870171 2602042110 Bacteria 5283285
451 2603875129 2602042111 Bacteria 5212080
452 2606047362 2603880178 Bacteria 5283018
453 2606070274 2603880184 Bacteria 5217896
454 2606146135 2603880202 Bacteria 5284684
455 2606174763 2603880211 Bacteria 5284226
456 2608384528 2606217733 Bacteria 6360972
457 2637226039 2636415599 Bacteria 5718434
458 2640736064 2639762793 Bacteria 3943681
459 2643788963 2643221554 Bacteria 6603920
460 2643808968 2643221557 Bacteria 7184309
461 2644048766 2643221607 Bacteria 6314006
462 2644051821 2643221607 Bacteria 6314006
463 2644069187 2643221610 Bacteria 7480339
464 2644104835 2643221618 Bacteria 7717186
465 2644133489 2643221623 Bacteria 5239945
466 2644151266 2643221626 Bacteria 8069654
467 2644201628 2643221636 Bacteria 6583769
468 2644201911 2643221636 Bacteria 6583769
469 2644252760 2643221645 Bacteria 7207331
470 2644313254 2643221655 Bacteria 7722067
471 2644336340 2643221659 Bacteria 7890716
472 2644361349 2643221665 Bacteria 4699229
473 2644378560 2643221668 Bacteria 7306521
474 2644420258 2643221675 Bacteria 7473456
475 2644453665 2643221680 Bacteria 7473610
476 2644464770 2643221683 Bacteria 5749203
477 2644480689 2643221686 Bacteria 6310811
478 2644481568 2643221686 Bacteria 6310811
479 2644529125 2643221695 Bacteria 3441323
480 2644547176 2643221698 Bacteria 7756764
481 2644612877 2643221712 Bacteria 7729434
482 2644674322 2643221723 Bacteria 7095460
483 2644692364 2643221726 Bacteria 7455827
484 2644745287 2643221736 Bacteria 6608466
485 2656275305 2654587920 Bacteria 5475511
486 2676407771 2675903046 Bacteria 5451247
487 2678229302 2675903507 Bacteria 3737791
488 2681997408 2681812866 Bacteria 4552357
489 2682007088 2681812869 Bacteria 5014465
490 2689444594 2687453601 Bacteria 5546041
491 2722884472 2721755523 Bacteria 6430384
492 2738742470 2738541280 Bacteria 6630198
493 2739307111 2738543024 Bacteria 5603683
494 2743740015 2740892503 Bacteria 6855563
495 2753855489 2751185917 Bacteria 4551186
496 2765588465 2765235842 Bacteria 4799256
497 2774390169 2773857761 Bacteria 3837365
498 2775542279 2775506706 Bacteria 4873073
499 2777024664 2775507074 Bacteria 5532402
500 2807179366 2806310673 Bacteria 4801221
501 2808941848 2808606379 Bacteria 5022697
502 2816517351 2816332141 Bacteria 4436036
503 2821119296 2821118458 Bacteria 4714306
504 2823374252 2823373977 Bacteria 4779415
505 2838080740 2838074704 Bacteria 6785777
506 2839143068 2839138175 Bacteria 6549354
507 2842392067 2842391507 Bacteria 4486072
508 2844169612 2844163670 Bacteria 7266046
509 2844427032 2844425489 Bacteria 4854065
510 2854916189 2854911287 Bacteria 5582813
511 2857540091 2857537821 Bacteria 5248181
512 2858951395 2858950400 Bacteria 6783797
513 2858956754 2858950400 Bacteria 6783797
514 2871452341 2871451962 Bacteria 7336357
515 2874221933 2874220319 Bacteria 4594709
516 2884088311 2884086401 Bacteria 5005459
517 2888368690 2888366609 Bacteria 5155009
518 2901301702 2901300506 Bacteria 8463898
519 2904518361 2904513164 Bacteria 5476410
520 2912966881 2912963787 Bacteria 5646108
521 2916046867 2916041962 Bacteria 6820487
522 2919089430 2919089067 Bacteria 4560942
523 2919112864 2919108558 Bacteria 5897419
524 2919184504 2919182534 Bacteria 3907101
525 2923159106 2923153595 Bacteria 6870622
526 2923638921 2923634449 Bacteria 4753480
527 2927834588 2927833300 Bacteria 4923934
528 2928497403 2928496128 Bacteria 4631123
529 2929189753 2929183550 Bacteria 6377511
530 2931380471 2931380184 Bacteria 4455911
531 2937057400 2937056579 Bacteria 7107896
532 2937543289 2937539931 Bacteria 4639830
533 2937612772 2937610967 Bacteria 4618818
534 2939574449 2939573065 Bacteria 4926053
535 2939607964 2939607340 Bacteria 4719256
536 2939627051 2939626828 Bacteria 4695272
537 2941481552
538 2941488218 2941485952 Bacteria 3591484
539 2941491310 2941489479 Bacteria 6313767
540 2941504471 2941499720 Bacteria 7599444
541 2960693111 2960687367 Bacteria 6535474
542 2961048700 2961047084 Bacteria 4594415
543 2961067589 2961064222 Bacteria 4749990
544 2964615197 2964607997 Bacteria 7101408
545 2969083054 2969079654 Bacteria 5439582
546 2971824326 2971820967 Bacteria 5823634
547 2974312613 2974310843 Bacteria 4947816
548 2977571445 2977565890 Bacteria 6901543
549 2984509911 2984509177 Bacteria 5274802
550 2984519391 2984518228 Bacteria 5277463
551 2984538251 2984537506 Bacteria 5277481
552 2984560072 2984559226 Bacteria 5683096
553 2984598152 2984595703 Bacteria 5682994
554 2989352679 2989349275 Bacteria 6349068
555 640937600 640753048 Bacteria 5495657
556 644751648 644736347 Bacteria 6476522
557 8004006295 8003999396 Bacteria 7063185
558 8004595582 8004592986 Bacteria 5122074
559 8011351961 8011350971 Bacteria 6158957
560 8011353697 8011350971 Bacteria 6158957
561 8018225805 8018221730 Bacteria 4616064
562 8018407179 8018405270 Bacteria 4978981
563 8055088579 8055087960 Bacteria 4784273
564 8055099604 8055097453 Bacteria 4865496
565 8056120579 8056115690 Bacteria 5527654
566 Ga0496113_0014045
567 SwRhRL2b_contig_1285905
568 SwRhRL2b_contig_148930
569 SwRhRL2b_contig_1554327
570 SwRhRL2b_contig_3580412
571 JGI24739J22299_10032649
572 JGI24735J21928_10002402
573 JGI25158J39367_1002663
574 JGI25159J45721_1008201
575 rootH2_10004276
576 JGI25160J50197_1012751
577 JGI25161J50226_1004519
578 Ga0055526_1015775
579 Ga0055537_1005801
580 Ga0055537_1019322
581 Ga0055536_1000458
582 Ga0055536_1006139
583 Ga0055534_1005125
584 Ga0055530_10006986
585 Ga0055540_1000344
586 Ga0055531_10018220
587 Ga0058692_1027174
588 Ga0055543_1006180
589 Ga0065165_1015275
590 Ga0065703_1000278
591 Ga0065704_10096582
592 Ga0065704_10108081
593 Ga0065704_10110904
594 Ga0065704_10206317
595 Ga0065715_10521747
596 Ga0070669_100002005
597 Ga0070673_100006037
598 Ga0070711_100204144
599 Ga0070694_100031563
600 Ga0070694_100044913
601 Ga0070706_100101310
602 Ga0070707_100423538
603 Ga0070698_100157035
604 Ga0070698_100587630
605 Ga0070699_100016974
606 Ga0070697_100028533
607 Ga0070697_100588631
608 Ga0070695_100036228
609 Ga0070695_100363330
610 Ga0070695_100443992
611 Ga0070696_100028212
612 Ga0070696_100355475
613 Ga0070704_100310960
614 Ga0070704_100394302
615 Ga0070704_100473166
616 Ga0070704_100781853
617 Ga0068864_100712880
618 Ga0068860_100581968
619 Ga0075366_10142596
620 Ga0075428_100288714
621 Ga0075428_100482024
622 Ga0075430_100034008
623 Ga0075430_100137450
624 Ga0075429_100495596
625 Ga0079104_1000004
626 Ga0079104_1000274
627 Ga0079104_1000859
628 Ga0079104_1001748
629 Ga0079104_1001872
630 Ga0099794_10253601
631 Ga0105251_10000036
632 Ga0105251_10001816
633 Ga0105251_10023911
634 Ga0105251_10139824
635 Ga0105244_10000071
636 Ga0105244_10003937
637 Ga0105244_10007727
638 Ga0105244_10015908
639 Ga0105244_10031066
640 Ga0105250_10008380
641 Ga0105250_10019425
642 Ga0105250_10106160
643 Ga0111539_10000192
644 Ga0111539_10233533
645 Ga0111539_10425337
646 Ga0114129_10094609
647 Ga0114129_10377249
648 Ga0114129_10478367
649 Ga0105243_10000547
650 Ga0105243_10001371
651 Ga0105241_10000012
652 Ga0105241_10305655
653 Ga0105246_10081391
654 Ga0157373_10001666
655 Ga0157371_10005973
656 Ga0157371_10009152
657 Ga0157371_10050635
658 Ga0157370_10002605
659 Ga0157370_10034391
660 Ga0157370_10102224
661 Ga0157369_10011242
662 Ga0157369_10553600
663 Ga0182008_10034689
664 Ga0182008_10096785
665 Ga0182006_1000022
666 Ga0182006_1023968
667 Ga0182006_1107517
668 Ga0183368_1002
669 Ga0183360_10003
670 Ga0163161_10000001
671 Ga0163161_10005131
672 Ga0163161_10005485
673 Ga0163161_10226183
674 Ga0163161_10325115
675 Ga0209436_103850
676 Ga0209674_100014
677 Ga0209565_1001783
678 Ga0209565_1003136
679 Ga0209565_1007397
680 Ga0209130_1004553
681 Ga0209675_1026834
682 Ga0209676_1000098
683 Ga0209676_1000991
684 Ga0209025_1000098
685 Ga0209564_1015709
686 Ga0209050_1000525
687 Ga0209256_1001323
688 Ga0209256_1014049
689 Ga0207426_1008869
690 Ga0209051_1000098
691 Ga0209051_1027099
692 Ga0209257_1000157
693 Ga0209257_1026748
694 Ga0207696_1000517
695 Ga0207696_1002641
696 Ga0207696_1007861
697 Ga0207696_1058933
698 Ga0207655_1000027
699 Ga0207655_1000042
700 Ga0207655_1000079
701 Ga0207655_1000423
702 Ga0207655_1006225
703 Ga0207713_1000054
704 Ga0207713_1008995
705 Ga0207713_1088244
706 Ga0207647_10007646
707 Ga0207684_10075539
708 Ga0207654_10000015
709 Ga0207681_10001080
710 Ga0207709_10000019
711 Ga0207709_10000130
712 Ga0207651_10016148
713 Ga0207668_10017411
714 Ga0207703_10043921
715 Ga0209281_1000005
716 Ga0209281_1000092
717 Ga0209281_1000180
718 Ga0209281_1001380
719 Ga0209281_1002053
720 Ga0209371_1005330
721 Ga0209371_1010864
722 Ga0209282_1000011
723 Ga0207428_10000016
724 Ga0268256_1001622
725 Ga0268256_1010696
726 Ga0307405_10048028
727 Ga0307405_10725259
728 Ga0307412_10000804
729 Ga0307412_10247750
730 Ga0307414_10034366
731 Ga0307411_10073542
732 Ga0439436_0007403
733 Ga0439438_000023
734 Ga0439438_007690
735 Ga0439447_008361
736 Ga0439466_0011365
737 Ga0439432_006057
738 Ga0439452_000931
739 Ga0439452_006872
740 Ga0439452_024814
741 Ga0439456_000037
742 Ga0450900_002491
743 Ga0450905_000549
744 Ga0450907_000002
745 Ga0450908_001631
746 Ga0439434_0056810
747 Ga0450901_002111
748 Ga0466966_0023164
749 Ga0466961_0002373
750 Ga0466957_0001234
751 Ga0466959_0407937
752 Ga0495617_000216
753 Ga0495617_002203
754 Ga0495617_087833
755 Ga0495627_000093
756 Ga0495627_005268
757 Ga0495590_0000059
758 Ga0495590_0011347
759 Ga0495590_0035443
760 Ga0495591_000440
761 Ga0495591_012568
762 Ga0495638_0005031
763 Ga0495638_0013826
764 Ga0495638_0014997
765 Ga0495638_0025543
766 Ga0495638_0130145
767 Ga0495650_0005655
768 Ga0495580_0132627
769 Ga0495605_0008041
770 Ga0495605_0019716
771 Ga0495605_0064238
772 Ga0495584_0000223
773 Ga0495584_0006021
774 Ga0495584_0044068
775 Ga0495584_0156217
776 Ga0495585_0000563
777 Ga0495585_0000650
778 Ga0495585_0004304
779 Ga0495585_0012581
780 Ga0495585_0030342
781 Ga0495585_0073277
782 Ga0495585_0112797
783 Ga0495596_0000063
784 Ga0495596_0016757
785 Ga0495607_0002226
786 Ga0495607_0005951
787 Ga0495607_0010765
788 Ga0495607_0013235
789 Ga0495607_0014501
790 Ga0495607_0015635
791 Ga0495607_0028684
792 Ga0495607_0063422
793 Ga0495607_0071589
794 Ga0495607_0116962
795 Ga0495583_0000045
796 Ga0495583_0000367
797 Ga0495583_0000857
798 Ga0495583_0001487
799 Ga0495583_0038852
800 Ga0495583_0048540
801 Ga0495606_0011012
802 Ga0495606_0047087
803 Ga0495610_0001672
804 Ga0495610_0001748
805 Ga0495616_0000770
806 Ga0495616_0001788
807 Ga0495616_0011508
808 Ga0495616_0024618
809 Ga0495616_0034422
810 Ga0495616_0063361
811 Ga0495620_0005985
812 Ga0495620_0077850
813 Ga0495631_0000938
814 Ga0495632_0005872
815 Ga0495632_0030830
816 Ga0495637_0000011
817 Ga0495643_0032741
818 Ga0495643_0057479
819 Ga0495644_0000054
820 Ga0495644_0000653
821 Ga0495644_0014571
822 Ga0495644_0047144
823 Ga0495648_0000722
824 Ga0495648_0004864
825 Ga0495648_0067541
826 Ga0495663_0000445
827 Ga0495663_0002745
828 Ga0495663_0006038
829 Ga0495642_0005182
830 Ga0495642_0005285
831 Ga0495642_0009438
832 Ga0495642_0025001
833 Ga0495654_0039098
834 Ga0495609_0001265
835 Ga0495609_0001705
836 Ga0495609_0003367
837 Ga0495609_0003873
838 Ga0495597_0000129
839 Ga0495597_0002397
840 Ga0495633_0000801
841 Ga0495633_0001694
842 Ga0495633_0023945
843 Ga0495633_0028892
844 Ga0495633_0078817
845 Ga0495656_0000033
846 Ga0495656_0007072
847 Ga0495656_0017505
848 Ga0495656_0043319
849 Ga0495668_0010888
850 Ga0495668_0073129
851 Ga0495611_0000730
852 Ga0495611_0001213
853 Ga0495611_0003970
854 Ga0495611_0007779
855 Ga0495611_0060252
856 Ga0495625_0001930
857 Ga0495625_0006238
858 Ga0495625_0011107
859 Ga0495625_0044896
860 Ga0495659_0001285
861 Ga0495659_0001462
862 Ga0495659_0003039
863 Ga0495659_0003240
864 Ga0495661_0018918
865 Ga0495661_0039857
866 Ga0495661_0048418
867 Ga0495661_0078133
868 Ga0495588_0002593
869 Ga0495588_0137095
870 Ga0495669_0071381
871 Ga0495670_0009310
872 Ga0495670_0052930
873 Ga0495671_0001967
874 Ga0495671_0013775
875 Ga0495649_0000762
876 Ga0495649_0001266
877 Ga0495649_0007289
878 Ga0495649_0013849
879 Ga0495649_0051256
880 Ga0495589_0002370
881 Ga0495589_0145744
882 Ga0495660_0004635
883 Ga0495636_0000460
884 Ga0495636_0008837
885 Ga0495636_0009485
886 Ga0495636_0058726
887 Ga0495636_0229881
888 Ga0495672_0000027
889 Ga0495672_0000756
890 Ga0495672_0001395
891 Ga0495672_0006150
892 Ga0495672_0008381
893 Ga0495683_0000467
894 Ga0495683_0000582
895 Ga0495683_0013385
896 Ga0495683_0023864
897 Ga0495683_0046382
898 Ga0495687_000376
899 Ga0495687_052359
900 Ga0495677_0000452
901 Ga0495677_0001167
902 Ga0495677_0003548
903 Ga0495677_0009702
904 Ga0495679_000019
905 Ga0495679_008602
906 Ga0495679_013515
907 Ga0495679_046813
908 Ga0495679_055627
909 Ga0495685_000090
910 Ga0495673_0006850
911 Ga0495673_0138611
912 Ga0495681_0001951
913 Ga0495681_0010489
914 Ga0495681_0015974
915 Ga0495681_0019819
916 Ga0495681_0057232
917 Ga0495681_0226137
918 Ga0495686_0010283
919 Ga0495626_0001226
920 Ga0495626_0002411
921 Ga0496115_0000565
922 Ga0496116_0001419
923 Ga0496116_0009580
924 Ga0496116_0014243
925 Ga0496117_0014087
926 Ga0496118_0000629
927 Ga0496118_0011122
928 Ga0496118_0042693
929 Ga0496118_0051911
930 Ga0496119_0024996
931 Ga0496120_0007586
932 Ga0496121_0000159
933 Ga0496121_0004027
934 Ga0496121_0088361
935 Ga0496122_0000473
936 Ga0496122_0026271
937 Ga0496122_0128523
938 Ga0496123_0001289
939 Ga0496123_0021495
940 Ga0496124_0000288
941 Ga0496124_0035690
942 Ga0496124_0080197
943 Ga0496124_0215774
944 Ga0496125_0000005
945 Ga0496125_0002805
946 Ga0496125_0005473
947 Ga0496125_0009306
948 Ga0496126_0008904
949 Ga0496126_0164338
950 Ga0496126_0324392
951 Ga0495678_000205
952 Ga0495678_003121
953 Ga0495682_0000216
954 Ga0495682_0000822
955 Ga0495682_0003368
956 Ga0501032_0077214
957 Ga0501034_0294789
958 Ga0501039_0778517
959 Ga0501047_0194341
960 Ga0501073_0064800
961 Ga0501035_0022832
962 Ga0501044_0000426
963 Ga0501044_0161300
964 Ga0501044_0841403
965 nmdc:mga05p37_161565_c1
966 nmdc:mga05p37_338246_c1
967 nmdc:mga05p37_75538_c1
968 nmdc:mga09592_1025650_c1
969 nmdc:mga09592_386619_c1
970 nmdc:mga06r32_117014_c1
971 nmdc:mga08y16_32_c1
972 nmdc:mga08y16_38900_c1
973 2508852081
974 2512637382
975 2512974395
976 2513955372
977 2513961401
978 2514040703
979 2548652015
980 2554815166
981 2585164246
982 2599413766
983 2600197202
984 2601521412
985 2601526436
986 2601613267
987 2601622168
988 2601643364
989 2601650205
990 2601655494
991 2601656741
992 2601663185
993 2601696144
994 2601700818
995 2601704539
996 2601709567
997 2601714579
998 2601721168
999 2601729518
1000 2601729526
1001 2601734543
1002 2601744063
1003 2601753378
1004 2602020773
1005 2603642927
1006 2603660569
1007 2603665842
1008 2603698035
1009 2603703536
1010 2603836896
1011 2603841973
1012 2603847046
1013 2603852116
1014 2603867451
1015 2603870171
1016 2603875129
1017 2606047362
1018 2606070274
1019 2606146135
1020 2606174763
1021 2608384528
1022 2637226039
1023 2640736064
1024 2643788963
1025 2643808968
1026 2644048766
1027 2644051821
1028 2644069187
1029 2644104835
1030 2644133489
1031 2644151266
1032 2644201628
1033 2644201911
1034 2644252760
1035 2644313254
1036 2644336340
1037 2644361349
1038 2644378560
1039 2644420258
1040 2644453665
1041 2644464770
1042 2644480689
1043 2644481568
1044 2644529125
1045 2644547176
1046 2644612877
1047 2644674322
1048 2644692364
1049 2644745287
1050 2656275305
1051 2676407771
1052 2678229302
1053 2681997408
1054 2682007088
1055 2689444594
1056 2722884472
1057 2738742470
1058 2739307111
1059 2743740015
1060 2753855489
1061 2765588465
1062 2774390169
1063 2775542279
1064 2777024664
1065 2807179366
1066 2808941848
1067 2816517351
1068 2821119296
1069 2823374252
1070 2838080740
1071 2839143068
1072 2842392067
1073 2844169612
1074 2844427032
1075 2854916189
1076 2857540091
1077 2858951395
1078 2858956754
1079 2871452341
1080 2874221933
1081 2884088311
1082 2888368690
1083 2901301702
1084 2904518361
1085 2912966881
1086 2916046867
1087 2919089430
1088 2919112864
1089 2919184504
1090 2923159106
1091 2923638921
1092 2927834588
1093 2928497403
1094 2929189753
1095 2931380471
1096 2937057400
1097 2937543289
1098 2937612772
1099 2939574449
1100 2939607964
1101 2939627051
1102 2941481552
1103 2941488218
1104 2941491310
1105 2941504471
1106 2960693111
1107 2961048700
1108 2961067589
1109 2964615197
1110 2969083054
1111 2971824326
1112 2974312613
1113 2977571445
1114 2984509911
1115 2984519391
1116 2984538251
1117 2984560072
1118 2984598152
1119 2989352679
1120 640937600
1121 644751648
1122 8004006295
1123 8004595582
1124 8011351961
1125 8011353697
1126 8018225805
1127 8018407179
1128 8055088579
1129 8055099604
1130 8056120579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

55

209

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.8896 16 186
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.8807 80 147
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.8804 16 188
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.8786 13 186
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8559 67 147
ID Description Score Start End Superfamily
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8807 80 147 3.40.50.850
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8671 13 186 3.40.50.850
af_Q9USS0_3_213_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.867 80 147 3.40.50.850
af_P21369_4_203_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8669 78 146 3.40.50.850
af_Q9VDU7_96_314_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8646 80 146 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A7X1EUG2-F1-model_v4 deleted 0.9405 60 158
AF-A0A7X1EUG2-F1-model_v4 deleted 0.9226 60 158
AF-A0A751SU60-F1-model_v4 Isochorismatase family protein 0.922 4 171
AF-A0A6I1JAI0-F1-model_v4 deleted 0.9209 4 147
AF-A0A1H3P4S7-F1-model_v4 Nicotinamidase-related amidase 0.9189 4 178

Map