F464317

General Info

Members Datasets Scaffolds Average Seq Length
565 330 473 540

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0001190|Ga0501034_0001190_13010_15055
Length 663
Sequence LPASATRLSAGQCLQLCVPAGTVLHAGAGRIEVSGPPQWLAESWHVSRWRLRAGETLAIPAWLAAGRGAGPAGVAQAPRAVAMAAPAATDCRPGAGKTIKLRSGRTWHIGVPNPPAAVPGFPMLRLSEVKLPLDHTESDLDAAVRASAAQIGVKGDGLIGYTVFRRAHDARKRSDIKLTYIIDLEVSDEATARKRMAGKPNWSVTPDMEYHFVARAPQGGPALRPVVIGMGPCGLLAGLILAQSGFRPIVLERGKEVRERTKDTFGLWRKSVLNPESNVQFGEGGAGTFSDGKLYSQIKDPKHYGRKVLNEFVRAGAPEDILVKARPHIGTFRLVSMVEKMRAEIIELGGEIRFETRVDDIDIDGGKVRGLKLSNGEYLEADHVIMAVGHSARDTFEMLHDRGVFMEAKPFSLGFRIEHPQGLINRSRFGKFAGNKLLGAADYKVVHHCSNGRSVYSFCMCPGGTVVAAASEPGRVVTNGMSQYKRAERNANAGIVVGITPDDYPGGPLAGIEFQRKWEERAFELGGSNYNAPGQLVGDFIAGRASTSLGSVEPSYKPGVTPTDLSTSLPDYVIEAIREGIPEIDKKLPGFALHDAVLTGVETRTSSPLRIRRNNDDYQSINVRGLYPAGEGAGYAGGIYSAAIDGIEVAEAVALSIVGGKQA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
11 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
12 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
13 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
14 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
15 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
16 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
17 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
18 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
19 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
20 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
21 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
22 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
23 2643221660 Methylibium sp. Root1272 Isolate Unclassified
24 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
25 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
26 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
27 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
28 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
29 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
30 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
31 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
32 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
33 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
34 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
35 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
36 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
37 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
38 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
39 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
40 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
41 2818991450 Burkholderia sp. 604 Isolate Unclassified
42 2818991452 Burkholderia cepacia 561 Isolate Unclassified
43 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
44 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
45 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
46 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
47 2855730933 Achromobacter sp. HZ28 Isolate Nodule
48 2855767633 Achromobacter sp. HZ34 Isolate Nodule
49 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
50 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
51 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
52 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
53 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
54 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
55 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
56 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
57 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
58 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
59 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
60 2904564687 Burkholderia sp. 571 Isolate Unclassified
61 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
62 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
63 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
64 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
65 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
66 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
67 2928163908 Burkholderia sp. 567 Isolate Unclassified
68 2928170801 Burkholderia sp. 572 Isolate Unclassified
69 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
70 2928536128 Burkholderia sola 565 Isolate Unclassified
71 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
72 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
73 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
74 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
75 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
76 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
77 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
78 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
79 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
80 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
81 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
82 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
83 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
84 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
85 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
86 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
87 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
88 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
89 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
90 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
91 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
92 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
93 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
94 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
97 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
123 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
165 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
189 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
198 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
290 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
298 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
299 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
310 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
311 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
312 639633007 Azoarcus olearius BH72 Isolate Unclassified
313 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
314 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
315 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
316 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
317 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
318 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
319 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
320 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
321 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
322 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
323 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
324 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
325 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
326 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
327 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
328 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
329 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
330 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.72
Metatranscriptomes 0
Isolates 16.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.45
Nodule 3.54
Rhizoplane 2.65
Rhizosphere 66.9
Stem 0
Stem Tuber 0
Unclassified 13.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000096 3300001979 Bacteria 30943
2 JGI24740J21852_10000665 3300001979 Bacteria 14886
3 JGI24739J22299_10002547 3300001989 Bacteria 7029
4 JGI24739J22299_10005128 3300001989 Bacteria 4989
5 JGI24739J22299_10008190 3300001989 Bacteria 3902
6 JGI24737J22298_10011182 3300001990 Bacteria 2945
7 JGI24735J21928_10000897 3300002067 Bacteria 10623
8 JGI25156J39149_1001141 3300002705 Bacteria 11899
9 JGI25156J39149_1001151 3300002705 Bacteria 11861
10 JGI25156J39149_1001474 3300002705 Bacteria 9889
11 JGI25156J39149_1012063 3300002705 Bacteria 1924
12 JGI25154J39366_1001608 3300002738 Bacteria 7679
13 JGI25151J46595_10000096 3300003187 Bacteria 118213
14 JGI25151J46595_10002553 3300003187 Bacteria 10803
15 JGI25165J46597_1002875 3300003214 Bacteria 4900
16 JGI25160J50197_1000025 3300003354 Bacteria 186706
17 Ga0055533_1000339 3300003756 Bacteria 20510
18 Ga0055533_1001609 3300003756 Bacteria 5832
19 Ga0055532_1000043 3300003758 Bacteria 195042
20 Ga0055532_1001069 3300003758 Bacteria 8468
21 Ga0055532_1001171 3300003758 Bacteria 7913
22 Ga0055525_1000006 3300003759 Bacteria 642912
23 Ga0055527_1000026 3300003760 Bacteria 192398
24 Ga0055535_1000032 3300003761 Bacteria 195042
25 Ga0055535_1001816 3300003761 Bacteria 9240
26 Ga0055542_1000049 3300003762 Bacteria 195042
27 Ga0055542_1000659 3300003762 Bacteria 28301
28 Ga0055542_1000766 3300003762 Bacteria 24309
29 Ga0055542_1001743 3300003762 Bacteria 9240
30 Ga0055529_1000059 3300003763 Bacteria 195042
31 Ga0055529_1001014 3300003763 Bacteria 13501
32 Ga0055526_1004148 3300003771 Bacteria 8820
33 Ga0055524_1002077 3300003775 Bacteria 10609
34 Ga0055524_1018853 3300003775 Bacteria 2380
35 Ga0055536_1000020 3300003781 Bacteria 199649
36 Ga0055534_1000814 3300003784 Bacteria 14411
37 Ga0055534_1002241 3300003784 Bacteria 6840
38 Ga0058692_1003047 3300003856 Bacteria 5346
39 Ga0065165_1000173 3300005262 Bacteria 114553
40 Ga0070658_10019262 3300005327 Bacteria 5467
41 Ga0070658_10040061 3300005327 Bacteria 3780
42 Ga0070666_10000003 3300005335 Bacteria 463666
43 Ga0070666_10006429 3300005335 Bacteria 7222
44 Ga0070660_100009504 3300005339 Bacteria 6842
45 Ga0070660_100127706 3300005339 Bacteria 2032
46 Ga0070687_100005878 3300005343 Bacteria 4990
47 Ga0070669_100000104 3300005353 Bacteria 80979
48 Ga0070659_100036047 3300005366 Bacteria 3854
49 Ga0070710_10005929 3300005437 Bacteria 5834
50 Ga0070663_100000177 3300005455 Bacteria 32482
51 Ga0070678_100040982 3300005456 Bacteria 3280
52 Ga0070665_100016183 3300005548 Bacteria 7483
53 Ga0070665_100053574 3300005548 Bacteria 4046
54 Ga0068858_100131722 3300005842 Bacteria 2345
55 Ga0075364_10026280 3300006051 Bacteria 3712
56 Ga0075366_10000651 3300006195 Bacteria 16360
57 Ga0097621_100002147 3300006237 Bacteria 13495
58 Ga0068871_100000379 3300006358 Bacteria 31123
59 Ga0075429_100007034 3300006880 Bacteria 9774
60 Ga0099826_10000004 3300006948 Bacteria 802669
61 Ga0105251_10000438 3300009011 Bacteria 40380
62 Ga0105240_10014912 3300009093 Bacteria 10587
63 Ga0105237_10001467 3300009545 Bacteria 31062
64 Ga0105238_10001660 3300009551 Bacteria 22345
65 Ga0105239_10000568 3300010375 Bacteria 52997
66 Ga0105239_10038426 3300010375 Bacteria 5246
67 Ga0105246_10093314 3300011119 Bacteria 2174
68 Ga0157371_10000010 3300013102 Bacteria 384921
69 Ga0157369_10002778 3300013105 Bacteria 20904
70 Ga0163162_10000381 3300013306 Bacteria 40432
71 Ga0163162_10121052 3300013306 Bacteria 2722
72 Ga0183363_1005 3300015690 Bacteria 403020
73 Ga0209566_100781 3300025225 Bacteria 16945
74 Ga0209566_100873 3300025225 Bacteria 14760
75 Ga0209674_100017 3300025226 Bacteria 689087
76 Ga0209674_100209 3300025226 Bacteria 58880
77 Ga0209674_100312 3300025226 Bacteria 32298
78 Ga0209672_100001 3300025228 Bacteria 2828210
79 Ga0209672_100014 3300025228 Bacteria 546252
80 Ga0209147_100022 3300025229 Bacteria 443906
81 Ga0209147_100171 3300025229 Bacteria 86726
82 Ga0209147_100586 3300025229 Bacteria 20183
83 Ga0209563_100022 3300025230 Bacteria 643318
84 Ga0207427_102677 3300025231 Bacteria 4497
85 Ga0209258_100033 3300025242 Bacteria 443845
86 Ga0209258_100183 3300025242 Bacteria 136466
87 Ga0209646_1000019 3300025246 Bacteria 475248
88 Ga0209026_1002168 3300025250 Bacteria 7625
89 Ga0209677_103097 3300025253 Bacteria 5659
90 Ga0209148_1000035 3300025254 Bacteria 548413
91 Ga0209148_1000046 3300025254 Bacteria 443881
92 Ga0209148_1000193 3300025254 Bacteria 115649
93 Ga0209759_1000770 3300025256 Bacteria 27111
94 Ga0209759_1002235 3300025256 Bacteria 8827
95 Ga0209759_1002543 3300025256 Bacteria 7930
96 Ga0209759_1003845 3300025256 Bacteria 5817
97 Ga0209233_1000050 3300025261 Bacteria 450736
98 Ga0209565_1000103 3300025263 Bacteria 127199
99 Ga0209455_1000038 3300025272 Bacteria 443899
100 Ga0209455_1000072 3300025272 Bacteria 293074
101 Ga0209673_1000140 3300025273 Bacteria 157575
102 Ga0209130_1004078 3300025284 Bacteria 5763
103 Ga0209675_1000109 3300025291 Bacteria 117127
104 Ga0209675_1006048 3300025291 Bacteria 4942
105 Ga0209676_1000066 3300025292 Bacteria 317897
106 Ga0209025_1000003 3300025294 Bacteria 1366495
107 Ga0209025_1000297 3300025294 Bacteria 111389
108 Ga0209025_1001260 3300025294 Bacteria 35038
109 Ga0209025_1001779 3300025294 Bacteria 25633
110 Ga0209025_1007411 3300025294 Bacteria 8196
111 Ga0209564_1000970 3300025295 Bacteria 36261
112 Ga0209564_1001046 3300025295 Bacteria 33841
113 Ga0209564_1001983 3300025295 Bacteria 17946
114 Ga0209564_1007205 3300025295 Bacteria 5793
115 Ga0209564_1008024 3300025295 Bacteria 5293
116 Ga0209256_1000599 3300025299 Bacteria 50126
117 Ga0209256_1003976 3300025299 Bacteria 9709
118 Ga0207426_1000020 3300025302 Bacteria 558084
119 Ga0209051_1005465 3300025303 Bacteria 7415
120 Ga0209051_1006337 3300025303 Bacteria 6695
121 Ga0207713_1000390 3300025735 Bacteria 47707
122 Ga0207680_10000006 3300025903 Bacteria 635950
123 Ga0207680_10033847 3300025903 Bacteria 2919
124 Ga0207647_10003708 3300025904 Bacteria 11421
125 Ga0207647_10005594 3300025904 Bacteria 9182
126 Ga0207647_10035466 3300025904 Bacteria 3179
127 Ga0207695_10008771 3300025913 Bacteria 12610
128 Ga0207695_10068828 3300025913 Bacteria 3625
129 Ga0207671_10000206 3300025914 Bacteria 89176
130 Ga0207657_10001927 3300025919 Bacteria 22401
131 Ga0207681_10000051 3300025923 Bacteria 114367
132 Ga0207706_10030166 3300025933 Bacteria 4839
133 Ga0207667_10023453 3300025949 Bacteria 6794
134 Ga0207678_10000060 3300026067 Bacteria 85708
135 Ga0207683_10062003 3300026121 Bacteria 3292
136 Ga0209371_1000079 3300027312 Bacteria 187621
137 Ga0209371_1012338 3300027312 Bacteria 2480
138 Ga0209282_1000015 3300027666 Bacteria 206531
139 Ga0209974_10003043 3300027876 Bacteria 6062
140 Ga0268266_10000043 3300028379 Bacteria 316604
141 Ga0268266_10084849 3300028379 Bacteria 2766
142 Ga0307515_10000123 3300028794 Bacteria 186601
143 Ga0307515_10000870 3300028794 Bacteria 69361
144 Ga0307515_10001649 3300028794 Bacteria 49654
145 Ga0307515_10079791 3300028794 Bacteria 4280
146 Ga0265338_10074122 3300028800 Bacteria 2897
147 Ga0268256_1000090 3300030500 Bacteria 153976
148 Ga0268256_1013441 3300030500 Bacteria 2480
149 Ga0307512_10020892 3300030522 Bacteria 5914
150 Ga0265330_10003103 3300031235 Bacteria 8793
151 Ga0265332_10002095 3300031238 Bacteria 10359
152 Ga0265325_10000129 3300031241 Bacteria 51966
153 Ga0307513_10011480 3300031456 Bacteria 11007
154 Ga0307509_10052710 3300031507 Bacteria 4342
155 Ga0307408_100015115 3300031548 Bacteria 5137
156 Ga0307408_100039047 3300031548 Bacteria 3353
157 Ga0265313_10007959 3300031595 Bacteria 7119
158 Ga0307508_10001439 3300031616 Bacteria 26811
159 Ga0307514_10017332 3300031649 Bacteria 5929
160 Ga0265314_10002287 3300031711 Bacteria 19835
161 Ga0307516_10009733 3300031730 Bacteria 10665
162 Ga0307412_10000011 3300031911 Bacteria 405842
163 Ga0307416_100136925 3300032002 Bacteria 2217
164 Ga0307510_10000232 3300033180 Bacteria 49997
165 Ga0373935_0067130 3300035692 Bacteria 2305
166 Ga0395899_0006930 3300037312 Bacteria 8778
167 Ga0395900_0005646 3300037418 Bacteria 13087
168 Ga0395898_0000254 3300037466 Bacteria 131247
169 Ga0395901_0000009 3300038443 Bacteria 479396
170 Ga0395901_0013930 3300038443 Bacteria 8183
171 Ga0395901_0021862 3300038443 Bacteria 6555
172 Ga0451793_1490485 3300041452 Bacteria 2429
173 Ga0451806_615820 3300041462 Bacteria 2670
174 Ga0439448_0000360 3300042005 Bacteria 10240
175 Ga0450919_001759 3300042121 Bacteria 2828
176 Ga0450918_001066 3300042531 Bacteria 5651
177 Ga0451577_0000936 3300042876 Bacteria 42888
178 Ga0453684_0002634 3300044712 Bacteria 42888
179 Ga0466957_0003707 3300044842 Bacteria 8442
180 Ga0466957_0026185 3300044842 Bacteria 3459
181 Ga0466967_0013006 3300045976 Bacteria 6403
182 Ga0495617_000276 3300046452 Bacteria 29626
183 Ga0495627_001064 3300046453 Bacteria 18149
184 Ga0495627_002431 3300046453 Bacteria 8987
185 Ga0495603_0000935 3300046455 Bacteria 16800
186 Ga0495603_0003018 3300046455 Bacteria 9972
187 Ga0495590_0000063 3300046457 Bacteria 81777
188 Ga0495590_0005458 3300046457 Bacteria 5042
189 Ga0495590_0006649 3300046457 Bacteria 4506
190 Ga0495591_001082 3300046458 Bacteria 18146
191 Ga0495629_0000609 3300046459 Bacteria 29116
192 Ga0495629_0000625 3300046459 Bacteria 28762
193 Ga0495629_0002674 3300046459 Bacteria 13639
194 Ga0495629_0014960 3300046459 Bacteria 5574
195 Ga0495638_0009866 3300046460 Bacteria 6664
196 Ga0495653_0007197 3300046463 Bacteria 9117
197 Ga0495653_0025139 3300046463 Bacteria 4790
198 Ga0495653_0062465 3300046463 Bacteria 2814
199 Ga0495650_0000353 3300046471 Bacteria 81130
200 Ga0495650_0000441 3300046471 Bacteria 66713
201 Ga0495650_0006720 3300046471 Bacteria 7118
202 Ga0495580_0000844 3300046472 Bacteria 26546
203 Ga0495580_0022666 3300046472 Bacteria 4617
204 Ga0495580_0033487 3300046472 Bacteria 3701
205 Ga0495580_0052674 3300046472 Bacteria 2873
206 Ga0495582_0004978 3300046473 Bacteria 7443
207 Ga0495582_0008687 3300046473 Bacteria 5602
208 Ga0495582_0012578 3300046473 Bacteria 4665
209 Ga0495605_0000265 3300046474 Bacteria 59855
210 Ga0495605_0004370 3300046474 Bacteria 8317
211 Ga0495605_0005136 3300046474 Bacteria 7630
212 Ga0495605_0024028 3300046474 Bacteria 3194
213 Ga0495605_0036021 3300046474 Bacteria 2497
214 Ga0495662_0009867 3300046476 Bacteria 4690
215 Ga0495664_0013037 3300046477 Bacteria 4713
216 Ga0495664_0013922 3300046477 Bacteria 4559
217 Ga0495664_0026525 3300046477 Bacteria 3374
218 Ga0495664_0074742 3300046477 Bacteria 2027
219 Ga0495584_0000015 3300046491 Bacteria 169335
220 Ga0495584_0000757 3300046491 Bacteria 21367
221 Ga0495584_0000843 3300046491 Bacteria 19864
222 Ga0495584_0000868 3300046491 Bacteria 19506
223 Ga0495584_0004341 3300046491 Bacteria 7634
224 Ga0495585_0000334 3300046492 Bacteria 45951
225 Ga0495585_0006352 3300046492 Bacteria 7341
226 Ga0495585_0007832 3300046492 Bacteria 6500
227 Ga0495585_0008488 3300046492 Bacteria 6223
228 Ga0495585_0013069 3300046492 Bacteria 4869
229 Ga0495594_0001254 3300046499 Bacteria 13302
230 Ga0495594_0022543 3300046499 Bacteria 3368
231 Ga0495596_0000439 3300046500 Bacteria 26637
232 Ga0495596_0000610 3300046500 Bacteria 22455
233 Ga0495596_0000742 3300046500 Bacteria 20110
234 Ga0495596_0001535 3300046500 Bacteria 13177
235 Ga0495596_0003404 3300046500 Bacteria 8065
236 Ga0495596_0006723 3300046500 Bacteria 5260
237 Ga0495596_0023586 3300046500 Bacteria 2495
238 Ga0495596_0029672 3300046500 Bacteria 2192
239 Ga0495596_0032791 3300046500 Bacteria 2069
240 Ga0495607_0009806 3300046501 Bacteria 6465
241 Ga0495607_0043120 3300046501 Bacteria 2670
242 Ga0495607_0061707 3300046501 Bacteria 2129
243 Ga0495583_0000065 3300046506 Bacteria 192022
244 Ga0495583_0001650 3300046506 Bacteria 21668
245 Ga0495583_0002709 3300046506 Bacteria 14677
246 Ga0495583_0003732 3300046506 Bacteria 11328
247 Ga0495583_0004411 3300046506 Bacteria 10091
248 Ga0495583_0005077 3300046506 Bacteria 9088
249 Ga0495606_0000855 3300046507 Bacteria 45752
250 Ga0495606_0003889 3300046507 Bacteria 15397
251 Ga0495606_0006923 3300046507 Bacteria 10312
252 Ga0495606_0018502 3300046507 Bacteria 5220
253 Ga0495606_0022355 3300046507 Bacteria 4609
254 Ga0495606_0075723 3300046507 Bacteria 2105
255 Ga0495608_0006641 3300046511 Bacteria 8213
256 Ga0495610_0003111 3300046512 Bacteria 13225
257 Ga0495616_0001189 3300046513 Bacteria 18344
258 Ga0495616_0003371 3300046513 Bacteria 10247
259 Ga0495616_0004652 3300046513 Bacteria 8615
260 Ga0495616_0020806 3300046513 Bacteria 3564
261 Ga0495618_0002002 3300046514 Bacteria 13366
262 Ga0495628_0002704 3300046516 Bacteria 15870
263 Ga0495628_0022013 3300046516 Bacteria 5238
264 Ga0495628_0077127 3300046516 Bacteria 2592
265 Ga0495630_0034535 3300046517 Bacteria 3776
266 Ga0495630_0090850 3300046517 Bacteria 2307
267 Ga0495631_0000649 3300046518 Bacteria 22533
268 Ga0495631_0005196 3300046518 Bacteria 6854
269 Ga0495631_0007487 3300046518 Bacteria 5548
270 Ga0495632_0000699 3300046519 Bacteria 30508
271 Ga0495632_0004368 3300046519 Bacteria 9621
272 Ga0495632_0004690 3300046519 Bacteria 9235
273 Ga0495632_0011557 3300046519 Bacteria 5146
274 Ga0495637_0000011 3300046520 Bacteria 337279
275 Ga0495643_0000714 3300046522 Bacteria 38054
276 Ga0495643_0024344 3300046522 Bacteria 3435
277 Ga0495644_0020910 3300046523 Bacteria 2496
278 Ga0495648_0005541 3300046524 Bacteria 10471
279 Ga0495648_0084697 3300046524 Bacteria 1793
280 Ga0495663_0003152 3300046525 Bacteria 4809
281 Ga0495666_0000207 3300046526 Bacteria 25106
282 Ga0495666_0009982 3300046526 Bacteria 4742
283 Ga0495666_0022998 3300046526 Bacteria 3084
284 Ga0495642_0009912 3300046528 Bacteria 3649
285 Ga0495652_0009887 3300046529 Bacteria 8646
286 Ga0495652_0049085 3300046529 Bacteria 3614
287 Ga0495652_0098737 3300046529 Bacteria 2373
288 Ga0495652_0134284 3300046529 Bacteria 1954
289 Ga0495665_0003478 3300046531 Bacteria 8548
290 Ga0495665_0004679 3300046531 Bacteria 7381
291 Ga0495665_0014722 3300046531 Bacteria 4215
292 Ga0495640_0009094 3300046533 Bacteria 7752
293 Ga0495640_0028942 3300046533 Bacteria 3983
294 Ga0495640_0029904 3300046533 Bacteria 3904
295 Ga0495586_0000456 3300046535 Bacteria 24555
296 Ga0495586_0060632 3300046535 Bacteria 2057
297 Ga0495587_0034239 3300046536 Bacteria 3063
298 Ga0495609_0001202 3300046538 Bacteria 17832
299 Ga0495609_0001439 3300046538 Bacteria 15849
300 Ga0495609_0003312 3300046538 Bacteria 9290
301 Ga0495609_0012951 3300046538 Bacteria 3945
302 Ga0495597_0001000 3300046542 Bacteria 21670
303 Ga0495597_0001446 3300046542 Bacteria 17022
304 Ga0495597_0001916 3300046542 Bacteria 14101
305 Ga0495597_0002070 3300046542 Bacteria 13376
306 Ga0495645_0001425 3300046543 Bacteria 16105
307 Ga0495645_0006781 3300046543 Bacteria 7956
308 Ga0495622_0020169 3300046557 Bacteria 3104
309 Ga0495633_0005308 3300046558 Bacteria 7917
310 Ga0495633_0014788 3300046558 Bacteria 4065
311 Ga0495656_0000556 3300046615 Bacteria 12186
312 Ga0495668_0001437 3300046616 Bacteria 23034
313 Ga0495668_0003072 3300046616 Bacteria 12917
314 Ga0495634_0003108 3300046642 Bacteria 13493
315 Ga0495634_0005007 3300046642 Bacteria 10236
316 Ga0495611_0000652 3300046648 Bacteria 19814
317 Ga0495611_0006374 3300046648 Bacteria 5029
318 Ga0495611_0014291 3300046648 Bacteria 3389
319 Ga0495625_0000644 3300046660 Bacteria 50280
320 Ga0495625_0034367 3300046660 Bacteria 3742
321 Ga0495635_0039699 3300046663 Bacteria 3255
322 Ga0495635_0092541 3300046663 Bacteria 2067
323 Ga0495661_0002551 3300046665 Bacteria 13963
324 Ga0495661_0002681 3300046665 Bacteria 13612
325 Ga0495588_0012992 3300046674 Bacteria 3955
326 Ga0495657_0019266 3300046675 Bacteria 4925
327 Ga0495599_0004462 3300046678 Bacteria 8288
328 Ga0495646_0001665 3300046680 Bacteria 13278
329 Ga0495646_0009831 3300046680 Bacteria 6078
330 Ga0495646_0021056 3300046680 Bacteria 4121
331 Ga0495646_0074734 3300046680 Bacteria 1988
332 Ga0495613_0033227 3300046689 Bacteria 3833
333 Ga0495624_0007497 3300046690 Bacteria 7654
334 Ga0495624_0007980 3300046690 Bacteria 7422
335 Ga0495624_0009606 3300046690 Bacteria 6697
336 Ga0495670_0001757 3300046691 Bacteria 10641
337 Ga0495670_0003910 3300046691 Bacteria 7320
338 Ga0495670_0026182 3300046691 Bacteria 2887
339 Ga0495671_0000946 3300046692 Bacteria 20444
340 Ga0495671_0003779 3300046692 Bacteria 9201
341 Ga0495649_0000308 3300046694 Bacteria 42949
342 Ga0495649_0033363 3300046694 Bacteria 2833
343 Ga0495589_0000899 3300046794 Bacteria 18426
344 Ga0495589_0000906 3300046794 Bacteria 18302
345 Ga0495589_0004912 3300046794 Bacteria 7087
346 Ga0495589_0030550 3300046794 Bacteria 2713
347 Ga0495589_0032389 3300046794 Bacteria 2628
348 Ga0495589_0035536 3300046794 Bacteria 2498
349 Ga0495660_0000849 3300046810 Bacteria 22546
350 Ga0495660_0006123 3300046810 Bacteria 7142
351 Ga0495660_0006622 3300046810 Bacteria 6847
352 Ga0495660_0013414 3300046810 Bacteria 4749
353 Ga0495660_0018298 3300046810 Bacteria 4027
354 Ga0495660_0029480 3300046810 Bacteria 3095
355 Ga0495581_0000183 3300047315 Bacteria 28887
356 Ga0495581_0055962 3300047315 Bacteria 2276
357 Ga0495604_0009034 3300047317 Bacteria 7883
358 Ga0495604_0028769 3300047317 Bacteria 4422
359 Ga0495604_0034144 3300047317 Bacteria 4025
360 Ga0495604_0036055 3300047317 Bacteria 3901
361 Ga0495636_0003485 3300047318 Bacteria 6107
362 Ga0495674_0020198 3300047319 Bacteria 6170
363 Ga0495674_0033475 3300047319 Bacteria 4654
364 Ga0495674_0043861 3300047319 Bacteria 3977
365 Ga0495674_0049724 3300047319 Bacteria 3702
366 Ga0495674_0066703 3300047319 Bacteria 3120
367 Ga0495674_0100345 3300047319 Bacteria 2463
368 Ga0495672_0000005 3300047320 Bacteria 593294
369 Ga0495672_0000618 3300047320 Bacteria 39664
370 Ga0495672_0002522 3300047320 Bacteria 16718
371 Ga0495672_0004927 3300047320 Bacteria 10721
372 Ga0495672_0008563 3300047320 Bacteria 7529
373 Ga0495672_0027546 3300047320 Bacteria 3609
374 Ga0495672_0043777 3300047320 Bacteria 2689
375 Ga0495676_0021407 3300047321 Bacteria 5648
376 Ga0495676_0028119 3300047321 Bacteria 4810
377 Ga0495676_0097771 3300047321 Bacteria 2179
378 Ga0495680_0027716 3300047322 Bacteria 4649
379 Ga0495680_0068028 3300047322 Bacteria 2722
380 Ga0495683_0000596 3300047323 Bacteria 27122
381 Ga0495683_0000970 3300047323 Bacteria 20052
382 Ga0495683_0008348 3300047323 Bacteria 5550
383 Ga0495683_0011799 3300047323 Bacteria 4595
384 Ga0495683_0017831 3300047323 Bacteria 3675
385 Ga0495683_0017832 3300047323 Bacteria 3675
386 Ga0495683_0020641 3300047323 Bacteria 3396
387 Ga0495683_0027405 3300047323 Bacteria 2913
388 Ga0495683_0055061 3300047323 Bacteria 1981
389 Ga0495687_001281 3300047443 Bacteria 23676
390 Ga0495687_001585 3300047443 Bacteria 20574
391 Ga0495687_001796 3300047443 Bacteria 18932
392 Ga0495687_002650 3300047443 Bacteria 13960
393 Ga0495687_013585 3300047443 Bacteria 4239
394 Ga0495687_014737 3300047443 Bacteria 4007
395 Ga0495675_0022458 3300047444 Bacteria 4021
396 Ga0495675_0024974 3300047444 Bacteria 3811
397 Ga0495675_0053111 3300047444 Bacteria 2572
398 Ga0495677_0000710 3300047445 Bacteria 13472
399 Ga0495677_0001421 3300047445 Bacteria 9602
400 Ga0495677_0016714 3300047445 Bacteria 2661
401 Ga0495679_000139 3300047446 Bacteria 65340
402 Ga0495679_000825 3300047446 Bacteria 19712
403 Ga0495679_003645 3300047446 Bacteria 7362
404 Ga0495679_005995 3300047446 Bacteria 5311
405 Ga0495685_013112 3300047447 Bacteria 2811
406 Ga0495673_0024849 3300047469 Bacteria 2885
407 Ga0495681_0004322 3300047470 Bacteria 9721
408 Ga0495681_0030213 3300047470 Bacteria 2762
409 Ga0495686_0000540 3300047472 Bacteria 54110
410 Ga0495686_0000553 3300047472 Bacteria 53519
411 Ga0495686_0042289 3300047472 Bacteria 2898
412 Ga0495686_0120355 3300047472 Bacteria 1565
413 Ga0495593_0006983 3300047673 Bacteria 6615
414 Ga0495593_0007707 3300047673 Bacteria 6282
415 Ga0495602_0001984 3300048088 Bacteria 20519
416 Ga0495602_0054345 3300048088 Bacteria 3536
417 Ga0495602_0070438 3300048088 Bacteria 2992
418 Ga0495614_0001030 3300048089 Bacteria 11899
419 Ga0495614_0001918 3300048089 Bacteria 9119
420 Ga0495626_0000050 3300048091 Bacteria 160905
421 Ga0495626_0002523 3300048091 Bacteria 12599
422 Ga0495626_0029128 3300048091 Bacteria 2674
423 Ga0496103_0064382 3300048906 Bacteria 2285
424 Ga0496109_0039857 3300048912 Bacteria 4253
425 Ga0496110_0041187 3300048913 Bacteria 4030
426 Ga0496110_0142151 3300048913 Bacteria 2169
427 Ga0496114_0000035 3300048917 Bacteria 160029
428 Ga0496114_0125226 3300048917 Bacteria 2214
429 Ga0496115_0000854 3300048918 Bacteria 22109
430 Ga0496115_0050674 3300048918 Bacteria 3327
431 Ga0496117_0015090 3300048920 Bacteria 6616
432 Ga0496117_0078640 3300048920 Bacteria 2176
433 Ga0496118_0009318 3300048921 Bacteria 9950
434 Ga0496118_0016418 3300048921 Bacteria 6793
435 Ga0496118_0042249 3300048921 Bacteria 3598
436 Ga0496121_0000154 3300048924 Bacteria 150013
437 Ga0496121_0000749 3300048924 Bacteria 59710
438 Ga0496121_0007384 3300048924 Bacteria 13283
439 Ga0496121_0015916 3300048924 Bacteria 7812
440 Ga0496122_0000629 3300048925 Bacteria 71906
441 Ga0496123_0004217 3300048926 Bacteria 15335
442 Ga0496123_0004526 3300048926 Bacteria 14525
443 Ga0496126_0007188 3300048929 Bacteria 12256
444 Ga0496126_0018808 3300048929 Bacteria 6830
445 Ga0495678_000252 3300049459 Bacteria 60083
446 Ga0495678_001331 3300049459 Bacteria 19809
447 Ga0495678_001431 3300049459 Bacteria 18780
448 Ga0495678_002672 3300049459 Bacteria 11802
449 Ga0495682_0001386 3300049460 Bacteria 13228
450 Ga0495682_0002870 3300049460 Bacteria 7928
451 Ga0501033_0012747 3300049570 Bacteria 6411
452 Ga0501034_0001190 3300049571 Bacteria 35808
453 Ga0501043_0000018 3300049579 Bacteria 161101
454 Ga0501046_0000042 3300049580 Bacteria 151850
455 Ga0501047_0000052 3300049581 Bacteria 153448
456 Ga0501047_0002418 3300049581 Bacteria 17848
457 Ga0501048_0000099 3300049582 Bacteria 47309
458 Ga0501198_000033 3300049649 Bacteria 56683
459 Ga0501209_000430 3300049656 Bacteria 5096
460 Ga0501222_000016 3300049662 Bacteria 80046
461 Ga0501083_0048124 3300049744 Bacteria 2879
462 Ga0501280_000307 3300049776 Bacteria 12329
463 Ga0501035_0022949 3300049822 Bacteria 5728
464 Ga0501044_0006666 3300049823 Bacteria 12729
465 Ga0501045_0012615 3300049824 Bacteria 5950
466 nmdc:mga00v17_7319_c1 3300050491 Bacteria 5884
467 nmdc:mga0k408_2240_c1 3300050493 Bacteria 10340
468 nmdc:mga0k408_2279_c1 3300050493 Bacteria 10252
469 nmdc:mga09592_1681_c1 3300050508 Bacteria 17836
470 nmdc:mga0qj67_14473_c1 3300050509 Bacteria 5964
471 Ga0500643_000017 3300053087 Bacteria 305781
472 Ga0500619_000182 3300053154 Bacteria 15103
473 Ga0500587_001205 3300053739 Bacteria 3586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046523 Ga0495644_0020910 Ga0495644_0020910_14_1420 453
2 3300047472 Ga0495686_0120355 Ga0495686_0120355_133_1539 453
3 3300046680 Ga0495646_0074734 Ga0495646_0074734_512_1975 472
4 3300048920 Ga0496117_0078640 Ga0496117_0078640_648_2156 492
5 3300006237 Ga0097621_100002147 Ga0097621_1000021477 501
6 3300006358 Ga0068871_100000379 Ga0068871_10000037923 501
7 3300046524 Ga0495648_0084697 Ga0495648_0084697_217_1782 506
8 3300046471 Ga0495650_0006720 Ga0495650_0006720_4909_6561 507
9 3300047443 Ga0495687_001796 Ga0495687_001796_10989_12557 507
10 3300005339 Ga0070660_100127706 Ga0070660_1001277062 513
11 3300005456 Ga0070678_100040982 Ga0070678_1000409823 513
12 3300005548 Ga0070665_100016183 Ga0070665_1000161835 513
13 3300005548 Ga0070665_100053574 Ga0070665_1000535742 513
14 3300025903 Ga0207680_10033847 Ga0207680_100338473 513
15 3300025919 Ga0207657_10001927 Ga0207657_100019276 513
16 3300025933 Ga0207706_10030166 Ga0207706_100301663 513
17 3300026121 Ga0207683_10062003 Ga0207683_100620032 513
18 3300028379 Ga0268266_10084849 Ga0268266_100848492 513
19 3300046557 Ga0495622_0020169 Ga0495622_0020169_131_1711 513
20 3300048924 Ga0496121_0000154 Ga0496121_0000154_130897_132480 513
21 3300053087 Ga0500643_000017 Ga0500643_000017_285817_287397 513
22 3300006880 Ga0075429_100007034 Ga0075429_1000070345 517
23 3300049570 Ga0501033_0012747 Ga0501033_0012747_4195_5787 517
24 3300049581 Ga0501047_0002418 Ga0501047_0002418_11756_13348 517
25 3300049822 Ga0501035_0022949 Ga0501035_0022949_2201_3793 517
26 3300049823 Ga0501044_0006666 Ga0501044_0006666_3113_4705 517
27 3300050491 nmdc:mga00v17_7319_c1 nmdc:mga00v17_7319_c1_1454_3076 517
28 3300050508 nmdc:mga09592_1681_c1 nmdc:mga09592_1681_c1_9687_11366 517
29 3300050509 nmdc:mga0qj67_14473_c1 nmdc:mga0qj67_14473_c1_4263_5942 517
30 iso_pu_bacteria 8002745576 8002749786 517
31 3300046810 Ga0495660_0006622 Ga0495660_0006622_1721_3361 519
32 3300047320 Ga0495672_0000005 Ga0495672_0000005_357722_359425 519
33 iso_pu_bacteria 2585428062 2587758155 519
34 3300028794 Ga0307515_10079791 Ga0307515_100797912 520
35 3300048917 Ga0496114_0000035 Ga0496114_0000035_23748_25370 520
36 iso_pu_bacteria 639633007 639787061 520
37 3300005327 Ga0070658_10019262 Ga0070658_100192624 521
38 3300005335 Ga0070666_10000003 Ga0070666_1000000354 521
39 3300005353 Ga0070669_100000104 Ga0070669_10000010426 521
40 3300005842 Ga0068858_100131722 Ga0068858_1001317222 521
41 3300009551 Ga0105238_10001660 Ga0105238_100016608 521
42 3300013306 Ga0163162_10000381 Ga0163162_100003813 521
43 3300025903 Ga0207680_10000006 Ga0207680_10000006199 521
44 3300025923 Ga0207681_10000051 Ga0207681_1000005136 521
45 3300028379 Ga0268266_10000043 Ga0268266_10000043140 521
46 3300031238 Ga0265332_10002095 Ga0265332_100020955 521
47 3300033180 Ga0307510_10000232 Ga0307510_1000023228 521
48 3300046471 Ga0495650_0000353 Ga0495650_0000353_30887_32491 521
49 3300049656 Ga0501209_000430 Ga0501209_000430_1994_3619 521
50 3300050493 nmdc:mga0k408_2279_c1 nmdc:mga0k408_2279_c1_4538_6175 521
51 iso_pu_bacteria 2643221644 2644246639 521
52 iso_pu_bacteria 2643221660 2644340101 521
53 iso_pu_bacteria 643348555 643390136 521
54 3300005437 Ga0070710_10005929 Ga0070710_100059292 522
55 3300013102 Ga0157371_10000010 Ga0157371_1000001091 522
56 3300035692 Ga0373935_0067130 Ga0373935_0067130_165_1802 522
57 3300046522 Ga0495643_0024344 Ga0495643_0024344_532_2148 522
58 3300046694 Ga0495649_0000308 Ga0495649_0000308_10656_12272 522
59 3300049776 Ga0501280_000307 Ga0501280_000307_6552_8165 522
60 3300003759 Ga0055525_1000006 Ga0055525_1000006354 523
61 3300005327 Ga0070658_10040061 Ga0070658_100400613 523
62 3300005335 Ga0070666_10006429 Ga0070666_100064298 523
63 3300005339 Ga0070660_100009504 Ga0070660_1000095043 523
64 3300005366 Ga0070659_100036047 Ga0070659_1000360472 523
65 3300006051 Ga0075364_10026280 Ga0075364_100262806 523
66 3300010375 Ga0105239_10038426 Ga0105239_100384262 523
67 3300011119 Ga0105246_10093314 Ga0105246_100933141 523
68 3300025230 Ga0209563_100022 Ga0209563_100022352 523
69 3300025253 Ga0209677_103097 Ga0209677_1030972 523
70 3300025949 Ga0207667_10023453 Ga0207667_100234533 523
71 3300028794 Ga0307515_10000123 Ga0307515_1000012367 523
72 3300028794 Ga0307515_10000870 Ga0307515_1000087035 523
73 3300028794 Ga0307515_10001649 Ga0307515_1000164916 523
74 3300030522 Ga0307512_10020892 Ga0307512_100208925 523
75 3300031456 Ga0307513_10011480 Ga0307513_100114806 523
76 3300031507 Ga0307509_10052710 Ga0307509_100527102 523
77 3300031616 Ga0307508_10001439 Ga0307508_100014397 523
78 3300031649 Ga0307514_10017332 Ga0307514_100173323 523
79 3300031730 Ga0307516_10009733 Ga0307516_100097334 523
80 3300037312 Ga0395899_0006930 Ga0395899_0006930_4822_6444 523
81 3300037418 Ga0395900_0005646 Ga0395900_0005646_4869_6491 523
82 3300038443 Ga0395901_0021862 Ga0395901_0021862_4869_6491 523
83 3300042005 Ga0439448_0000360 Ga0439448_0000360_227_1957 523
84 3300044842 Ga0466957_0003707 Ga0466957_0003707_2159_3781 523
85 3300044842 Ga0466957_0026185 Ga0466957_0026185_1638_3254 523
86 3300045976 Ga0466967_0013006 Ga0466967_0013006_1660_3282 523
87 3300046452 Ga0495617_000276 Ga0495617_000276_374_1987 523
88 3300046453 Ga0495627_001064 Ga0495627_001064_9306_10967 523
89 3300046453 Ga0495627_002431 Ga0495627_002431_6257_7876 523
90 3300046457 Ga0495590_0000063 Ga0495590_0000063_45115_46731 523
91 3300046457 Ga0495590_0005458 Ga0495590_0005458_1847_3463 523
92 3300046458 Ga0495591_001082 Ga0495591_001082_6172_7788 523
93 3300046460 Ga0495638_0009866 Ga0495638_0009866_5033_6652 523
94 3300046473 Ga0495582_0008687 Ga0495582_0008687_3955_5571 523
95 3300046473 Ga0495582_0012578 Ga0495582_0012578_620_2236 523
96 3300046474 Ga0495605_0000265 Ga0495605_0000265_50295_51917 523
97 3300046474 Ga0495605_0005136 Ga0495605_0005136_5274_6893 523
98 3300046474 Ga0495605_0024028 Ga0495605_0024028_1317_2933 523
99 3300046474 Ga0495605_0036021 Ga0495605_0036021_755_2371 523
100 3300046491 Ga0495584_0000015 Ga0495584_0000015_38828_40441 523
101 3300046491 Ga0495584_0000757 Ga0495584_0000757_5991_7604 523
102 3300046491 Ga0495584_0000843 Ga0495584_0000843_9606_11225 523
103 3300046491 Ga0495584_0000868 Ga0495584_0000868_10325_11941 523
104 3300046491 Ga0495584_0004341 Ga0495584_0004341_4179_5798 523
105 3300046492 Ga0495585_0000334 Ga0495585_0000334_37294_38907 523
106 3300046492 Ga0495585_0006352 Ga0495585_0006352_863_2476 523
107 3300046492 Ga0495585_0007832 Ga0495585_0007832_2941_4560 523
108 3300046492 Ga0495585_0008488 Ga0495585_0008488_4408_6024 523
109 3300046492 Ga0495585_0013069 Ga0495585_0013069_181_1800 523
110 3300046499 Ga0495594_0001254 Ga0495594_0001254_3566_5185 523
111 3300046499 Ga0495594_0022543 Ga0495594_0022543_295_1914 523
112 3300046500 Ga0495596_0000610 Ga0495596_0000610_10618_12240 523
113 3300046500 Ga0495596_0000742 Ga0495596_0000742_8099_9715 523
114 3300046500 Ga0495596_0003404 Ga0495596_0003404_5984_7603 523
115 3300046500 Ga0495596_0006723 Ga0495596_0006723_3210_4823 523
116 3300046500 Ga0495596_0023586 Ga0495596_0023586_393_2009 523
117 3300046501 Ga0495607_0009806 Ga0495607_0009806_36_1652 523
118 3300046501 Ga0495607_0043120 Ga0495607_0043120_769_2388 523
119 3300046501 Ga0495607_0061707 Ga0495607_0061707_86_1708 523
120 3300046506 Ga0495583_0000065 Ga0495583_0000065_184573_186186 523
121 3300046506 Ga0495583_0004411 Ga0495583_0004411_3359_4975 523
122 3300046506 Ga0495583_0005077 Ga0495583_0005077_6146_7762 523
123 3300046507 Ga0495606_0003889 Ga0495606_0003889_5717_7330 523
124 3300046507 Ga0495606_0006923 Ga0495606_0006923_6415_8034 523
125 3300046507 Ga0495606_0022355 Ga0495606_0022355_2002_3621 523
126 3300046512 Ga0495610_0003111 Ga0495610_0003111_10743_12404 523
127 3300046513 Ga0495616_0003371 Ga0495616_0003371_2728_4344 523
128 3300046513 Ga0495616_0004652 Ga0495616_0004652_3352_4971 523
129 3300046513 Ga0495616_0020806 Ga0495616_0020806_1473_3089 523
130 3300046517 Ga0495630_0090850 Ga0495630_0090850_258_1874 523
131 3300046518 Ga0495631_0000649 Ga0495631_0000649_10895_12511 523
132 3300046518 Ga0495631_0007487 Ga0495631_0007487_3687_5303 523
133 3300046519 Ga0495632_0000699 Ga0495632_0000699_17929_19590 523
134 3300046519 Ga0495632_0004368 Ga0495632_0004368_7346_8965 523
135 3300046519 Ga0495632_0011557 Ga0495632_0011557_1868_3484 523
136 3300046520 Ga0495637_0000011 Ga0495637_0000011_266345_267961 523
137 3300046524 Ga0495648_0005541 Ga0495648_0005541_1662_3275 523
138 3300046525 Ga0495663_0003152 Ga0495663_0003152_879_2498 523
139 3300046526 Ga0495666_0022998 Ga0495666_0022998_683_2299 523
140 3300046528 Ga0495642_0009912 Ga0495642_0009912_1676_3337 523
141 3300046531 Ga0495665_0014722 Ga0495665_0014722_451_2070 523
142 3300046535 Ga0495586_0060632 Ga0495586_0060632_104_1720 523
143 3300046536 Ga0495587_0034239 Ga0495587_0034239_777_2393 523
144 3300046538 Ga0495609_0001439 Ga0495609_0001439_2107_3723 523
145 3300046538 Ga0495609_0012951 Ga0495609_0012951_187_1803 523
146 3300046542 Ga0495597_0001000 Ga0495597_0001000_7144_8760 523
147 3300046542 Ga0495597_0001446 Ga0495597_0001446_8148_9764 523
148 3300046542 Ga0495597_0001916 Ga0495597_0001916_8917_10536 523
149 3300046542 Ga0495597_0002070 Ga0495597_0002070_1015_2634 523
150 3300046558 Ga0495633_0005308 Ga0495633_0005308_1927_3546 523
151 3300046558 Ga0495633_0014788 Ga0495633_0014788_2253_3866 523
152 3300046615 Ga0495656_0000556 Ga0495656_0000556_3737_5356 523
153 3300046616 Ga0495668_0001437 Ga0495668_0001437_8597_10213 523
154 3300046616 Ga0495668_0003072 Ga0495668_0003072_10091_11707 523
155 3300046642 Ga0495634_0005007 Ga0495634_0005007_7919_9535 523
156 3300046648 Ga0495611_0000652 Ga0495611_0000652_7489_9105 523
157 3300046648 Ga0495611_0006374 Ga0495611_0006374_2814_4433 523
158 3300046660 Ga0495625_0000644 Ga0495625_0000644_33080_34741 523
159 3300046665 Ga0495661_0002551 Ga0495661_0002551_4006_5622 523
160 3300046665 Ga0495661_0002681 Ga0495661_0002681_5445_7061 523
161 3300046674 Ga0495588_0012992 Ga0495588_0012992_2111_3727 523
162 3300046691 Ga0495670_0001757 Ga0495670_0001757_7880_9499 523
163 3300046691 Ga0495670_0003910 Ga0495670_0003910_823_2439 523
164 3300046691 Ga0495670_0026182 Ga0495670_0026182_1120_2739 523
165 3300046692 Ga0495671_0003779 Ga0495671_0003779_1881_3542 523
166 3300046694 Ga0495649_0033363 Ga0495649_0033363_1177_2793 523
167 3300046794 Ga0495589_0000899 Ga0495589_0000899_10559_12175 523
168 3300046794 Ga0495589_0000906 Ga0495589_0000906_8229_9851 523
169 3300046794 Ga0495589_0004912 Ga0495589_0004912_1762_3381 523
170 3300046794 Ga0495589_0035536 Ga0495589_0035536_200_1816 523
171 3300046810 Ga0495660_0000849 Ga0495660_0000849_15546_17168 523
172 3300046810 Ga0495660_0013414 Ga0495660_0013414_2959_4575 523
173 3300046810 Ga0495660_0018298 Ga0495660_0018298_743_2359 523
174 3300046810 Ga0495660_0029480 Ga0495660_0029480_403_2019 523
175 3300047315 Ga0495581_0055962 Ga0495581_0055962_525_2144 523
176 3300047317 Ga0495604_0028769 Ga0495604_0028769_2013_3632 523
177 3300047318 Ga0495636_0003485 Ga0495636_0003485_946_2565 523
178 3300047320 Ga0495672_0004927 Ga0495672_0004927_8308_9930 523
179 3300047320 Ga0495672_0008563 Ga0495672_0008563_4421_6040 523
180 3300047321 Ga0495676_0021407 Ga0495676_0021407_3035_4654 523
181 3300047321 Ga0495676_0028119 Ga0495676_0028119_2329_3945 523
182 3300047322 Ga0495680_0068028 Ga0495680_0068028_1059_2708 523
183 3300047323 Ga0495683_0000596 Ga0495683_0000596_12671_14284 523
184 3300047323 Ga0495683_0000970 Ga0495683_0000970_3042_4658 523
185 3300047323 Ga0495683_0027405 Ga0495683_0027405_524_2137 523
186 3300047443 Ga0495687_001281 Ga0495687_001281_11117_12733 523
187 3300047443 Ga0495687_001585 Ga0495687_001585_7226_8842 523
188 3300047443 Ga0495687_002650 Ga0495687_002650_5279_6901 523
189 3300047445 Ga0495677_0000710 Ga0495677_0000710_8618_10237 523
190 3300047445 Ga0495677_0016714 Ga0495677_0016714_799_2418 523
191 3300047447 Ga0495685_013112 Ga0495685_013112_908_2524 523
192 3300047470 Ga0495681_0004322 Ga0495681_0004322_7588_9207 523
193 3300047470 Ga0495681_0030213 Ga0495681_0030213_706_2319 523
194 3300047472 Ga0495686_0000553 Ga0495686_0000553_18401_20017 523
195 3300047673 Ga0495593_0007707 Ga0495593_0007707_3478_5094 523
196 3300048089 Ga0495614_0001030 Ga0495614_0001030_8513_10129 523
197 3300048091 Ga0495626_0000050 Ga0495626_0000050_23855_25477 523
198 3300048091 Ga0495626_0002523 Ga0495626_0002523_1538_3154 523
199 3300048912 Ga0496109_0039857 Ga0496109_0039857_943_2559 523
200 3300048913 Ga0496110_0142151 Ga0496110_0142151_207_1823 523
201 3300048918 Ga0496115_0000854 Ga0496115_0000854_12654_14273 523
202 3300048918 Ga0496115_0050674 Ga0496115_0050674_1275_2894 523
203 3300048925 Ga0496122_0000629 Ga0496122_0000629_8970_10586 523
204 3300048926 Ga0496123_0004217 Ga0496123_0004217_3530_5146 523
205 3300049459 Ga0495678_000252 Ga0495678_000252_51341_52957 523
206 3300049459 Ga0495678_001331 Ga0495678_001331_10703_12319 523
207 3300049459 Ga0495678_001431 Ga0495678_001431_10439_12100 523
208 3300049459 Ga0495678_002672 Ga0495678_002672_7048_8664 523
209 3300049460 Ga0495682_0001386 Ga0495682_0001386_11562_13178 523
210 3300049460 Ga0495682_0002870 Ga0495682_0002870_2890_4506 523
211 3300053739 Ga0500587_001205 Ga0500587_001205_399_2060 523
212 3300006195 Ga0075366_10000651 Ga0075366_100006519 524
213 3300009545 Ga0105237_10001467 Ga0105237_1000146718 524
214 3300010375 Ga0105239_10000568 Ga0105239_100005684 524
215 3300025913 Ga0207695_10068828 Ga0207695_100688282 524
216 3300025914 Ga0207671_10000206 Ga0207671_1000020670 524
217 3300028800 Ga0265338_10074122 Ga0265338_100741222 524
218 3300031241 Ga0265325_10000129 Ga0265325_100001299 524
219 3300031548 Ga0307408_100039047 Ga0307408_1000390473 524
220 3300031595 Ga0265313_10007959 Ga0265313_100079593 524
221 3300041452 Ga0451793_1490485 Ga0451793_1490485_71_1693 524
222 3300041462 Ga0451806_615820 Ga0451806_615820_860_2482 524
223 3300046507 Ga0495606_0000855 Ga0495606_0000855_34682_36319 524
224 3300046538 Ga0495609_0003312 Ga0495609_0003312_1246_2868 524
225 3300046660 Ga0495625_0034367 Ga0495625_0034367_192_1841 524
226 3300047320 Ga0495672_0027546 Ga0495672_0027546_904_2526 524
227 3300047323 Ga0495683_0055061 Ga0495683_0055061_135_1757 524
228 3300047469 Ga0495673_0024849 Ga0495673_0024849_351_1973 524
229 3300047472 Ga0495686_0042289 Ga0495686_0042289_670_2370 524
230 3300048906 Ga0496103_0064382 Ga0496103_0064382_429_2060 524
231 3300048924 Ga0496121_0000749 Ga0496121_0000749_25124_26743 524
232 3300048924 Ga0496121_0015916 Ga0496121_0015916_4288_5907 524
233 3300048929 Ga0496126_0007188 Ga0496126_0007188_111_1730 524
234 3300050493 nmdc:mga0k408_2240_c1 nmdc:mga0k408_2240_c1_1628_3274 524
235 iso_pu_bacteria 2904434214 2904438968 524
236 3300027312 Ga0209371_1012338 Ga0209371_10123382 525
237 3300027876 Ga0209974_10003043 Ga0209974_100030432 525
238 3300030500 Ga0268256_1013441 Ga0268256_10134412 525
239 3300042121 Ga0450919_001759 Ga0450919_001759_1090_2751 525
240 3300042531 Ga0450918_001066 Ga0450918_001066_22_1683 525
241 3300042876 Ga0451577_0000936 Ga0451577_0000936_3483_5102 525
242 3300044712 Ga0453684_0002634 Ga0453684_0002634_37787_39406 525
243 3300048913 Ga0496110_0041187 Ga0496110_0041187_1074_2732 525
244 3300048920 Ga0496117_0015090 Ga0496117_0015090_740_2413 525
245 3300048921 Ga0496118_0009318 Ga0496118_0009318_1750_3423 525
246 3300053154 Ga0500619_000182 Ga0500619_000182_12363_14024 525
247 iso_pu_bacteria 2855730933 2855734286 525
248 iso_pu_bacteria 2855767633 2855769876 525
249 iso_pu_bacteria 2881412998 2881414133 525
250 iso_pu_bacteria 641228493 641336313 525
251 3300005343 Ga0070687_100005878 Ga0070687_1000058783 526
252 3300049579 Ga0501043_0000018 Ga0501043_0000018_88633_90282 526
253 3300049580 Ga0501046_0000042 Ga0501046_0000042_88633_90282 526
254 3300049581 Ga0501047_0000052 Ga0501047_0000052_63167_64816 526
255 3300049582 Ga0501048_0000099 Ga0501048_0000099_15847_17496 526
256 3300049649 Ga0501198_000033 Ga0501198_000033_37011_38669 526
257 3300049662 Ga0501222_000016 Ga0501222_000016_41388_43046 526
258 3300049744 Ga0501083_0048124 Ga0501083_0048124_571_2220 526
259 3300049824 Ga0501045_0012615 Ga0501045_0012615_724_2373 526
260 3300046471 Ga0495650_0000441 Ga0495650_0000441_13259_14896 527
261 3300046474 Ga0495605_0004370 Ga0495605_0004370_1203_2840 527
262 3300046506 Ga0495583_0002709 Ga0495583_0002709_7159_8805 527
263 3300046506 Ga0495583_0003732 Ga0495583_0003732_5817_7454 527
264 3300046513 Ga0495616_0001189 Ga0495616_0001189_10853_12487 527
265 3300046518 Ga0495631_0005196 Ga0495631_0005196_4899_6545 527
266 3300046519 Ga0495632_0004690 Ga0495632_0004690_6505_8151 527
267 3300046522 Ga0495643_0000714 Ga0495643_0000714_5983_7623 527
268 3300046538 Ga0495609_0001202 Ga0495609_0001202_6268_7905 527
269 3300046648 Ga0495611_0014291 Ga0495611_0014291_682_2328 527
270 3300046810 Ga0495660_0006123 Ga0495660_0006123_3180_4826 527
271 3300047320 Ga0495672_0000618 Ga0495672_0000618_6844_8481 527
272 3300047323 Ga0495683_0017832 Ga0495683_0017832_1476_3113 527
273 3300047445 Ga0495677_0001421 Ga0495677_0001421_1378_3024 527
274 3300047446 Ga0495679_003645 Ga0495679_003645_4843_6489 527
275 3300048091 Ga0495626_0029128 Ga0495626_0029128_389_2035 527
276 3300005455 Ga0070663_100000177 Ga0070663_10000017719 528
277 3300006948 Ga0099826_10000004 Ga0099826_10000004657 528
278 3300015690 Ga0183363_1005 Ga0183363_1005333 528
279 3300026067 Ga0207678_10000060 Ga0207678_1000006027 528
280 3300027666 Ga0209282_1000015 Ga0209282_1000015163 528
281 3300031235 Ga0265330_10003103 Ga0265330_1000310311 528
282 3300031711 Ga0265314_10002287 Ga0265314_1000228716 528
283 iso_pu_bacteria 2501025502 2501082561 528
284 iso_pu_bacteria 2501025504 2501408489 528
285 iso_pu_bacteria 2508501125 2509131633 528
286 iso_pu_bacteria 2510065045 2510252625 528
287 iso_pu_bacteria 2510917013 2511086104 528
288 iso_pu_bacteria 2510917014 2511096223 528
289 iso_pu_bacteria 2512047030 2512346792 528
290 iso_pu_bacteria 2513237150 2513953105 528
291 iso_pu_bacteria 2513237151 2513959741 528
292 iso_pu_bacteria 2513237165 2514042068 528
293 iso_pu_bacteria 2515154122 2515686821 528
294 iso_pu_bacteria 2515154189 2516024471 528
295 iso_pu_bacteria 2526164713 2527079741 528
296 iso_pu_bacteria 2562617112 2563063652 528
297 iso_pu_bacteria 2582581311 2585290280 528
298 iso_pu_bacteria 2599185239 2599736740 528
299 iso_pu_bacteria 2599185240 2599744813 528
300 iso_pu_bacteria 2599185355 2600205823 528
301 iso_pu_bacteria 2675903129 2676742942 528
302 iso_pu_bacteria 2711768613 2713474534 528
303 iso_pu_bacteria 2718217991 2719641726 528
304 iso_pu_bacteria 2738541296 2738824662 528
305 iso_pu_bacteria 2738541298 2738837130 528
306 iso_pu_bacteria 2738541306 2738878660 528
307 iso_pu_bacteria 2738543002 2739190311 528
308 iso_pu_bacteria 2738543008 2739225251 528
309 iso_pu_bacteria 2744054900 2746088045 528
310 iso_pu_bacteria 2744054901 2746098527 528
311 iso_pu_bacteria 2751185846 2753571857 528
312 iso_pu_bacteria 2808606384 2808972782 528
313 iso_pu_bacteria 2808606390 2809007764 528
314 iso_pu_bacteria 2808606391 2809014696 528
315 iso_pu_bacteria 2816332253 2817261423 528
316 iso_pu_bacteria 2816332256 2817279109 528
317 iso_pu_bacteria 2816332286 2817456286 528
318 iso_pu_bacteria 2818991450 2819624910 528
319 iso_pu_bacteria 2818991452 2819631224 528
320 iso_pu_bacteria 2834641062 2834641638 528
321 iso_pu_bacteria 2842324504 2842332849 528
322 iso_pu_bacteria 2842348783 2842357055 528
323 iso_pu_bacteria 2842454564 2842458802 528
324 iso_pu_bacteria 2856287931 2856292166 528
325 iso_pu_bacteria 2857357740 2857361150 528
326 iso_pu_bacteria 2863421361 2863427422 528
327 iso_pu_bacteria 2883087390 2883087941 528
328 iso_pu_bacteria 2885270888 2885272885 528
329 iso_pu_bacteria 2900634093 2900637021 528
330 iso_pu_bacteria 2902682994 2902684714 528
331 iso_pu_bacteria 2904483920 2904487951 528
332 iso_pu_bacteria 2904564687 2904570040 528
333 iso_pu_bacteria 2904571731 2904576049 528
334 iso_pu_bacteria 2919527303 2919531315 528
335 iso_pu_bacteria 2921643360 2921643609 528
336 iso_pu_bacteria 2928108538 2928114613 528
337 iso_pu_bacteria 2928135762 2928142078 528
338 iso_pu_bacteria 2928157003 2928162929 528
339 iso_pu_bacteria 2928163908 2928169591 528
340 iso_pu_bacteria 2928170801 2928171657 528
341 iso_pu_bacteria 2928503688 2928509937 528
342 iso_pu_bacteria 2928536128 2928542604 528
343 iso_pu_bacteria 2945934425 2945934613 528
344 iso_pu_bacteria 2981990288 2981996788 528
345 iso_pu_bacteria 2990703756 2990704828 528
346 iso_pu_bacteria 641736151 642427384 528
347 iso_pu_bacteria 641736154 642416314 528
348 iso_pu_bacteria 642555113 642623250 528
349 iso_pu_bacteria 644736347 644747280 528
350 iso_pu_bacteria 8003400568 8003403732 528
351 iso_pu_bacteria 8018845410 8018846994 528
352 iso_pu_bacteria 8020807995 8020813647 528
353 iso_pu_bacteria 8020938398 8020944956 528
354 iso_pu_bacteria 8020953355 8020957007 528
355 iso_pu_bacteria 8021120328 8021122134 528
356 iso_pu_bacteria 8040167225 8040172775 528
357 iso_pu_bacteria 8040173305 8040173754 528
358 iso_pu_bacteria 8055266321 8055272766 528
359 iso_pu_bacteria 8055301274 8055305772 528
360 3300002705 JGI25156J39149_1001151 JGI25156J39149_10011513 529
361 3300003187 JGI25151J46595_10000096 JGI25151J46595_1000009611 529
362 3300025226 Ga0209674_100209 Ga0209674_1002092 529
363 3300025256 Ga0209759_1003845 Ga0209759_10038452 529
364 3300025294 Ga0209025_1000003 Ga0209025_1000003645 529
365 3300046500 Ga0495596_0000439 Ga0495596_0000439_9323_10942 529
366 3300046692 Ga0495671_0000946 Ga0495671_0000946_15659_17278 529
367 3300047319 Ga0495674_0020198 Ga0495674_0020198_4319_5932 529
368 3300047320 Ga0495672_0002522 Ga0495672_0002522_264_1877 529
369 3300047472 Ga0495686_0000540 Ga0495686_0000540_279_1892 529
370 3300048926 Ga0496123_0004526 Ga0496123_0004526_9869_11488 529
371 3300003187 JGI25151J46595_10002553 JGI25151J46595_100025536 530
372 3300003771 Ga0055526_1004148 Ga0055526_10041483 530
373 3300003775 Ga0055524_1002077 Ga0055524_100207713 530
374 3300003775 Ga0055524_1018853 Ga0055524_10188532 530
375 3300003781 Ga0055536_1000020 Ga0055536_100002099 530
376 3300003784 Ga0055534_1000814 Ga0055534_100081411 530
377 3300003784 Ga0055534_1002241 Ga0055534_10022415 530
378 3300025263 Ga0209565_1000103 Ga0209565_1000103110 530
379 3300025291 Ga0209675_1000109 Ga0209675_100010962 530
380 3300025291 Ga0209675_1006048 Ga0209675_10060484 530
381 3300025292 Ga0209676_1000066 Ga0209676_1000066113 530
382 3300025294 Ga0209025_1000297 Ga0209025_100029758 530
383 3300025294 Ga0209025_1001779 Ga0209025_100177915 530
384 3300025294 Ga0209025_1007411 Ga0209025_10074114 530
385 3300025295 Ga0209564_1000970 Ga0209564_100097012 530
386 3300025295 Ga0209564_1001046 Ga0209564_100104622 530
387 3300025295 Ga0209564_1001983 Ga0209564_10019833 530
388 3300025299 Ga0209256_1000599 Ga0209256_100059915 530
389 3300025299 Ga0209256_1003976 Ga0209256_100397613 530
390 3300025303 Ga0209051_1006337 Ga0209051_10063375 530
391 iso_pu_bacteria 2501025501 2501075114 531
392 iso_pu_bacteria 2510917015 2511103054 531
393 3300001979 JGI24740J21852_10000096 JGI24740J21852_1000009625 532
394 3300001979 JGI24740J21852_10000665 JGI24740J21852_100006656 532
395 3300001989 JGI24739J22299_10002547 JGI24739J22299_100025473 532
396 3300001989 JGI24739J22299_10005128 JGI24739J22299_100051284 532
397 3300001989 JGI24739J22299_10008190 JGI24739J22299_100081902 532
398 3300001990 JGI24737J22298_10011182 JGI24737J22298_100111822 532
399 3300002067 JGI24735J21928_10000897 JGI24735J21928_100008972 532
400 3300002705 JGI25156J39149_1001141 JGI25156J39149_10011413 532
401 3300002705 JGI25156J39149_1001474 JGI25156J39149_10014744 532
402 3300002705 JGI25156J39149_1012063 JGI25156J39149_10120631 532
403 3300002738 JGI25154J39366_1001608 JGI25154J39366_10016083 532
404 3300003214 JGI25165J46597_1002875 JGI25165J46597_10028752 532
405 3300003354 JGI25160J50197_1000025 JGI25160J50197_100002553 532
406 3300003756 Ga0055533_1000339 Ga0055533_100033916 532
407 3300003756 Ga0055533_1001609 Ga0055533_10016095 532
408 3300003758 Ga0055532_1000043 Ga0055532_10000432 532
409 3300003758 Ga0055532_1001069 Ga0055532_10010696 532
410 3300003758 Ga0055532_1001171 Ga0055532_10011715 532
411 3300003760 Ga0055527_1000026 Ga0055527_1000026175 532
412 3300003761 Ga0055535_1000032 Ga0055535_1000032177 532
413 3300003761 Ga0055535_1001816 Ga0055535_10018162 532
414 3300003762 Ga0055542_1000049 Ga0055542_10000492 532
415 3300003762 Ga0055542_1000659 Ga0055542_100065920 532
416 3300003762 Ga0055542_1000766 Ga0055542_10007663 532
417 3300003762 Ga0055542_1001743 Ga0055542_10017432 532
418 3300003763 Ga0055529_1000059 Ga0055529_1000059177 532
419 3300003763 Ga0055529_1001014 Ga0055529_10010146 532
420 3300003856 Ga0058692_1003047 Ga0058692_10030474 532
421 3300005262 Ga0065165_1000173 Ga0065165_1000173105 532
422 3300009011 Ga0105251_10000438 Ga0105251_100004383 532
423 3300009093 Ga0105240_10014912 Ga0105240_100149127 532
424 3300013105 Ga0157369_10002778 Ga0157369_1000277816 532
425 3300013306 Ga0163162_10121052 Ga0163162_101210522 532
426 3300025225 Ga0209566_100781 Ga0209566_1007819 532
427 3300025225 Ga0209566_100873 Ga0209566_1008737 532
428 3300025226 Ga0209674_100017 Ga0209674_100017629 532
429 3300025226 Ga0209674_100312 Ga0209674_1003125 532
430 3300025228 Ga0209672_100001 Ga0209672_1000012506 532
431 3300025228 Ga0209672_100014 Ga0209672_100014104 532
432 3300025229 Ga0209147_100022 Ga0209147_1000222 532
433 3300025229 Ga0209147_100171 Ga0209147_10017113 532
434 3300025229 Ga0209147_100586 Ga0209147_1005867 532
435 3300025231 Ga0207427_102677 Ga0207427_1026772 532
436 3300025242 Ga0209258_100033 Ga0209258_100033410 532
437 3300025242 Ga0209258_100183 Ga0209258_100183106 532
438 3300025246 Ga0209646_1000019 Ga0209646_10000193 532
439 3300025250 Ga0209026_1002168 Ga0209026_10021685 532
440 3300025254 Ga0209148_1000035 Ga0209148_1000035401 532
441 3300025254 Ga0209148_1000046 Ga0209148_10000463 532
442 3300025254 Ga0209148_1000193 Ga0209148_100019382 532
443 3300025256 Ga0209759_1000770 Ga0209759_10007702 532
444 3300025256 Ga0209759_1002235 Ga0209759_10022352 532
445 3300025256 Ga0209759_1002543 Ga0209759_10025435 532
446 3300025261 Ga0209233_1000050 Ga0209233_10000502 532
447 3300025272 Ga0209455_1000038 Ga0209455_10000383 532
448 3300025272 Ga0209455_1000072 Ga0209455_100007251 532
449 3300025273 Ga0209673_1000140 Ga0209673_100014067 532
450 3300025284 Ga0209130_1004078 Ga0209130_10040782 532
451 3300025294 Ga0209025_1001260 Ga0209025_100126029 532
452 3300025295 Ga0209564_1007205 Ga0209564_10072053 532
453 3300025295 Ga0209564_1008024 Ga0209564_10080242 532
454 3300025302 Ga0207426_1000020 Ga0207426_1000020306 532
455 3300025303 Ga0209051_1005465 Ga0209051_10054658 532
456 3300025735 Ga0207713_1000390 Ga0207713_10003903 532
457 3300025904 Ga0207647_10003708 Ga0207647_100037083 532
458 3300025904 Ga0207647_10005594 Ga0207647_100055942 532
459 3300025904 Ga0207647_10035466 Ga0207647_100354662 532
460 3300025913 Ga0207695_10008771 Ga0207695_100087718 532
461 3300027312 Ga0209371_1000079 Ga0209371_1000079149 532
462 3300030500 Ga0268256_1000090 Ga0268256_1000090152 532
463 3300031548 Ga0307408_100015115 Ga0307408_1000151152 532
464 3300031911 Ga0307412_10000011 Ga0307412_100000112 532
465 3300032002 Ga0307416_100136925 Ga0307416_1001369251 532
466 3300037466 Ga0395898_0000254 Ga0395898_0000254_106397_108019 532
467 3300038443 Ga0395901_0000009 Ga0395901_0000009_164708_166330 532
468 3300038443 Ga0395901_0013930 Ga0395901_0013930_4457_6079 532
469 3300046455 Ga0495603_0000935 Ga0495603_0000935_373_1995 532
470 3300046455 Ga0495603_0003018 Ga0495603_0003018_7424_9049 532
471 3300046457 Ga0495590_0006649 Ga0495590_0006649_1167_2789 532
472 3300046459 Ga0495629_0000609 Ga0495629_0000609_1656_3278 532
473 3300046459 Ga0495629_0000625 Ga0495629_0000625_26716_28341 532
474 3300046459 Ga0495629_0002674 Ga0495629_0002674_10347_11969 532
475 3300046459 Ga0495629_0014960 Ga0495629_0014960_2522_4147 532
476 3300046463 Ga0495653_0007197 Ga0495653_0007197_5801_7423 532
477 3300046463 Ga0495653_0025139 Ga0495653_0025139_1624_3246 532
478 3300046463 Ga0495653_0062465 Ga0495653_0062465_519_2141 532
479 3300046472 Ga0495580_0000844 Ga0495580_0000844_1524_3146 532
480 3300046472 Ga0495580_0022666 Ga0495580_0022666_1340_2962 532
481 3300046472 Ga0495580_0033487 Ga0495580_0033487_920_2542 532
482 3300046472 Ga0495580_0052674 Ga0495580_0052674_50_1672 532
483 3300046473 Ga0495582_0004978 Ga0495582_0004978_4189_5811 532
484 3300046476 Ga0495662_0009867 Ga0495662_0009867_1670_3292 532
485 3300046477 Ga0495664_0013037 Ga0495664_0013037_1452_3074 532
486 3300046477 Ga0495664_0013922 Ga0495664_0013922_1354_2976 532
487 3300046477 Ga0495664_0026525 Ga0495664_0026525_978_2603 532
488 3300046477 Ga0495664_0074742 Ga0495664_0074742_168_1802 532
489 3300046500 Ga0495596_0001535 Ga0495596_0001535_9897_11519 532
490 3300046500 Ga0495596_0029672 Ga0495596_0029672_179_1807 532
491 3300046500 Ga0495596_0032791 Ga0495596_0032791_198_1826 532
492 3300046506 Ga0495583_0001650 Ga0495583_0001650_18938_20560 532
493 3300046507 Ga0495606_0018502 Ga0495606_0018502_1654_3417 532
494 3300046507 Ga0495606_0075723 Ga0495606_0075723_193_1818 532
495 3300046511 Ga0495608_0006641 Ga0495608_0006641_4939_6564 532
496 3300046514 Ga0495618_0002002 Ga0495618_0002002_1866_3488 532
497 3300046516 Ga0495628_0002704 Ga0495628_0002704_12725_14347 532
498 3300046516 Ga0495628_0022013 Ga0495628_0022013_1574_3196 532
499 3300046516 Ga0495628_0077127 Ga0495628_0077127_853_2478 532
500 3300046517 Ga0495630_0034535 Ga0495630_0034535_1739_3364 532
501 3300046526 Ga0495666_0000207 Ga0495666_0000207_1640_3262 532
502 3300046526 Ga0495666_0009982 Ga0495666_0009982_1496_3118 532
503 3300046529 Ga0495652_0009887 Ga0495652_0009887_1732_3354 532
504 3300046529 Ga0495652_0049085 Ga0495652_0049085_251_1876 532
505 3300046529 Ga0495652_0098737 Ga0495652_0098737_610_2244 532
506 3300046529 Ga0495652_0134284 Ga0495652_0134284_250_1872 532
507 3300046531 Ga0495665_0003478 Ga0495665_0003478_5293_6915 532
508 3300046531 Ga0495665_0004679 Ga0495665_0004679_4040_5665 532
509 3300046533 Ga0495640_0009094 Ga0495640_0009094_1746_3368 532
510 3300046533 Ga0495640_0028942 Ga0495640_0028942_794_2419 532
511 3300046533 Ga0495640_0029904 Ga0495640_0029904_608_2230 532
512 3300046535 Ga0495586_0000456 Ga0495586_0000456_21231_22853 532
513 3300046543 Ga0495645_0001425 Ga0495645_0001425_1632_3254 532
514 3300046543 Ga0495645_0006781 Ga0495645_0006781_5931_7556 532
515 3300046642 Ga0495634_0003108 Ga0495634_0003108_10227_11849 532
516 3300046663 Ga0495635_0039699 Ga0495635_0039699_1588_3216 532
517 3300046663 Ga0495635_0092541 Ga0495635_0092541_60_1685 532
518 3300046675 Ga0495657_0019266 Ga0495657_0019266_1611_3236 532
519 3300046678 Ga0495599_0004462 Ga0495599_0004462_5009_6631 532
520 3300046680 Ga0495646_0001665 Ga0495646_0001665_9986_11608 532
521 3300046680 Ga0495646_0009831 Ga0495646_0009831_2060_3685 532
522 3300046680 Ga0495646_0021056 Ga0495646_0021056_75_1697 532
523 3300046689 Ga0495613_0033227 Ga0495613_0033227_682_2304 532
524 3300046690 Ga0495624_0007497 Ga0495624_0007497_5788_7410 532
525 3300046690 Ga0495624_0007980 Ga0495624_0007980_1656_3278 532
526 3300046690 Ga0495624_0009606 Ga0495624_0009606_1747_3369 532
527 3300046794 Ga0495589_0030550 Ga0495589_0030550_660_2288 532
528 3300046794 Ga0495589_0032389 Ga0495589_0032389_73_1698 532
529 3300047315 Ga0495581_0000183 Ga0495581_0000183_25742_27364 532
530 3300047317 Ga0495604_0009034 Ga0495604_0009034_5780_7402 532
531 3300047317 Ga0495604_0034144 Ga0495604_0034144_723_2345 532
532 3300047317 Ga0495604_0036055 Ga0495604_0036055_699_2321 532
533 3300047319 Ga0495674_0033475 Ga0495674_0033475_1296_2918 532
534 3300047319 Ga0495674_0043861 Ga0495674_0043861_1934_3556 532
535 3300047319 Ga0495674_0049724 Ga0495674_0049724_1659_3281 532
536 3300047319 Ga0495674_0066703 Ga0495674_0066703_413_2038 532
537 3300047319 Ga0495674_0100345 Ga0495674_0100345_562_2196 532
538 3300047320 Ga0495672_0043777 Ga0495672_0043777_801_2423 532
539 3300047321 Ga0495676_0097771 Ga0495676_0097771_260_1885 532
540 3300047322 Ga0495680_0027716 Ga0495680_0027716_1168_2790 532
541 3300047323 Ga0495683_0008348 Ga0495683_0008348_1766_3394 532
542 3300047323 Ga0495683_0011799 Ga0495683_0011799_1194_2957 532
543 3300047323 Ga0495683_0017831 Ga0495683_0017831_397_2019 532
544 3300047323 Ga0495683_0020641 Ga0495683_0020641_702_2324 532
545 3300047443 Ga0495687_013585 Ga0495687_013585_1601_3364 532
546 3300047443 Ga0495687_014737 Ga0495687_014737_901_2523 532
547 3300047444 Ga0495675_0022458 Ga0495675_0022458_1581_3203 532
548 3300047444 Ga0495675_0024974 Ga0495675_0024974_1844_3469 532
549 3300047444 Ga0495675_0053111 Ga0495675_0053111_50_1672 532
550 3300047446 Ga0495679_000139 Ga0495679_000139_62087_63709 532
551 3300047446 Ga0495679_000825 Ga0495679_000825_16392_18014 532
552 3300047446 Ga0495679_005995 Ga0495679_005995_2031_3653 532
553 3300047673 Ga0495593_0006983 Ga0495593_0006983_3415_5037 532
554 3300048088 Ga0495602_0001984 Ga0495602_0001984_17265_18887 532
555 3300048088 Ga0495602_0054345 Ga0495602_0054345_1660_3282 532
556 3300048088 Ga0495602_0070438 Ga0495602_0070438_413_2038 532
557 3300048089 Ga0495614_0001918 Ga0495614_0001918_1674_3296 532
558 3300048917 Ga0496114_0125226 Ga0496114_0125226_296_1921 532
559 3300048921 Ga0496118_0016418 Ga0496118_0016418_1744_3366 532
560 3300048921 Ga0496118_0042249 Ga0496118_0042249_350_1975 532
561 3300048924 Ga0496121_0007384 Ga0496121_0007384_10008_11630 532
562 3300048929 Ga0496126_0018808 Ga0496126_0018808_1660_3282 532
563 3300049571 Ga0501034_0001190 Ga0501034_0001190_13010_15055 532
564 iso_pu_bacteria 2870068957 2870070894 532
565 iso_pu_bacteria 8020945358 8020945531 532

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21688

FAD-depend_C

FAD-dependent protein, C-terminal domain-like

410

605

1

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

275

403

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nlc-assembly1.cif.gz_A crystal structure of the vp0956 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr147 0.9455 1 532
3nlc-assembly1.cif.gz_A crystal structure of the vp0956 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr147 0.9438 1 532
7xe8-assembly2.cif.gz_B crystal structure of imine reductase from streptomyces albidoflavus 0.8904 100 128
6grl-assembly1.cif.gz_A structure of imine reductase (apo form) at 1.6 a resolution from saccharomonospora xinjiangensis 0.8167 97 129
5n0j-assembly1.cif.gz_A structure of a novel oxidoreductase from gloeobacter violaceus 0.7432 99 264
ID Description Score Start End Superfamily
3nlcA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.962 88 527 3.50.50.60
3nlcA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9541 88 527 3.50.50.60
af_A0A0P0WM81_180_403_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9051 94 303 3.50.50.60
5a9sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8621 102 129 3.40.50.720
af_A0A1D6LF14_1_79_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8541 215 260 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7R7DDV1-F1-model_v4 deleted 0.9645 106 528
AF-A0A6A5LEF6-F1-model_v4 deleted 0.9639 1 527
AF-A0A0Q0AL77-F1-model_v4 FAD-dependent protein C-terminal domain-containing protein 0.9632 90 528
AF-A0A7Y7M782-F1-model_v4 FAD-dependent oxidoreductase 0.9626 98 528
AF-A0A7W5EE02-F1-model_v4 FAD-dependent protein C-terminal domain-containing protein 0.9624 61 528

Feature Viewer

pLDDT pTM Quality
86.13 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map