F464323

General Info

Members Datasets Scaffolds Average Seq Length
565 365 1128 381

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_95314_c1|nmdc:mga06r32_95314_c1_1121_2413
Length 418
Sequence LTFVLISQSAHAQRFKGEGKTEFAARADSIPPERALRTNSERPNVPTLNLPVAGGKQAPYTMQQPREFPAAKPPFNRIAYAAAHVVADPLADADPWLDVAIDWERTVAFRRHLWSLGLGVAEAMDTAQRGMGLDWPTSLELIGRTLDAARDCPGALIGCGAGTDQLAANGASLDDVIRAYEEQCAAIEKLNGRIVLMASRALVKAARSPDDYAKVYGRILAQVKAPVIIHWLGEMFDPALDGYWGHKDHYAAMEVAVEVIAAHPEKVDGVKVSLLDKDKEIAMRRRLPQGVRMYTGDDFNYAELIGIFDAIAPAAGAALGALTRGEPETFHDILAPTVPLSRHIFMAPTRFYKTGVVFMAYLNGLQDHFTMVGGQESARSTLHLAELFRLADAAGLLADPDRAAARMRCVLATRGIAA

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
295 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
296 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
299 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
300 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
305 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
306 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
307 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
308 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
309 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
310 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
311 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
312 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
313 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
314 2643221580 Devosia sp. Root635 Isolate Unclassified
315 2643221582 Rhizobium sp. Root651 Isolate Unclassified
316 2643221591 Devosia sp. Root685 Isolate Unclassified
317 2643221629 Devosia sp. Root105 Isolate Unclassified
318 2643221662 Devosia sp. Root413D1 Isolate Unclassified
319 2643221674 Devosia sp. Root436 Isolate Unclassified
320 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
321 2643221693 Rhizobium sp. Root491 Isolate Unclassified
322 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
323 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
324 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
325 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
326 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
327 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
328 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
329 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
330 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
331 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
332 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
333 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
334 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
335 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
336 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
337 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
338 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
339 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
340 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
341 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
342 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
343 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
344 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
345 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
346 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
347 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
348 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
349 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
350 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
351 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
352 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
353 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
354 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
355 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
356 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
357 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
358 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
359 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
360 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
361 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
362 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
363 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
364 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
365 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.2
Metatranscriptomes 0
Isolates 10.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 9.91
Nodule 4.25
Rhizoplane 10.97
Rhizosphere 63.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_95314_c1 3300050510 Bacteria 2912
2 JGI24739J22299_10002028 3300001989 Bacteria 7752
3 JGI24735J21928_10005357 3300002067 Bacteria 4257
4 JGI24750J21931_1001065 3300002070 Bacteria 3586
5 JGI24738J21930_10003831 3300002075 Bacteria 3756
6 JGI25151J46595_10004033 3300003187 Bacteria 7876
7 rootH2_10036286 3300003320 Bacteria 1454
8 rootH2_10140249 3300003320 Bacteria 2826
9 JGI25160J50197_1000152 3300003354 Bacteria 60894
10 JGI25404J52841_10019199 3300003659 Bacteria 1481
11 Ga0058692_1001660 3300003856 Bacteria 7987
12 Ga0065165_1001079 3300005262 Bacteria 32537
13 Ga0065165_1001764 3300005262 Bacteria 21478
14 Ga0070683_100008490 3300005329 Bacteria 8725
15 Ga0070670_100059446 3300005331 Bacteria 3281
16 Ga0070670_100067059 3300005331 Bacteria 3080
17 Ga0068869_100039791 3300005334 Bacteria 3359
18 Ga0070666_10010009 3300005335 Bacteria 5917
19 Ga0070680_100007691 3300005336 Bacteria 8222
20 Ga0070680_100178870 3300005336 Bacteria 1786
21 Ga0070689_100059283 3300005340 Bacteria 2975
22 Ga0070661_100033885 3300005344 Bacteria 3702
23 Ga0070692_10130020 3300005345 Bacteria 1414
24 Ga0070671_100002293 3300005355 Bacteria 14772
25 Ga0070671_100062872 3300005355 Bacteria 3091
26 Ga0070674_100019337 3300005356 Bacteria 4325
27 Ga0070688_100027663 3300005365 Bacteria 3378
28 Ga0070667_100101861 3300005367 Bacteria 2481
29 Ga0070667_100272863 3300005367 Bacteria 1517
30 Ga0070709_10006670 3300005434 Bacteria 6303
31 Ga0070714_100005639 3300005435 Bacteria 9577
32 Ga0070713_100005618 3300005436 Bacteria 8599
33 Ga0070710_10001592 3300005437 Bacteria 10720
34 Ga0070694_100067615 3300005444 Bacteria 2453
35 Ga0070694_100170719 3300005444 Bacteria 1602
36 Ga0070678_100047778 3300005456 Bacteria 3078
37 Ga0070681_10000393 3300005458 Bacteria 35383
38 Ga0070681_10051649 3300005458 Bacteria 4100
39 Ga0068867_100146230 3300005459 Bacteria 1852
40 Ga0070679_100061160 3300005530 Bacteria 3754
41 Ga0070686_100165348 3300005544 Bacteria 1561
42 Ga0070665_100002585 3300005548 Bacteria 19803
43 Ga0070665_100037829 3300005548 Bacteria 4851
44 Ga0070704_100098358 3300005549 Bacteria 2198
45 Ga0068859_100189874 3300005617 Bacteria 2139
46 Ga0068859_100206879 3300005617 Bacteria 2048
47 Ga0068864_100052619 3300005618 Bacteria 3510
48 Ga0068864_100150912 3300005618 Bacteria 2105
49 Ga0068863_100005132 3300005841 Bacteria 12916
50 Ga0068862_100065762 3300005844 Bacteria 3123
51 Ga0081540_1000259 3300005983 Bacteria 55849
52 Ga0081540_1007648 3300005983 Bacteria 7667
53 Ga0070717_10002414 3300006028 Bacteria 13178
54 Ga0075365_10186601 3300006038 Bacteria 1450
55 Ga0075368_10002169 3300006042 Bacteria 6348
56 Ga0075368_10012500 3300006042 Bacteria 3105
57 Ga0075364_10024786 3300006051 Bacteria 3812
58 Ga0075364_10054580 3300006051 Bacteria 2613
59 Ga0075364_10112777 3300006051 Bacteria 1815
60 Ga0070715_10002800 3300006163 Bacteria 5429
61 Ga0075362_10006668 3300006177 Bacteria 4312
62 Ga0075367_10000357 3300006178 Bacteria 16390
63 Ga0075367_10040805 3300006178 Bacteria 2711
64 Ga0075366_10116562 3300006195 Bacteria 1608
65 Ga0097621_100001440 3300006237 Bacteria 16328
66 Ga0097621_100145266 3300006237 Bacteria 2030
67 Ga0075428_100000280 3300006844 Bacteria 50009
68 Ga0075428_100002145 3300006844 Bacteria 21309
69 Ga0075428_100029694 3300006844 Bacteria 6049
70 Ga0075430_100000319 3300006846 Bacteria 34222
71 Ga0075430_100004595 3300006846 Bacteria 11616
72 Ga0075430_100006309 3300006846 Bacteria 10002
73 Ga0075430_100011470 3300006846 Bacteria 7527
74 Ga0075430_100038383 3300006846 Bacteria 4056
75 Ga0075430_100079581 3300006846 Bacteria 2746
76 Ga0075431_100009654 3300006847 Bacteria 9689
77 Ga0075431_100198435 3300006847 Bacteria 2054
78 Ga0075431_100211303 3300006847 Bacteria 1982
79 Ga0075431_100230906 3300006847 Bacteria 1885
80 Ga0075434_100000003 3300006871 Bacteria 134839
81 Ga0075434_100284099 3300006871 Bacteria 1674
82 Ga0075429_100003718 3300006880 Bacteria 13008
83 Ga0075429_100008539 3300006880 Bacteria 8912
84 Ga0075429_100210108 3300006880 Bacteria 1705
85 Ga0075436_100012392 3300006914 Bacteria 5845
86 Ga0075436_100100594 3300006914 Bacteria 2013
87 Ga0097620_100189868 3300006931 Bacteria 2139
88 Ga0097620_100206906 3300006931 Bacteria 2048
89 Ga0099826_10000040 3300006948 Bacteria 98176
90 Ga0099826_10013124 3300006948 Bacteria 6255
91 Ga0075435_100010435 3300007076 Bacteria 6796
92 Ga0099794_10050607 3300007265 Bacteria 1999
93 Ga0111539_10000415 3300009094 Bacteria 53467
94 Ga0105247_10231192 3300009101 Bacteria 1256
95 Ga0114129_10003796 3300009147 Bacteria 21298
96 Ga0105243_10004732 3300009148 Bacteria 10707
97 Ga0105248_10042700 3300009177 Bacteria 5085
98 Ga0105248_10073325 3300009177 Bacteria 3847
99 Ga0105248_10282049 3300009177 Bacteria 1870
100 Ga0105248_10288341 3300009177 Bacteria 1848
101 Ga0157373_10003308 3300013100 Bacteria 12181
102 Ga0157371_10000042 3300013102 Bacteria 198938
103 Ga0157370_10000035 3300013104 Bacteria 137103
104 Ga0157369_10034340 3300013105 Bacteria 5567
105 Ga0157374_10000817 3300013296 Bacteria 27316
106 Ga0163162_10000119 3300013306 Bacteria 69465
107 Ga0163162_10100143 3300013306 Bacteria 2989
108 Ga0163162_10128562 3300013306 Bacteria 2641
109 Ga0157372_10208248 3300013307 Bacteria 2266
110 Ga0157375_10078104 3300013308 Bacteria 3342
111 Ga0163163_10002693 3300014325 Bacteria 15021
112 Ga0163163_10003896 3300014325 Bacteria 12723
113 Ga0157380_10081415 3300014326 Bacteria 2648
114 Ga0182008_10050620 3300014497 Bacteria 2062
115 Ga0157377_10052185 3300014745 Bacteria 2308
116 Ga0157376_10034320 3300014969 Bacteria 4096
117 Ga0157376_10111777 3300014969 Bacteria 2406
118 Ga0209435_100806 3300025206 Bacteria 5009
119 Ga0209759_1000097 3300025256 Bacteria 157627
120 Ga0209130_1005205 3300025284 Bacteria 4600
121 Ga0209675_1000882 3300025291 Bacteria 19297
122 Ga0209025_1000374 3300025294 Bacteria 93607
123 Ga0209564_1006003 3300025295 Bacteria 6710
124 Ga0209758_1000400 3300025297 Bacteria 74944
125 Ga0207426_1000103 3300025302 Bacteria 250320
126 Ga0207426_1002112 3300025302 Bacteria 13653
127 Ga0209051_1001712 3300025303 Bacteria 17510
128 Ga0207692_10002932 3300025898 Bacteria 6607
129 Ga0207642_10046573 3300025899 Bacteria 1933
130 Ga0207688_10081166 3300025901 Bacteria 1852
131 Ga0207680_10020835 3300025903 Bacteria 3539
132 Ga0207685_10001604 3300025905 Bacteria 4835
133 Ga0207699_10002399 3300025906 Bacteria 8849
134 Ga0207705_10146884 3300025909 Bacteria 1765
135 Ga0207707_10001889 3300025912 Bacteria 19120
136 Ga0207707_10030695 3300025912 Bacteria 4701
137 Ga0207693_10026790 3300025915 Bacteria 4560
138 Ga0207663_10001670 3300025916 Bacteria 10451
139 Ga0207660_10204867 3300025917 Bacteria 1542
140 Ga0207662_10012814 3300025918 Bacteria 4677
141 Ga0207662_10028204 3300025918 Bacteria 3244
142 Ga0207662_10212048 3300025918 Bacteria 1257
143 Ga0207657_10013968 3300025919 Bacteria 7857
144 Ga0207681_10087729 3300025923 Bacteria 2214
145 Ga0207650_10022119 3300025925 Bacteria 4500
146 Ga0207659_10081178 3300025926 Bacteria 2397
147 Ga0207659_10133111 3300025926 Bacteria 1922
148 Ga0207687_10259783 3300025927 Bacteria 1384
149 Ga0207700_10006118 3300025928 Bacteria 7249
150 Ga0207664_10023236 3300025929 Bacteria 4642
151 Ga0207644_10008769 3300025931 Bacteria 6621
152 Ga0207644_10041643 3300025931 Bacteria 3250
153 Ga0207690_10045508 3300025932 Bacteria 2900
154 Ga0207670_10074915 3300025936 Bacteria 2351
155 Ga0207670_10115989 3300025936 Bacteria 1938
156 Ga0207665_10086977 3300025939 Bacteria 2160
157 Ga0207691_10378131 3300025940 Bacteria 1209
158 Ga0207711_10020195 3300025941 Bacteria 5551
159 Ga0207711_10101463 3300025941 Bacteria 2546
160 Ga0207689_10003164 3300025942 Bacteria 15085
161 Ga0207689_10028873 3300025942 Bacteria 4638
162 Ga0207679_10237611 3300025945 Bacteria 1542
163 Ga0207658_10070887 3300025986 Bacteria 2638
164 Ga0207658_10081553 3300025986 Bacteria 2481
165 Ga0207708_10058060 3300026075 Bacteria 2953
166 Ga0207641_10018313 3300026088 Bacteria 5741
167 Ga0207641_10052319 3300026088 Bacteria 3458
168 Ga0207641_10128760 3300026088 Bacteria 2270
169 Ga0207648_10200478 3300026089 Bacteria 1770
170 Ga0207675_100019861 3300026118 Bacteria 6270
171 Ga0207683_10037248 3300026121 Bacteria 4235
172 Ga0207683_10075957 3300026121 Bacteria 2974
173 Ga0209371_1000003 3300027312 Bacteria 1122971
174 Ga0209371_1000998 3300027312 Bacteria 21742
175 Ga0209371_1010382 3300027312 Bacteria 2868
176 Ga0209969_1000360 3300027360 Bacteria 6116
177 Ga0209967_1000598 3300027364 Bacteria 4695
178 Ga0209981_1002027 3300027378 Bacteria 2590
179 Ga0210000_1000268 3300027462 Bacteria 7410
180 Ga0210000_1001534 3300027462 Bacteria 3257
181 Ga0209995_1001640 3300027471 Bacteria 3478
182 Ga0209999_1002061 3300027543 Bacteria 3513
183 Ga0209282_1000167 3300027666 Bacteria 37134
184 Ga0209282_1050107 3300027666 Bacteria 2403
185 Ga0209813_10013727 3300027866 Bacteria 2168
186 Ga0209813_10042412 3300027866 Bacteria 1390
187 Ga0207428_10004843 3300027907 Bacteria 12697
188 Ga0268266_10001510 3300028379 Bacteria 27433
189 Ga0268266_10002425 3300028379 Bacteria 20076
190 Ga0268266_10124537 3300028379 Bacteria 2298
191 Ga0268265_10023406 3300028380 Bacteria 4353
192 Ga0268264_10142385 3300028381 Bacteria 2140
193 Ga0268256_1000004 3300030500 Bacteria 1122967
194 Ga0268256_1002297 3300030500 Bacteria 9909
195 Ga0268256_1011138 3300030500 Bacteria 2868
196 Ga0268256_1012972 3300030500 Bacteria 2550
197 Ga0265325_10000291 3300031241 Bacteria 35029
198 Ga0265340_10047749 3300031247 Bacteria 2083
199 Ga0265316_10126203 3300031344 Bacteria 1929
200 Ga0307405_10062571 3300031731 Bacteria 2358
201 Ga0307412_10000003 3300031911 Bacteria 659081
202 Ga0307416_100198387 3300032002 Bacteria 1901
203 Ga0307507_10100209 3300033179 Bacteria 2428
204 Ga0307510_10016468 3300033180 Bacteria 8725
205 Ga0307510_10042938 3300033180 Bacteria 4920
206 Ga0373953_0041940 3300035117 Bacteria 1822
207 Ga0373954_0000003 3300035118 Bacteria 137757
208 Ga0373961_0012161 3300035241 Bacteria 2150
209 Ga0373961_0025522 3300035241 Bacteria 1607
210 Ga0373931_0002472 3300035691 Bacteria 8191
211 Ga0373931_0019088 3300035691 Bacteria 3417
212 Ga0373933_0011065 3300035724 Bacteria 4959
213 Ga0373937_0000131 3300036401 Bacteria 72767
214 Ga0373925_0035982 3300037068 Bacteria 3655
215 Ga0395899_0001796 3300037312 Bacteria 17781
216 Ga0395900_0058638 3300037418 Bacteria 3963
217 Ga0395898_0237623 3300037466 Bacteria 1738
218 Ga0395905_0026083 3300037471 Bacteria 5511
219 Ga0395901_0001705 3300038443 Bacteria 22698
220 Ga0395901_0338626 3300038443 Bacteria 1554
221 Ga0436365_0841579 3300039437 Bacteria 1833
222 Ga0436365_0961376 3300039437 Bacteria 13290
223 Ga0436365_1860307 3300039437 Bacteria 1317
224 Ga0451807_0028406 3300041486 Bacteria 4524
225 Ga0439441_000359 3300042001 Bacteria 4691
226 Ga0439460_0010474 3300042461 Bacteria 2374
227 Ga0466969_0002021 3300044656 Bacteria 10838
228 Ga0466965_0008955 3300044683 Bacteria 4639
229 Ga0466966_0002405 3300044684 Bacteria 12217
230 Ga0466966_0003694 3300044684 Bacteria 10092
231 Ga0466961_0001327 3300044693 Bacteria 15256
232 Ga0466961_0001482 3300044693 Bacteria 14592
233 Ga0466961_0003884 3300044693 Bacteria 9339
234 Ga0466964_0005963 3300044706 Bacteria 4539
235 Ga0466970_0001757 3300044765 Bacteria 10458
236 Ga0466970_0048420 3300044765 Bacteria 2266
237 Ga0466957_0006857 3300044842 Bacteria 6438
238 Ga0466959_0001528 3300045049 Bacteria 14221
239 Ga0466959_0003967 3300045049 Bacteria 9835
240 Ga0451576_0105022 3300045051 Bacteria 2938
241 Ga0451576_0336534 3300045051 Bacteria 1580
242 Ga0466958_0001223 3300045836 Bacteria 12013
243 Ga0466958_0006856 3300045836 Bacteria 6227
244 Ga0495592_0140163 3300046454 Bacteria 1683
245 Ga0495603_0000913 3300046455 Bacteria 16979
246 Ga0495603_0060178 3300046455 Bacteria 2244
247 Ga0495629_0000084 3300046459 Bacteria 83614
248 Ga0495629_0009472 3300046459 Bacteria 7124
249 Ga0495629_0013480 3300046459 Bacteria 5895
250 Ga0495653_0086428 3300046463 Bacteria 2305
251 Ga0495650_0000041 3300046471 Bacteria 363945
252 Ga0495650_0000543 3300046471 Bacteria 53935
253 Ga0495650_0040317 3300046471 Bacteria 2005
254 Ga0495580_0012872 3300046472 Bacteria 6409
255 Ga0495580_0044850 3300046472 Bacteria 3143
256 Ga0495580_0051643 3300046472 Bacteria 2906
257 Ga0495580_0224025 3300046472 Bacteria 1292
258 Ga0495582_0001739 3300046473 Bacteria 12287
259 Ga0495582_0026781 3300046473 Bacteria 3161
260 Ga0495639_0010035 3300046475 Bacteria 4070
261 Ga0495664_0002957 3300046477 Bacteria 9175
262 Ga0495594_0000064 3300046499 Bacteria 45387
263 Ga0495594_0000278 3300046499 Bacteria 25080
264 Ga0495594_0007198 3300046499 Bacteria 5722
265 Ga0495596_0007132 3300046500 Bacteria 5060
266 Ga0495596_0039340 3300046500 Bacteria 1868
267 Ga0495583_0010080 3300046506 Bacteria 5559
268 Ga0495583_0014486 3300046506 Bacteria 4349
269 Ga0495606_0059600 3300046507 Bacteria 2448
270 Ga0495608_0090008 3300046511 Bacteria 1986
271 Ga0495610_0000404 3300046512 Bacteria 44370
272 Ga0495618_0080264 3300046514 Bacteria 2082
273 Ga0495628_0016740 3300046516 Bacteria 6112
274 Ga0495631_0121345 3300046518 Bacteria 1124
275 Ga0495644_0000605 3300046523 Bacteria 15088
276 Ga0495648_0006282 3300046524 Bacteria 9718
277 Ga0495666_0001156 3300046526 Bacteria 12656
278 Ga0495642_0005457 3300046528 Bacteria 4886
279 Ga0495652_0013149 3300046529 Bacteria 7451
280 Ga0495665_0019374 3300046531 Bacteria 3659
281 Ga0495640_0018052 3300046533 Bacteria 5243
282 Ga0495586_0014069 3300046535 Bacteria 4250
283 Ga0495609_0019522 3300046538 Bacteria 3135
284 Ga0495621_0015002 3300046539 Bacteria 2463
285 Ga0495645_0000231 3300046543 Bacteria 40403
286 Ga0495645_0001708 3300046543 Bacteria 14933
287 Ga0495622_0014677 3300046557 Bacteria 3639
288 Ga0495667_0007018 3300046559 Bacteria 7643
289 Ga0495625_0057655 3300046660 Bacteria 2761
290 Ga0495625_0163256 3300046660 Bacteria 1491
291 Ga0495635_0006962 3300046663 Bacteria 7898
292 Ga0495588_0004233 3300046674 Bacteria 6331
293 Ga0495599_0014138 3300046678 Bacteria 4940
294 Ga0495599_0195915 3300046678 Bacteria 1242
295 Ga0495646_0002346 3300046680 Bacteria 11584
296 Ga0495669_0005308 3300046684 Bacteria 5370
297 Ga0495669_0010490 3300046684 Bacteria 3917
298 Ga0495669_0032230 3300046684 Bacteria 2303
299 Ga0495669_0051540 3300046684 Bacteria 1847
300 Ga0495613_0000700 3300046689 Bacteria 26428
301 Ga0495613_0012199 3300046689 Bacteria 6386
302 Ga0495624_0002596 3300046690 Bacteria 13633
303 Ga0495671_0022251 3300046692 Bacteria 3323
304 Ga0495649_0029406 3300046694 Bacteria 3039
305 Ga0495589_0002263 3300046794 Bacteria 10825
306 Ga0495581_0013142 3300047315 Bacteria 4800
307 Ga0495581_0148372 3300047315 Bacteria 1369
308 Ga0495636_0086486 3300047318 Bacteria 1356
309 Ga0495674_0014184 3300047319 Bacteria 7463
310 Ga0495672_0037443 3300047320 Bacteria 2968
311 Ga0495676_0029608 3300047321 Bacteria 4661
312 Ga0495676_0041762 3300047321 Bacteria 3771
313 Ga0495680_0006693 3300047322 Bacteria 10669
314 Ga0495683_0010589 3300047323 Bacteria 4865
315 Ga0495683_0043143 3300047323 Bacteria 2272
316 Ga0495687_007101 3300047443 Bacteria 6681
317 Ga0495687_041294 3300047443 Bacteria 2025
318 Ga0495675_0002174 3300047444 Bacteria 11689
319 Ga0495673_0011500 3300047469 Bacteria 4756
320 Ga0495673_0058188 3300047469 Bacteria 1667
321 Ga0495681_0012386 3300047470 Bacteria 5015
322 Ga0495684_0033211 3300047471 Bacteria 3960
323 Ga0495686_0121016 3300047472 Bacteria 1560
324 Ga0495593_0021592 3300047673 Bacteria 3593
325 Ga0495593_0028164 3300047673 Bacteria 3087
326 Ga0495593_0075067 3300047673 Bacteria 1753
327 Ga0495614_0000963 3300048089 Bacteria 12244
328 Ga0495614_0105876 3300048089 Bacteria 1232
329 Ga0496100_0017708 3300048903 Bacteria 4212
330 Ga0496101_0274616 3300048904 Bacteria 1316
331 Ga0496102_0074532 3300048905 Bacteria 3119
332 Ga0496102_0096896 3300048905 Bacteria 2735
333 Ga0496102_0102965 3300048905 Bacteria 2655
334 Ga0496102_0200903 3300048905 Bacteria 1879
335 Ga0496102_0205089 3300048905 Bacteria 1859
336 Ga0496103_0100724 3300048906 Bacteria 1828
337 Ga0496104_0000406 3300048907 Bacteria 37705
338 Ga0496104_0003010 3300048907 Bacteria 14511
339 Ga0496104_0009357 3300048907 Bacteria 8713
340 Ga0496104_0015099 3300048907 Bacteria 6990
341 Ga0496104_0017063 3300048907 Bacteria 6607
342 Ga0496104_0254307 3300048907 Bacteria 1670
343 Ga0496104_0325136 3300048907 Bacteria 1451
344 Ga0496105_0001047 3300048908 Bacteria 19154
345 Ga0496105_0004690 3300048908 Bacteria 10303
346 Ga0496105_0008980 3300048908 Bacteria 7797
347 Ga0496105_0027766 3300048908 Bacteria 4626
348 Ga0496105_0098643 3300048908 Bacteria 2412
349 Ga0496105_0200666 3300048908 Bacteria 1628
350 Ga0496106_0034458 3300048909 Bacteria 3781
351 Ga0496107_0042533 3300048910 Bacteria 3263
352 Ga0496108_0002003 3300048911 Bacteria 16322
353 Ga0496108_0028128 3300048911 Bacteria 4650
354 Ga0496109_0001337 3300048912 Bacteria 20357
355 Ga0496109_0012331 3300048912 Bacteria 7379
356 Ga0496109_0034899 3300048912 Bacteria 4534
357 Ga0496109_0134775 3300048912 Bacteria 2307
358 Ga0496110_0004175 3300048913 Bacteria 11155
359 Ga0496110_0043984 3300048913 Bacteria 3899
360 Ga0496110_0107547 3300048913 Bacteria 2504
361 Ga0496111_0007887 3300048914 Bacteria 7018
362 Ga0496111_0021665 3300048914 Bacteria 4491
363 Ga0496111_0029356 3300048914 Bacteria 3906
364 Ga0496111_0136853 3300048914 Bacteria 1814
365 Ga0496112_0001344 3300048915 Bacteria 18703
366 Ga0496112_0012523 3300048915 Bacteria 7791
367 Ga0496112_0060128 3300048915 Bacteria 3743
368 Ga0496112_0074063 3300048915 Bacteria 3367
369 Ga0496112_0140335 3300048915 Bacteria 2386
370 Ga0496112_0284856 3300048915 Bacteria 1599
371 Ga0496113_0003718 3300048916 Bacteria 9200
372 Ga0496113_0007339 3300048916 Bacteria 7080
373 Ga0496113_0025506 3300048916 Bacteria 4214
374 Ga0496113_0054287 3300048916 Bacteria 2999
375 Ga0496113_0078649 3300048916 Bacteria 2523
376 Ga0496113_0118789 3300048916 Bacteria 2065
377 Ga0496114_0004297 3300048917 Bacteria 11030
378 Ga0496114_0074200 3300048917 Bacteria 2863
379 Ga0496114_0165182 3300048917 Bacteria 1927
380 Ga0496114_0346521 3300048917 Bacteria 1314
381 Ga0496114_0400639 3300048917 Bacteria 1215
382 Ga0496115_0002089 3300048918 Bacteria 14308
383 Ga0496115_0010283 3300048918 Bacteria 6985
384 Ga0496115_0036572 3300048918 Bacteria 3888
385 Ga0496115_0066246 3300048918 Bacteria 2919
386 Ga0496116_0137214 3300048919 Bacteria 1382
387 Ga0496117_0000036 3300048920 Bacteria 325635
388 Ga0496117_0002472 3300048920 Bacteria 23206
389 Ga0496117_0017949 3300048920 Bacteria 5890
390 Ga0496117_0130898 3300048920 Bacteria 1521
391 Ga0496118_0000990 3300048921 Bacteria 44241
392 Ga0496118_0155092 3300048921 Bacteria 1426
393 Ga0496119_0012723 3300048922 Bacteria 6800
394 Ga0496120_0000036 3300048923 Bacteria 206505
395 Ga0496121_0000005 3300048924 Bacteria 1034486
396 Ga0496121_0070553 3300048924 Bacteria 2814
397 Ga0496121_0073066 3300048924 Bacteria 2750
398 Ga0496121_0105273 3300048924 Bacteria 2166
399 Ga0496122_0000002 3300048925 Bacteria 905834
400 Ga0496122_0016734 3300048925 Bacteria 6911
401 Ga0496122_0051655 3300048925 Bacteria 3120
402 Ga0496123_0000002 3300048926 Bacteria 1811682
403 Ga0496124_0000080 3300048927 Bacteria 210439
404 Ga0496124_0005551 3300048927 Bacteria 14128
405 Ga0496124_0070316 3300048927 Bacteria 2903
406 Ga0496124_0097604 3300048927 Bacteria 2385
407 Ga0496125_0000159 3300048928 Bacteria 151205
408 Ga0496126_0000734 3300048929 Bacteria 59483
409 Ga0496126_0176268 3300048929 Bacteria 1818
410 Ga0495682_0003424 3300049460 Bacteria 7056
411 Ga0495682_0004180 3300049460 Bacteria 6251
412 Ga0495682_0023138 3300049460 Bacteria 2321
413 Ga0501036_0045274 3300049572 Bacteria 3728
414 Ga0501036_0129926 3300049572 Bacteria 2127
415 Ga0501037_0021597 3300049573 Bacteria 4759
416 Ga0501038_0203995 3300049574 Bacteria 1585
417 Ga0501039_0001422 3300049575 Bacteria 17622
418 Ga0501039_0066483 3300049575 Bacteria 2798
419 Ga0501039_0233210 3300049575 Bacteria 1447
420 Ga0501040_0049808 3300049576 Bacteria 2865
421 Ga0501041_0002140 3300049577 Bacteria 11138
422 Ga0501042_0036746 3300049578 Bacteria 3475
423 Ga0501043_0011893 3300049579 Bacteria 6815
424 Ga0501046_0023901 3300049580 Bacteria 5019
425 Ga0501046_0095202 3300049580 Bacteria 2288
426 Ga0501048_0026841 3300049582 Bacteria 4191
427 Ga0501072_0014159 3300049588 Bacteria 6112
428 Ga0501072_0091602 3300049588 Bacteria 2414
429 Ga0501074_0126979 3300049590 Bacteria 1825
430 Ga0501075_0003293 3300049591 Bacteria 10814
431 Ga0501075_0053071 3300049591 Bacteria 3048
432 Ga0501076_0003274 3300049592 Bacteria 11341
433 Ga0501079_0085933 3300049741 Bacteria 2435
434 Ga0501080_0005820 3300049742 Bacteria 11037
435 Ga0501081_0000516 3300049743 Bacteria 21719
436 Ga0501081_0001649 3300049743 Bacteria 13814
437 Ga0501035_0306681 3300049822 Bacteria 1336
438 nmdc:mga03683_21713_c1 3300050489 Bacteria 2480
439 nmdc:mga03n38_43705_c1 3300050490 Bacteria 1965
440 nmdc:mga03n38_60770_c1 3300050490 Bacteria 1719
441 nmdc:mga00v17_19_c1 3300050491 Bacteria 115002
442 nmdc:mga00v17_37632_c1 3300050491 Bacteria 2470
443 nmdc:mga0yw44_110897_c1 3300050492 Bacteria 1758
444 nmdc:mga0yw44_63705_c1 3300050492 Bacteria 2268
445 nmdc:mga0k408_30771_c1 3300050493 Bacteria 3062
446 nmdc:mga06z11_14215_c1 3300050494 Bacteria 3520
447 nmdc:mga06z11_7960_c1 3300050494 Bacteria 4391
448 nmdc:mga06z11_91576_c1 3300050494 Bacteria 1651
449 nmdc:mga04h51_39259_c1 3300050495 Bacteria 1537
450 nmdc:mga04h51_56716_c1 3300050495 Bacteria 1331
451 nmdc:mga04h51_65123_c1 3300050495 Bacteria 1259
452 nmdc:mga07m45_92448_c1 3300050496 Bacteria 1734
453 nmdc:mga05p37_10912_c1 3300050507 Bacteria 10786
454 nmdc:mga05p37_139979_c1 3300050507 Bacteria 2965
455 nmdc:mga05p37_21649_c1 3300050507 Bacteria 7788
456 nmdc:mga05p37_21875_c1 3300050507 Bacteria 7749
457 nmdc:mga09592_1594_c1 3300050508 Bacteria 18277
458 nmdc:mga09592_179399_c1 3300050508 Bacteria 1832
459 nmdc:mga09592_18776_c1 3300050508 Bacteria 5672
460 nmdc:mga09592_63037_c1 3300050508 Bacteria 3137
461 nmdc:mga0qj67_134068_c1 3300050509 Bacteria 2007
462 nmdc:mga0qj67_20_c1 3300050509 Bacteria 109238
463 nmdc:mga0qj67_252_c1 3300050509 Bacteria 36647
464 nmdc:mga0qj67_63182_c1 3300050509 Bacteria 2944
465 nmdc:mga0qj67_6610_c1 3300050509 Bacteria 8518
466 nmdc:mga06r32_16956_c1 3300050510 Bacteria 6645
467 nmdc:mga06r32_200359_c1 3300050510 Bacteria 1984
468 nmdc:mga08y16_165920_c1 3300050511 Bacteria 2294
469 nmdc:mga08y16_28787_c1 3300050511 Bacteria 5855
470 nmdc:mga08y16_3283_c1 3300050511 Bacteria 16759
471 nmdc:mga0n895_6765_c1 3300050512 Bacteria 9780
472 nmdc:mga0rr50_2920_c1 3300050513 Bacteria 9758
473 nmdc:mga08x19_4603_c3 3300050514 Bacteria 3250
474 nmdc:mga08x19_68006_c1 3300050514 Bacteria 2318
475 nmdc:mga0a205_75160_c1 3300050515 Bacteria 3264
476 nmdc:mga0sz30_1633_c1 3300050516 Bacteria 7984
477 nmdc:mga0sz30_42148_c1 3300050516 Bacteria 1920
478 nmdc:mga0sz30_70001_c1 3300050516 Bacteria 1509
479 Ga0495601_0037111 3300053077 Bacteria 3046
480 Ga0495612_0019557 3300053078 Bacteria 2712
481 Ga0495619_0085500 3300053085 Bacteria 2130
482 Ga0495619_0136818 3300053085 Bacteria 1685
483 Ga0500651_0000002 3300053093 Bacteria 476609
484 Ga0500560_000204 3300053107 Bacteria 7053
485 Ga0500595_000012 3300053119 Bacteria 255472
486 Ga0500595_020004 3300053119 Bacteria 2417
487 Ga0500618_001007 3300053125 Bacteria 14209
488 Ga0500561_0000036 3300053137 Bacteria 27979
489 Ga0500604_0000777 3300053151 Bacteria 8778
490 Ga0500616_0057974 3300053153 Bacteria 2016
491 Ga0500624_000553 3300053157 Bacteria 10491
492 Ga0500634_0000373 3300053161 Bacteria 14283
493 Ga0500634_0003279 3300053161 Bacteria 7149
494 Ga0500636_0000011 3300053177 Bacteria 140769
495 Ga0500636_0000283 3300053177 Bacteria 28087
496 Ga0501084_0023633 3300054114 Bacteria 5126
497 Ga0501084_0046438 3300054114 Bacteria 3638
498 Ga0500661_000530 3300055283 Bacteria 7088
499 Ga0501082_0085318 3300060353 Bacteria 2723
500 Ga0501082_0088701 3300060353 Bacteria 2669
501 Ga0501082_0096941 3300060353 Bacteria 2549
502 Ga0530510_0042441 3300061734 Bacteria 3286
503 Ga0530510_0176938 3300061734 Bacteria 1581
504 2515687161 2515154123 Bacteria 6387382
505 2537873473 2537561587 Bacteria 5425293
506 2554245852 2554235003 Bacteria 5877155
507 2559296382 2558860242 Bacteria 5568029
508 2599605569 2599185210 Bacteria 5624189
509 2601611764 2600255279 Bacteria 5605316
510 2601749505 2600255308 Bacteria 5611129
511 2643748305 2643221545 Bacteria 5083237
512 2643754626 2643221547 Bacteria 4740017
513 2643910918 2643221580 Bacteria 3816678
514 2643917661 2643221582 Bacteria 5804683
515 2643965888 2643221591 Bacteria 4397626
516 2644167345 2643221629 Bacteria 5850260
517 2644349861 2643221662 Bacteria 5851492
518 2644412166 2643221674 Bacteria 3919126
519 2644508158 2643221691 Bacteria 5093099
520 2644522816 2643221693 Bacteria 5513853
521 2757572245 2757320392 Bacteria 3737298
522 2808988600 2808606387 Bacteria 5697198
523 2819557822 2818991439 Bacteria 6907412
524 2821445651 2821443989 Bacteria 7658172
525 2838679780 2838675328 Bacteria 4909118
526 2838717450 2838714209 Bacteria 5525906
527 2838724349 2838719591 Bacteria 5523910
528 2838729334 2838724970 Bacteria 4908691
529 2840768355 2840764183 Bacteria 6358399
530 2841850761 2841846520 Bacteria 5345850
531 2841864050 2841859092 Bacteria 5436171
532 2842129566 2842124991 Bacteria 5346824
533 2842134711 2842130223 Bacteria 4909145
534 2842156771 2842152218 Bacteria 4908957
535 2842173029 2842170452 Bacteria 5525737
536 2842180389 2842175837 Bacteria 4908771
537 2842191952 2842187318 Bacteria 5524014
538 2842216268 2842211629 Bacteria 5523832
539 2842228988 2842224351 Bacteria 5524473
540 2842520832 2842515876 Bacteria 5436280
541 2899793634 2899792073 Bacteria 4926588
542 2899848727 2899845264 Bacteria 5672268
543 2919119204 2919114240 Bacteria 5700270
544 2919534350 2919527303 Bacteria 7718827
545 2921653993 2921643360 Bacteria 11448031
546 2926759235 2926754445 Bacteria 5964435
547 2926763328 2926760298 Bacteria 5505990
548 2929142961 2929138655 Bacteria 5810547
549 2933011376 2933006813 Bacteria 4912075
550 2933016555 2933011516 Bacteria 5439334
551 2933596052 2933594066 Bacteria 5594265
552 2945936508 2945934425 Bacteria 7444609
553 2979091639 2979089926 Bacteria 5670289
554 2979097160 2979095461 Bacteria 5669583
555 2979102863 2979100975 Bacteria 5423623
556 2984509248 2984509177 Bacteria 5274802
557 2984520053 2984518228 Bacteria 5277463
558 2984537577 2984537506 Bacteria 5277481
559 2984604325 2984601300 Bacteria 5455244
560 2990709582 2990703756 Bacteria 7715990
561 642425263 641736151 Bacteria 7477263
562 650842775 650716007 Bacteria 5573770
563 8003574810 8003570095 Bacteria 5747666
564 8054464679 8054460903 Bacteria 4872905
565 nmdc:mga06r32_95314_c1
566 JGI24739J22299_10002028
567 JGI24735J21928_10005357
568 JGI24750J21931_1001065
569 JGI24738J21930_10003831
570 JGI25151J46595_10004033
571 rootH2_10036286
572 rootH2_10140249
573 JGI25160J50197_1000152
574 JGI25404J52841_10019199
575 Ga0058692_1001660
576 Ga0065165_1001079
577 Ga0065165_1001764
578 Ga0070683_100008490
579 Ga0070670_100059446
580 Ga0070670_100067059
581 Ga0068869_100039791
582 Ga0070666_10010009
583 Ga0070680_100007691
584 Ga0070680_100178870
585 Ga0070689_100059283
586 Ga0070661_100033885
587 Ga0070692_10130020
588 Ga0070671_100002293
589 Ga0070671_100062872
590 Ga0070674_100019337
591 Ga0070688_100027663
592 Ga0070667_100101861
593 Ga0070667_100272863
594 Ga0070709_10006670
595 Ga0070714_100005639
596 Ga0070713_100005618
597 Ga0070710_10001592
598 Ga0070694_100067615
599 Ga0070694_100170719
600 Ga0070678_100047778
601 Ga0070681_10000393
602 Ga0070681_10051649
603 Ga0068867_100146230
604 Ga0070679_100061160
605 Ga0070686_100165348
606 Ga0070665_100002585
607 Ga0070665_100037829
608 Ga0070704_100098358
609 Ga0068859_100189874
610 Ga0068859_100206879
611 Ga0068864_100052619
612 Ga0068864_100150912
613 Ga0068863_100005132
614 Ga0068862_100065762
615 Ga0081540_1000259
616 Ga0081540_1007648
617 Ga0070717_10002414
618 Ga0075365_10186601
619 Ga0075368_10002169
620 Ga0075368_10012500
621 Ga0075364_10024786
622 Ga0075364_10054580
623 Ga0075364_10112777
624 Ga0070715_10002800
625 Ga0075362_10006668
626 Ga0075367_10000357
627 Ga0075367_10040805
628 Ga0075366_10116562
629 Ga0097621_100001440
630 Ga0097621_100145266
631 Ga0075428_100000280
632 Ga0075428_100002145
633 Ga0075428_100029694
634 Ga0075430_100000319
635 Ga0075430_100004595
636 Ga0075430_100006309
637 Ga0075430_100011470
638 Ga0075430_100038383
639 Ga0075430_100079581
640 Ga0075431_100009654
641 Ga0075431_100198435
642 Ga0075431_100211303
643 Ga0075431_100230906
644 Ga0075434_100000003
645 Ga0075434_100284099
646 Ga0075429_100003718
647 Ga0075429_100008539
648 Ga0075429_100210108
649 Ga0075436_100012392
650 Ga0075436_100100594
651 Ga0097620_100189868
652 Ga0097620_100206906
653 Ga0099826_10000040
654 Ga0099826_10013124
655 Ga0075435_100010435
656 Ga0099794_10050607
657 Ga0111539_10000415
658 Ga0105247_10231192
659 Ga0114129_10003796
660 Ga0105243_10004732
661 Ga0105248_10042700
662 Ga0105248_10073325
663 Ga0105248_10282049
664 Ga0105248_10288341
665 Ga0157373_10003308
666 Ga0157371_10000042
667 Ga0157370_10000035
668 Ga0157369_10034340
669 Ga0157374_10000817
670 Ga0163162_10000119
671 Ga0163162_10100143
672 Ga0163162_10128562
673 Ga0157372_10208248
674 Ga0157375_10078104
675 Ga0163163_10002693
676 Ga0163163_10003896
677 Ga0157380_10081415
678 Ga0182008_10050620
679 Ga0157377_10052185
680 Ga0157376_10034320
681 Ga0157376_10111777
682 Ga0209435_100806
683 Ga0209759_1000097
684 Ga0209130_1005205
685 Ga0209675_1000882
686 Ga0209025_1000374
687 Ga0209564_1006003
688 Ga0209758_1000400
689 Ga0207426_1000103
690 Ga0207426_1002112
691 Ga0209051_1001712
692 Ga0207692_10002932
693 Ga0207642_10046573
694 Ga0207688_10081166
695 Ga0207680_10020835
696 Ga0207685_10001604
697 Ga0207699_10002399
698 Ga0207705_10146884
699 Ga0207707_10001889
700 Ga0207707_10030695
701 Ga0207693_10026790
702 Ga0207663_10001670
703 Ga0207660_10204867
704 Ga0207662_10012814
705 Ga0207662_10028204
706 Ga0207662_10212048
707 Ga0207657_10013968
708 Ga0207681_10087729
709 Ga0207650_10022119
710 Ga0207659_10081178
711 Ga0207659_10133111
712 Ga0207687_10259783
713 Ga0207700_10006118
714 Ga0207664_10023236
715 Ga0207644_10008769
716 Ga0207644_10041643
717 Ga0207690_10045508
718 Ga0207670_10074915
719 Ga0207670_10115989
720 Ga0207665_10086977
721 Ga0207691_10378131
722 Ga0207711_10020195
723 Ga0207711_10101463
724 Ga0207689_10003164
725 Ga0207689_10028873
726 Ga0207679_10237611
727 Ga0207658_10070887
728 Ga0207658_10081553
729 Ga0207708_10058060
730 Ga0207641_10018313
731 Ga0207641_10052319
732 Ga0207641_10128760
733 Ga0207648_10200478
734 Ga0207675_100019861
735 Ga0207683_10037248
736 Ga0207683_10075957
737 Ga0209371_1000003
738 Ga0209371_1000998
739 Ga0209371_1010382
740 Ga0209969_1000360
741 Ga0209967_1000598
742 Ga0209981_1002027
743 Ga0210000_1000268
744 Ga0210000_1001534
745 Ga0209995_1001640
746 Ga0209999_1002061
747 Ga0209282_1000167
748 Ga0209282_1050107
749 Ga0209813_10013727
750 Ga0209813_10042412
751 Ga0207428_10004843
752 Ga0268266_10001510
753 Ga0268266_10002425
754 Ga0268266_10124537
755 Ga0268265_10023406
756 Ga0268264_10142385
757 Ga0268256_1000004
758 Ga0268256_1002297
759 Ga0268256_1011138
760 Ga0268256_1012972
761 Ga0265325_10000291
762 Ga0265340_10047749
763 Ga0265316_10126203
764 Ga0307405_10062571
765 Ga0307412_10000003
766 Ga0307416_100198387
767 Ga0307507_10100209
768 Ga0307510_10016468
769 Ga0307510_10042938
770 Ga0373953_0041940
771 Ga0373954_0000003
772 Ga0373961_0012161
773 Ga0373961_0025522
774 Ga0373931_0002472
775 Ga0373931_0019088
776 Ga0373933_0011065
777 Ga0373937_0000131
778 Ga0373925_0035982
779 Ga0395899_0001796
780 Ga0395900_0058638
781 Ga0395898_0237623
782 Ga0395905_0026083
783 Ga0395901_0001705
784 Ga0395901_0338626
785 Ga0436365_0841579
786 Ga0436365_0961376
787 Ga0436365_1860307
788 Ga0451807_0028406
789 Ga0439441_000359
790 Ga0439460_0010474
791 Ga0466969_0002021
792 Ga0466965_0008955
793 Ga0466966_0002405
794 Ga0466966_0003694
795 Ga0466961_0001327
796 Ga0466961_0001482
797 Ga0466961_0003884
798 Ga0466964_0005963
799 Ga0466970_0001757
800 Ga0466970_0048420
801 Ga0466957_0006857
802 Ga0466959_0001528
803 Ga0466959_0003967
804 Ga0451576_0105022
805 Ga0451576_0336534
806 Ga0466958_0001223
807 Ga0466958_0006856
808 Ga0495592_0140163
809 Ga0495603_0000913
810 Ga0495603_0060178
811 Ga0495629_0000084
812 Ga0495629_0009472
813 Ga0495629_0013480
814 Ga0495653_0086428
815 Ga0495650_0000041
816 Ga0495650_0000543
817 Ga0495650_0040317
818 Ga0495580_0012872
819 Ga0495580_0044850
820 Ga0495580_0051643
821 Ga0495580_0224025
822 Ga0495582_0001739
823 Ga0495582_0026781
824 Ga0495639_0010035
825 Ga0495664_0002957
826 Ga0495594_0000064
827 Ga0495594_0000278
828 Ga0495594_0007198
829 Ga0495596_0007132
830 Ga0495596_0039340
831 Ga0495583_0010080
832 Ga0495583_0014486
833 Ga0495606_0059600
834 Ga0495608_0090008
835 Ga0495610_0000404
836 Ga0495618_0080264
837 Ga0495628_0016740
838 Ga0495631_0121345
839 Ga0495644_0000605
840 Ga0495648_0006282
841 Ga0495666_0001156
842 Ga0495642_0005457
843 Ga0495652_0013149
844 Ga0495665_0019374
845 Ga0495640_0018052
846 Ga0495586_0014069
847 Ga0495609_0019522
848 Ga0495621_0015002
849 Ga0495645_0000231
850 Ga0495645_0001708
851 Ga0495622_0014677
852 Ga0495667_0007018
853 Ga0495625_0057655
854 Ga0495625_0163256
855 Ga0495635_0006962
856 Ga0495588_0004233
857 Ga0495599_0014138
858 Ga0495599_0195915
859 Ga0495646_0002346
860 Ga0495669_0005308
861 Ga0495669_0010490
862 Ga0495669_0032230
863 Ga0495669_0051540
864 Ga0495613_0000700
865 Ga0495613_0012199
866 Ga0495624_0002596
867 Ga0495671_0022251
868 Ga0495649_0029406
869 Ga0495589_0002263
870 Ga0495581_0013142
871 Ga0495581_0148372
872 Ga0495636_0086486
873 Ga0495674_0014184
874 Ga0495672_0037443
875 Ga0495676_0029608
876 Ga0495676_0041762
877 Ga0495680_0006693
878 Ga0495683_0010589
879 Ga0495683_0043143
880 Ga0495687_007101
881 Ga0495687_041294
882 Ga0495675_0002174
883 Ga0495673_0011500
884 Ga0495673_0058188
885 Ga0495681_0012386
886 Ga0495684_0033211
887 Ga0495686_0121016
888 Ga0495593_0021592
889 Ga0495593_0028164
890 Ga0495593_0075067
891 Ga0495614_0000963
892 Ga0495614_0105876
893 Ga0496100_0017708
894 Ga0496101_0274616
895 Ga0496102_0074532
896 Ga0496102_0096896
897 Ga0496102_0102965
898 Ga0496102_0200903
899 Ga0496102_0205089
900 Ga0496103_0100724
901 Ga0496104_0000406
902 Ga0496104_0003010
903 Ga0496104_0009357
904 Ga0496104_0015099
905 Ga0496104_0017063
906 Ga0496104_0254307
907 Ga0496104_0325136
908 Ga0496105_0001047
909 Ga0496105_0004690
910 Ga0496105_0008980
911 Ga0496105_0027766
912 Ga0496105_0098643
913 Ga0496105_0200666
914 Ga0496106_0034458
915 Ga0496107_0042533
916 Ga0496108_0002003
917 Ga0496108_0028128
918 Ga0496109_0001337
919 Ga0496109_0012331
920 Ga0496109_0034899
921 Ga0496109_0134775
922 Ga0496110_0004175
923 Ga0496110_0043984
924 Ga0496110_0107547
925 Ga0496111_0007887
926 Ga0496111_0021665
927 Ga0496111_0029356
928 Ga0496111_0136853
929 Ga0496112_0001344
930 Ga0496112_0012523
931 Ga0496112_0060128
932 Ga0496112_0074063
933 Ga0496112_0140335
934 Ga0496112_0284856
935 Ga0496113_0003718
936 Ga0496113_0007339
937 Ga0496113_0025506
938 Ga0496113_0054287
939 Ga0496113_0078649
940 Ga0496113_0118789
941 Ga0496114_0004297
942 Ga0496114_0074200
943 Ga0496114_0165182
944 Ga0496114_0346521
945 Ga0496114_0400639
946 Ga0496115_0002089
947 Ga0496115_0010283
948 Ga0496115_0036572
949 Ga0496115_0066246
950 Ga0496116_0137214
951 Ga0496117_0000036
952 Ga0496117_0002472
953 Ga0496117_0017949
954 Ga0496117_0130898
955 Ga0496118_0000990
956 Ga0496118_0155092
957 Ga0496119_0012723
958 Ga0496120_0000036
959 Ga0496121_0000005
960 Ga0496121_0070553
961 Ga0496121_0073066
962 Ga0496121_0105273
963 Ga0496122_0000002
964 Ga0496122_0016734
965 Ga0496122_0051655
966 Ga0496123_0000002
967 Ga0496124_0000080
968 Ga0496124_0005551
969 Ga0496124_0070316
970 Ga0496124_0097604
971 Ga0496125_0000159
972 Ga0496126_0000734
973 Ga0496126_0176268
974 Ga0495682_0003424
975 Ga0495682_0004180
976 Ga0495682_0023138
977 Ga0501036_0045274
978 Ga0501036_0129926
979 Ga0501037_0021597
980 Ga0501038_0203995
981 Ga0501039_0001422
982 Ga0501039_0066483
983 Ga0501039_0233210
984 Ga0501040_0049808
985 Ga0501041_0002140
986 Ga0501042_0036746
987 Ga0501043_0011893
988 Ga0501046_0023901
989 Ga0501046_0095202
990 Ga0501048_0026841
991 Ga0501072_0014159
992 Ga0501072_0091602
993 Ga0501074_0126979
994 Ga0501075_0003293
995 Ga0501075_0053071
996 Ga0501076_0003274
997 Ga0501079_0085933
998 Ga0501080_0005820
999 Ga0501081_0000516
1000 Ga0501081_0001649
1001 Ga0501035_0306681
1002 nmdc:mga03683_21713_c1
1003 nmdc:mga03n38_43705_c1
1004 nmdc:mga03n38_60770_c1
1005 nmdc:mga00v17_19_c1
1006 nmdc:mga00v17_37632_c1
1007 nmdc:mga0yw44_110897_c1
1008 nmdc:mga0yw44_63705_c1
1009 nmdc:mga0k408_30771_c1
1010 nmdc:mga06z11_14215_c1
1011 nmdc:mga06z11_7960_c1
1012 nmdc:mga06z11_91576_c1
1013 nmdc:mga04h51_39259_c1
1014 nmdc:mga04h51_56716_c1
1015 nmdc:mga04h51_65123_c1
1016 nmdc:mga07m45_92448_c1
1017 nmdc:mga05p37_10912_c1
1018 nmdc:mga05p37_139979_c1
1019 nmdc:mga05p37_21649_c1
1020 nmdc:mga05p37_21875_c1
1021 nmdc:mga09592_1594_c1
1022 nmdc:mga09592_179399_c1
1023 nmdc:mga09592_18776_c1
1024 nmdc:mga09592_63037_c1
1025 nmdc:mga0qj67_134068_c1
1026 nmdc:mga0qj67_20_c1
1027 nmdc:mga0qj67_252_c1
1028 nmdc:mga0qj67_63182_c1
1029 nmdc:mga0qj67_6610_c1
1030 nmdc:mga06r32_16956_c1
1031 nmdc:mga06r32_200359_c1
1032 nmdc:mga08y16_165920_c1
1033 nmdc:mga08y16_28787_c1
1034 nmdc:mga08y16_3283_c1
1035 nmdc:mga0n895_6765_c1
1036 nmdc:mga0rr50_2920_c1
1037 nmdc:mga08x19_4603_c3
1038 nmdc:mga08x19_68006_c1
1039 nmdc:mga0a205_75160_c1
1040 nmdc:mga0sz30_1633_c1
1041 nmdc:mga0sz30_42148_c1
1042 nmdc:mga0sz30_70001_c1
1043 Ga0495601_0037111
1044 Ga0495612_0019557
1045 Ga0495619_0085500
1046 Ga0495619_0136818
1047 Ga0500651_0000002
1048 Ga0500560_000204
1049 Ga0500595_000012
1050 Ga0500595_020004
1051 Ga0500618_001007
1052 Ga0500561_0000036
1053 Ga0500604_0000777
1054 Ga0500616_0057974
1055 Ga0500624_000553
1056 Ga0500634_0000373
1057 Ga0500634_0003279
1058 Ga0500636_0000011
1059 Ga0500636_0000283
1060 Ga0501084_0023633
1061 Ga0501084_0046438
1062 Ga0500661_000530
1063 Ga0501082_0085318
1064 Ga0501082_0088701
1065 Ga0501082_0096941
1066 Ga0530510_0042441
1067 Ga0530510_0176938
1068 2515687161
1069 2537873473
1070 2554245852
1071 2559296382
1072 2599605569
1073 2601611764
1074 2601749505
1075 2643748305
1076 2643754626
1077 2643910918
1078 2643917661
1079 2643965888
1080 2644167345
1081 2644349861
1082 2644412166
1083 2644508158
1084 2644522816
1085 2757572245
1086 2808988600
1087 2819557822
1088 2821445651
1089 2838679780
1090 2838717450
1091 2838724349
1092 2838729334
1093 2840768355
1094 2841850761
1095 2841864050
1096 2842129566
1097 2842134711
1098 2842156771
1099 2842173029
1100 2842180389
1101 2842191952
1102 2842216268
1103 2842228988
1104 2842520832
1105 2899793634
1106 2899848727
1107 2919119204
1108 2919534350
1109 2921653993
1110 2926759235
1111 2926763328
1112 2929142961
1113 2933011376
1114 2933016555
1115 2933596052
1116 2945936508
1117 2979091639
1118 2979097160
1119 2979102863
1120 2984509248
1121 2984520053
1122 2984537577
1123 2984604325
1124 2990709582
1125 642425263
1126 650842775
1127 8003574810
1128 8054464679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06187

DUF993

Protein of unknown function (DUF993)

48

416

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dnh-assembly1.cif.gz_A crystal structure of hypothetical protein smc04132 from sinorhizobium meliloti 1021 0.9597 1 373
4dnh-assembly1.cif.gz_A crystal structure of hypothetical protein smc04132 from sinorhizobium meliloti 1021 0.9497 1 373
7lvl-assembly1.cif.gz_A dihydrodipicolinate synthase bound with allosteric inhibitor (s)-lysine from candidatus liberibacter solanacearum 0.8126 34 357
3nev-assembly1.cif.gz_C crystal structure of yage, a prophage protein from e. coli k12 in complex with kdgal 0.8117 34 354
7kpc-assembly1.cif.gz_D dihydrodipicolinate synthase (dhdps) from c.jejuni, e88q mutant with pyruvate bound in the active site and l-lysine bound at the allosteric site 0.8114 34 351
ID Description Score Start End Superfamily
4dnhA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9293 1 368 3.20.20.70
4dnhA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9171 1 368 3.20.20.70
af_P75682_5_302_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7965 34 354 3.20.20.70
3di0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7865 31 329 3.20.20.70
af_P75682_5_302_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7818 34 354 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A526URZ2-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9952 293 355
AF-A0A436JX64-F1-model_v4 deleted 0.9944 266 373
AF-A0A2V6UMI6-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9942 274 373
AF-A0A2N4XXX9-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9877 283 373
AF-A0A2W5QC32-F1-model_v4 Dihydrodipicolinate synthase family protein 0.981 300 373

Map