F464334

General Info

Members Datasets Scaffolds Average Seq Length
565 384 1130 115

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2970524798|2970529007
Length 134
Sequence IIIFGYAQWREEDMTVATSPQTASPSVPPIDGIFRALADPTRRRVVERLNRSPASVSELAQPFDMALPSFVEHLRVLEGCGLVHSEKAGRVRTYRLAPEPLKLAESWLAEQRALWERRLDQLDAYVMTLKEKDK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
151 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
152 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
153 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
193 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
255 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
261 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
262 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
267 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
268 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
269 2512875024
270 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
271 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
272 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
273 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
274 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
275 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
276 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
277 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
278 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
279 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
280 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
281 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
282 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
283 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
284 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
285 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
286 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
287 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
288 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
289 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
290 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
291 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
292 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
293 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
294 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
295 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
296 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
297 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
298 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
299 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
300 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
301 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
302 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
303 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
304 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
305 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
306 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
307 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
308 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
309 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
310 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
311 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
312 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
313 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
314 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
315 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
316 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
317 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
318 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
319 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
320 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
321 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
322 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
323 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
324 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
325 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
326 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
327 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
328 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
329 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
330 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
331 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
332 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
333 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
334 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
335 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
336 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
337 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
338 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
339 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
340 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
341 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
342 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
343 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
344 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
345 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
346 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
347 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
348 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
349 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
350 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
351 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
352 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
353 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
354 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
355 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
356 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
357 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
358 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
359 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
360 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
361 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
362 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
363 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
364 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
365 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
366 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
367 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
368 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
369 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
370 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
371 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
372 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
373 3004167301 Mesorhizobium loti 582 Isolate Unclassified
374 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
375 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
376 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
377 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
378 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
379 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
380 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
381 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
382 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
383 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
384 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.94
Metatranscriptomes 0
Isolates 21.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.99
Nodule 17.17
Rhizoplane 2.65
Rhizosphere 58.05
Stem 0
Stem Tuber 0
Unclassified 6.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10195603 3300001979 Bacteria 501
2 JGI24739J22299_10192473 3300001989 Bacteria 599
3 JGI25165J46597_1000016 3300003214 Bacteria 377866
4 Ga0055542_1000172 3300003762 Bacteria 80034
5 Ga0065704_10079924 3300005289 Unclassified 4047
6 Ga0065715_10437595 3300005293 Bacteria 840
7 Ga0070658_10521933 3300005327 Bacteria 1027
8 Ga0070676_10004641 3300005328 Bacteria 7256
9 Ga0070683_100236060 3300005329 Unclassified 1739
10 Ga0070690_100043614 3300005330 Bacteria 2845
11 Ga0070670_100254643 3300005331 Bacteria 1530
12 Ga0070677_10593923 3300005333 Bacteria 612
13 Ga0068869_100434289 3300005334 Bacteria 1086
14 Ga0070666_10009622 3300005335 Bacteria 6032
15 Ga0070666_10134421 3300005335 Bacteria 1720
16 Ga0070689_100110142 3300005340 Bacteria 2189
17 Ga0070689_101076382 3300005340 Bacteria 718
18 Ga0070668_100350062 3300005347 Bacteria 1250
19 Ga0070668_100566270 3300005347 Unclassified 990
20 Ga0070668_101062029 3300005347 Bacteria 730
21 Ga0070669_100920442 3300005353 Bacteria 747
22 Ga0070675_100007265 3300005354 Bacteria 8546
23 Ga0070675_100951267 3300005354 Bacteria 788
24 Ga0070675_100958374 3300005354 Bacteria 785
25 Ga0070671_100046594 3300005355 Bacteria 3606
26 Ga0070671_100121661 3300005355 Bacteria 2197
27 Ga0070674_100918380 3300005356 Bacteria 763
28 Ga0070659_100089716 3300005366 Bacteria 2462
29 Ga0070667_100007565 3300005367 Bacteria 9012
30 Ga0070667_101016132 3300005367 Bacteria 774
31 Ga0070667_102325545 3300005367 Bacteria 505
32 Ga0070663_100315012 3300005455 Bacteria 1256
33 Ga0070678_100009598 3300005456 Bacteria 5872
34 Ga0070681_10477278 3300005458 Bacteria 1160
35 Ga0070681_10567970 3300005458 Bacteria 1048
36 Ga0068867_100004874 3300005459 Bacteria 9447
37 Ga0070706_100050889 3300005467 Bacteria 3822
38 Ga0070706_100959708 3300005467 Bacteria 789
39 Ga0070684_101533354 3300005535 Bacteria 628
40 Ga0068853_100009790 3300005539 Bacteria 7736
41 Ga0068853_100152218 3300005539 Bacteria 2082
42 Ga0068853_100747910 3300005539 Bacteria 934
43 Ga0070672_100004907 3300005543 Bacteria 8800
44 Ga0070695_100620698 3300005545 Bacteria 851
45 Ga0070695_101396365 3300005545 Unclassified 581
46 Ga0070696_100221454 3300005546 Bacteria 1420
47 Ga0070665_100028490 3300005548 Bacteria 5624
48 Ga0070704_100207832 3300005549 Unclassified 1584
49 Ga0068855_100225116 3300005563 Bacteria 2102
50 Ga0068855_101513486 3300005563 Bacteria 689
51 Ga0068857_100007844 3300005577 Bacteria 9206
52 Ga0068857_102228687 3300005577 Bacteria 538
53 Ga0068856_101143853 3300005614 Bacteria 795
54 Ga0070702_101133844 3300005615 Unclassified 627
55 Ga0068852_100175522 3300005616 Bacteria 2012
56 Ga0068859_100155575 3300005617 Bacteria 2363
57 Ga0068859_100213471 3300005617 Bacteria 2016
58 Ga0068864_100007408 3300005618 Bacteria 9034
59 Ga0068864_100367631 3300005618 Unclassified 1360
60 Ga0068866_10114917 3300005718 Unclassified 1508
61 Ga0068861_101762318 3300005719 Bacteria 614
62 Ga0068870_10009071 3300005840 Bacteria 4505
63 Ga0068863_100064252 3300005841 Bacteria 3471
64 Ga0068863_100258004 3300005841 Unclassified 1685
65 Ga0068858_100025579 3300005842 Bacteria 5492
66 Ga0068858_100199918 3300005842 Bacteria 1890
67 Ga0068858_100291962 3300005842 Unclassified 1554
68 Ga0068858_100938407 3300005842 Bacteria 847
69 Ga0068860_100006112 3300005843 Bacteria 12110
70 Ga0068860_100013607 3300005843 Bacteria 7975
71 Ga0068860_100124056 3300005843 Unclassified 2475
72 Ga0068860_100283735 3300005843 Bacteria 1619
73 Ga0068862_100196144 3300005844 Bacteria 1819
74 Ga0068862_100524830 3300005844 Bacteria 1127
75 Ga0081455_10602368 3300005937 Bacteria 716
76 Ga0075365_10010622 3300006038 Bacteria 5375
77 Ga0075365_10011552 3300006038 Bacteria 5197
78 Ga0075365_10083877 3300006038 Bacteria 2162
79 Ga0075365_10155982 3300006038 Bacteria 1589
80 Ga0075365_10192328 3300006038 Bacteria 1428
81 Ga0075365_10229147 3300006038 Bacteria 1304
82 Ga0075365_10394381 3300006038 Bacteria 977
83 Ga0075365_10417795 3300006038 Bacteria 947
84 Ga0075368_10123415 3300006042 Bacteria 1074
85 Ga0075368_10304650 3300006042 Bacteria 688
86 Ga0075368_10398936 3300006042 Bacteria 604
87 Ga0075363_100114661 3300006048 Bacteria 1500
88 Ga0075364_10115826 3300006051 Bacteria 1791
89 Ga0075364_10354760 3300006051 Bacteria 1000
90 Ga0075364_10646453 3300006051 Bacteria 722
91 Ga0075362_10016284 3300006177 Bacteria 3041
92 Ga0075362_10026139 3300006177 Bacteria 2491
93 Ga0075362_10054880 3300006177 Bacteria 1792
94 Ga0075362_10136168 3300006177 Bacteria 1171
95 Ga0075362_10285990 3300006177 Bacteria 816
96 Ga0075367_10055496 3300006178 Bacteria 2351
97 Ga0075367_10103053 3300006178 Bacteria 1746
98 Ga0075367_10228070 3300006178 Bacteria 1166
99 Ga0075367_10477211 3300006178 Bacteria 791
100 Ga0075369_10004094 3300006186 Bacteria 5365
101 Ga0075369_10207651 3300006186 Bacteria 905
102 Ga0075369_10326044 3300006186 Bacteria 719
103 Ga0075366_10129952 3300006195 Bacteria 1520
104 Ga0075366_10133416 3300006195 Bacteria 1499
105 Ga0075366_10257512 3300006195 Bacteria 1065
106 Ga0075366_10609354 3300006195 Bacteria 677
107 Ga0097621_100011941 3300006237 Bacteria 6424
108 Ga0097621_101528807 3300006237 Bacteria 634
109 Ga0075370_10243353 3300006353 Bacteria 1065
110 Ga0075370_10246098 3300006353 Bacteria 1059
111 Ga0075370_10644535 3300006353 Bacteria 643
112 Ga0068871_100010536 3300006358 Bacteria 6753
113 Ga0068871_100076035 3300006358 Bacteria 2773
114 Ga0075428_100045172 3300006844 Bacteria 4841
115 Ga0075428_100118979 3300006844 Bacteria 2877
116 Ga0075428_100840968 3300006844 Bacteria 975
117 Ga0075430_100000987 3300006846 Bacteria 22451
118 Ga0075430_100507389 3300006846 Bacteria 995
119 Ga0075431_100007436 3300006847 Bacteria 10909
120 Ga0075431_100093249 3300006847 Bacteria 3108
121 Ga0075431_101925512 3300006847 Bacteria 547
122 Ga0075433_10087097 3300006852 Bacteria 2758
123 Ga0075434_100005931 3300006871 Bacteria 11178
124 Ga0075429_100003695 3300006880 Bacteria 13035
125 Ga0075429_100067171 3300006880 Bacteria 3120
126 Ga0075429_100790391 3300006880 Bacteria 831
127 Ga0075429_100871653 3300006880 Unclassified 788
128 Ga0068865_100006382 3300006881 Bacteria 7187
129 Ga0075436_100953843 3300006914 Bacteria 643
130 Ga0097620_100155571 3300006931 Bacteria 2363
131 Ga0097620_100213463 3300006931 Bacteria 2016
132 Ga0075435_101189982 3300007076 Bacteria 667
133 Ga0099795_10227851 3300007788 Bacteria 796
134 Ga0105251_10450926 3300009011 Unclassified 596
135 Ga0105240_10041488 3300009093 Bacteria 5873
136 Ga0105247_11223055 3300009101 Unclassified 599
137 Ga0114129_10013251 3300009147 Bacteria 11743
138 Ga0114129_10173444 3300009147 Bacteria 2938
139 Ga0114129_10450423 3300009147 Bacteria 1688
140 Ga0114129_11826534 3300009147 Bacteria 738
141 Ga0114129_12430833 3300009147 Bacteria 627
142 Ga0105243_10423399 3300009148 Bacteria 1243
143 Ga0105243_12393024 3300009148 Unclassified 566
144 Ga0105241_10013134 3300009174 Bacteria 6077
145 Ga0105241_10153764 3300009174 Bacteria 1884
146 Ga0105241_10524994 3300009174 Bacteria 1059
147 Ga0105248_10001222 3300009177 Bacteria 28675
148 Ga0105248_10214679 3300009177 Bacteria 2167
149 Ga0105248_10274189 3300009177 Bacteria 1899
150 Ga0105237_10027026 3300009545 Bacteria 5861
151 Ga0105237_10537599 3300009545 Bacteria 1175
152 Ga0105237_10572824 3300009545 Bacteria 1136
153 Ga0105237_11137840 3300009545 Bacteria 787
154 Ga0105238_10002917 3300009551 Bacteria 17078
155 Ga0105238_10652726 3300009551 Bacteria 1062
156 Ga0105238_11019382 3300009551 Bacteria 849
157 Ga0105249_10061692 3300009553 Bacteria 3441
158 Ga0105249_10338327 3300009553 Bacteria 1521
159 Ga0105249_11884673 3300009553 Bacteria 670
160 Ga0105249_12911190 3300009553 Bacteria 549
161 Ga0105239_10063343 3300010375 Bacteria 4060
162 Ga0105239_10101350 3300010375 Bacteria 3185
163 Ga0105239_11262766 3300010375 Bacteria 852
164 Ga0105239_11732074 3300010375 Bacteria 724
165 Ga0105239_12881395 3300010375 Bacteria 561
166 Ga0157370_10153410 3300013104 Bacteria 2143
167 Ga0157370_10638273 3300013104 Bacteria 974
168 Ga0157369_10153056 3300013105 Bacteria 2437
169 Ga0157369_10714163 3300013105 Bacteria 1032
170 Ga0157374_10003730 3300013296 Bacteria 12803
171 Ga0157374_11181262 3300013296 Unclassified 786
172 Ga0157374_11220324 3300013296 Bacteria 773
173 Ga0157378_10852950 3300013297 Bacteria 939
174 Ga0163162_10024800 3300013306 Bacteria 5925
175 Ga0163162_10193758 3300013306 Bacteria 2160
176 Ga0157372_10265707 3300013307 Bacteria 1992
177 Ga0157375_10131589 3300013308 Bacteria 2622
178 Ga0163163_11347715 3300014325 Bacteria 775
179 Ga0163163_11435874 3300014325 Bacteria 751
180 Ga0163163_12608712 3300014325 Bacteria 563
181 Ga0157377_11495523 3300014745 Bacteria 536
182 Ga0157379_10003011 3300014968 Bacteria 14227
183 Ga0157379_10381896 3300014968 Bacteria 1292
184 Ga0157376_10175529 3300014969 Bacteria 1954
185 Ga0157376_10732966 3300014969 Bacteria 996
186 Ga0209148_1000057 3300025254 Bacteria 360463
187 Ga0209233_1000068 3300025261 Bacteria 377969
188 Ga0209233_1038271 3300025261 Bacteria 1059
189 Ga0209455_1000240 3300025272 Bacteria 68476
190 Ga0207697_10007205 3300025315 Bacteria 4970
191 Ga0207682_10116111 3300025893 Bacteria 1183
192 Ga0207688_10692798 3300025901 Bacteria 644
193 Ga0207680_10023691 3300025903 Bacteria 3356
194 Ga0207680_10449502 3300025903 Bacteria 914
195 Ga0207647_10547454 3300025904 Bacteria 642
196 Ga0207645_10306472 3300025907 Bacteria 1058
197 Ga0207654_10022478 3300025911 Unclassified 3365
198 Ga0207654_10519744 3300025911 Bacteria 843
199 Ga0207654_10531290 3300025911 Bacteria 834
200 Ga0207695_10433692 3300025913 Bacteria 1198
201 Ga0207695_10812519 3300025913 Unclassified 815
202 Ga0207695_10934874 3300025913 Bacteria 747
203 Ga0207671_10008635 3300025914 Bacteria 8609
204 Ga0207681_10034544 3300025923 Bacteria 3325
205 Ga0207694_10051034 3300025924 Bacteria 3206
206 Ga0207694_10241127 3300025924 Bacteria 1477
207 Ga0207650_10031741 3300025925 Bacteria 3816
208 Ga0207659_10008074 3300025926 Bacteria 6516
209 Ga0207659_10577609 3300025926 Bacteria 957
210 Ga0207690_10214845 3300025932 Bacteria 1468
211 Ga0207670_10033884 3300025936 Bacteria 3295
212 Ga0207704_10101761 3300025938 Bacteria 1917
213 Ga0207691_10000328 3300025940 Bacteria 47302
214 Ga0207711_10015761 3300025941 Bacteria 6269
215 Ga0207711_10165119 3300025941 Bacteria 2006
216 Ga0207711_10180317 3300025941 Bacteria 1920
217 Ga0207711_11734275 3300025941 Unclassified 568
218 Ga0207661_10181718 3300025944 Unclassified 1838
219 Ga0207651_10007297 3300025960 Bacteria 5876
220 Ga0207712_10326018 3300025961 Bacteria 1269
221 Ga0207712_11764235 3300025961 Unclassified 555
222 Ga0207668_10014932 3300025972 Bacteria 4816
223 Ga0207668_10087046 3300025972 Bacteria 2284
224 Ga0207668_10846406 3300025972 Bacteria 812
225 Ga0207658_10006246 3300025986 Bacteria 8141
226 Ga0207658_10284028 3300025986 Bacteria 1420
227 Ga0207703_10017883 3300026035 Bacteria 5536
228 Ga0207703_10139067 3300026035 Bacteria 2105
229 Ga0207703_10217405 3300026035 Unclassified 1707
230 Ga0207639_10120441 3300026041 Bacteria 2155
231 Ga0207639_10800148 3300026041 Bacteria 878
232 Ga0207678_10753388 3300026067 Bacteria 859
233 Ga0207641_10012496 3300026088 Bacteria 6959
234 Ga0207641_10420170 3300026088 Bacteria 1287
235 Ga0207648_10001220 3300026089 Bacteria 28819
236 Ga0207676_10079807 3300026095 Bacteria 2654
237 Ga0207676_10165166 3300026095 Unclassified 1922
238 Ga0207674_10000920 3300026116 Bacteria 38313
239 Ga0207674_10990507 3300026116 Bacteria 810
240 Ga0207674_11036550 3300026116 Unclassified 790
241 Ga0207683_10000807 3300026121 Bacteria 28669
242 Ga0209813_10125120 3300027866 Bacteria 899
243 Ga0209813_10237355 3300027866 Bacteria 688
244 Ga0268266_10055814 3300028379 Bacteria 3396
245 Ga0268266_10174164 3300028379 Bacteria 1955
246 Ga0268266_11555298 3300028379 Bacteria 637
247 Ga0268264_10011189 3300028381 Bacteria 7411
248 Ga0268264_10203306 3300028381 Bacteria 1813
249 Ga0268264_11249735 3300028381 Bacteria 752
250 Ga0307405_11388519 3300031731 Unclassified 614
251 Ga0307413_10318731 3300031824 Bacteria 1187
252 Ga0307413_10891821 3300031824 Bacteria 755
253 Ga0307416_100194572 3300032002 Unclassified 1917
254 Ga0307415_100843640 3300032126 Unclassified 840
255 Ga0307415_101221566 3300032126 Bacteria 709
256 Ga0373944_0019077 3300035089 Bacteria 1965
257 Ga0373936_0115008 3300035113 Bacteria 1145
258 Ga0373945_0019775 3300035116 Bacteria 2300
259 Ga0373943_0088303 3300035170 Bacteria 1601
260 Ga0373946_0027960 3300035171 Bacteria 2234
261 Ga0373942_0140422 3300035207 Unclassified 769
262 Ga0373962_0389870 3300035242 Bacteria 511
263 Ga0373931_0266587 3300035691 Unclassified 1047
264 Ga0373931_0696684 3300035691 Bacteria 671
265 Ga0373931_0930464 3300035691 Bacteria 585
266 Ga0373935_0109556 3300035692 Bacteria 1831
267 Ga0373927_0025832 3300035695 Bacteria 3839
268 Ga0373927_0143638 3300035695 Unclassified 1562
269 Ga0373947_0083528 3300035725 Bacteria 1980
270 Ga0373925_0125637 3300037068 Bacteria 1995
271 Ga0395900_0202444 3300037418 Bacteria 2008
272 Ga0395900_0236455 3300037418 Bacteria 1835
273 Ga0395905_0148537 3300037471 Bacteria 2205
274 Ga0395905_0520744 3300037471 Bacteria 1090
275 Ga0395901_0088383 3300038443 Bacteria 3241
276 Ga0395901_0493964 3300038443 Bacteria 1247
277 Ga0451795_0098730 3300041456 Bacteria 744
278 Ga0451833_1481792 3300041491 Bacteria 605
279 Ga0451841_0049401 3300041498 Bacteria 547
280 Ga0451847_0674360 3300041503 Bacteria 636
281 Ga0451843_1316481 3300041509 Bacteria 1345
282 Ga0451853_2932347 3300041512 Bacteria 574
283 Ga0466963_0452201 3300044694 Unclassified 906
284 Ga0466959_0309020 3300045049 Bacteria 1082
285 Ga0466959_0622942 3300045049 Unclassified 725
286 Ga0451576_0140380 3300045051 Bacteria 2520
287 Ga0495603_0032915 3300046455 Bacteria 3119
288 Ga0495590_0065011 3300046457 Bacteria 1277
289 Ga0495629_1100620 3300046459 Bacteria 514
290 Ga0495638_0168596 3300046460 Bacteria 1258
291 Ga0495638_0337643 3300046460 Bacteria 800
292 Ga0495580_0649628 3300046472 Bacteria 694
293 Ga0495582_0090773 3300046473 Bacteria 1703
294 Ga0495639_0137386 3300046475 Bacteria 1173
295 Ga0495585_0084571 3300046492 Bacteria 1716
296 Ga0495594_0020793 3300046499 Bacteria 3498
297 Ga0495616_0291601 3300046513 Bacteria 691
298 Ga0495620_0277538 3300046515 Bacteria 638
299 Ga0495631_0322466 3300046518 Bacteria 657
300 Ga0495632_0093077 3300046519 Bacteria 1427
301 Ga0495637_0138414 3300046520 Bacteria 925
302 Ga0495666_0140448 3300046526 Bacteria 1126
303 Ga0495598_0023831 3300046537 Bacteria 1652
304 Ga0495621_0109329 3300046539 Bacteria 1059
305 Ga0495656_0047113 3300046615 Bacteria 1827
306 Ga0495668_0321127 3300046616 Bacteria 849
307 Ga0495634_0206834 3300046642 Bacteria 1217
308 Ga0495625_0045532 3300046660 Bacteria 3171
309 Ga0495588_0141669 3300046674 Bacteria 1270
310 Ga0495647_0321413 3300046681 Bacteria 700
311 Ga0495658_0387302 3300046683 Bacteria 890
312 Ga0495658_0696114 3300046683 Unclassified 651
313 Ga0495669_0077137 3300046684 Bacteria 1526
314 Ga0495613_0333293 3300046689 Bacteria 1045
315 Ga0495624_0132313 3300046690 Bacteria 1529
316 Ga0495670_0100235 3300046691 Bacteria 1491
317 Ga0495581_0327431 3300047315 Bacteria 895
318 Ga0495676_0052076 3300047321 Bacteria 3270
319 Ga0495684_0164393 3300047471 Bacteria 1654
320 Ga0495686_0341804 3300047472 Bacteria 816
321 Ga0495686_0401078 3300047472 Bacteria 736
322 Ga0495593_0187486 3300047673 Bacteria 1041
323 Ga0495615_0326514 3300048090 Bacteria 502
324 Ga0495626_0374504 3300048091 Bacteria 553
325 Ga0496101_0300666 3300048904 Bacteria 1257
326 Ga0496103_0700554 3300048906 Bacteria 642
327 Ga0496104_0137539 3300048907 Bacteria 2347
328 Ga0496104_0335579 3300048907 Bacteria 1425
329 Ga0496105_0106828 3300048908 Bacteria 2311
330 Ga0496106_0750865 3300048909 Bacteria 776
331 Ga0496107_0120890 3300048910 Bacteria 1929
332 Ga0496108_0377546 3300048911 Bacteria 1238
333 Ga0496110_1088314 3300048913 Unclassified 707
334 Ga0496114_1067136 3300048917 Unclassified 692
335 Ga0496115_0283856 3300048918 Bacteria 1359
336 Ga0496115_0328263 3300048918 Bacteria 1250
337 Ga0496115_1440761 3300048918 Bacteria 507
338 Ga0496119_0023858 3300048922 Bacteria 4323
339 Ga0496119_0105353 3300048922 Bacteria 1575
340 Ga0496120_0002038 3300048923 Bacteria 21901
341 Ga0496121_0400809 3300048924 Bacteria 899
342 Ga0496125_0059505 3300048928 Bacteria 3078
343 Ga0496126_0072915 3300048929 Plasmid 3053
344 Ga0496126_0515968 3300048929 Bacteria 953
345 Ga0501032_0170746 3300049569 Bacteria 1426
346 Ga0501033_0012011 3300049570 Bacteria 6615
347 Ga0501034_0378986 3300049571 Bacteria 1340
348 Ga0501034_0997027 3300049571 Bacteria 722
349 Ga0501034_1368940 3300049571 Unclassified 583
350 Ga0501036_0018128 3300049572 Bacteria 5894
351 Ga0501037_1001182 3300049573 Bacteria 544
352 Ga0501038_0033554 3300049574 Bacteria 4521
353 Ga0501040_0057575 3300049576 Bacteria 2668
354 Ga0501041_0074248 3300049577 Bacteria 2089
355 Ga0501042_0020709 3300049578 Bacteria 4578
356 Ga0501046_0010995 3300049580 Bacteria 7759
357 Ga0501048_0034745 3300049582 Bacteria 3634
358 Ga0501071_0095260 3300049587 Bacteria 2190
359 Ga0501072_0040309 3300049588 Bacteria 3667
360 Ga0501073_0014169 3300049589 Bacteria 5789
361 Ga0501074_0186084 3300049590 Bacteria 1481
362 Ga0501075_0020152 3300049591 Bacteria 4845
363 Ga0501076_0004321 3300049592 Bacteria 10078
364 Ga0501076_1715801 3300049592 Bacteria 515
365 Ga0501077_0126303 3300049593 Bacteria 1621
366 Ga0501079_0035305 3300049741 Bacteria 3848
367 Ga0501080_0366581 3300049742 Bacteria 1299
368 Ga0501081_0157548 3300049743 Bacteria 1634
369 Ga0501083_0077308 3300049744 Bacteria 2209
370 Ga0501083_0660106 3300049744 Bacteria 680
371 Ga0501035_0355064 3300049822 Bacteria 1226
372 Ga0501045_0020458 3300049824 Bacteria 4726
373 nmdc:mga03683_152792_c1 3300050489 Bacteria 1042
374 nmdc:mga03683_265784_c1 3300050489 Bacteria 799
375 nmdc:mga03683_364460_c1 3300050489 Bacteria 686
376 nmdc:mga03683_413365_c1 3300050489 Bacteria 645
377 nmdc:mga03683_42642_c1 3300050489 Bacteria 1868
378 nmdc:mga03683_43084_c1 3300050489 Bacteria 1860
379 nmdc:mga03n38_29837_c1 3300050490 Bacteria 2286
380 nmdc:mga03n38_316954_c1 3300050490 Bacteria 841
381 nmdc:mga03n38_43019_c1 3300050490 Bacteria 1978
382 nmdc:mga00v17_106451_c1 3300050491 Bacteria 1775
383 nmdc:mga00v17_505690_c1 3300050491 Bacteria 783
384 nmdc:mga00v17_741770_c1 3300050491 Bacteria 628
385 nmdc:mga0yw44_1230611_c1 3300050492 Bacteria 505
386 nmdc:mga0yw44_302171_c1 3300050492 Bacteria 1072
387 nmdc:mga0yw44_331948_c1 3300050492 Bacteria 1022
388 nmdc:mga0yw44_3617_c1 3300050492 Bacteria 6897
389 nmdc:mga0yw44_440275_c1 3300050492 Bacteria 883
390 nmdc:mga0yw44_48924_c1 3300050492 Bacteria 2550
391 nmdc:mga0yw44_52111_c1 3300050492 Bacteria 2480
392 nmdc:mga0yw44_528426_c1 3300050492 Bacteria 801
393 nmdc:mga0k408_125982_c1 3300050493 Bacteria 1519
394 nmdc:mga0k408_521151_c1 3300050493 Bacteria 704
395 nmdc:mga0k408_77766_c1 3300050493 Bacteria 1079
396 nmdc:mga0k408_783368_c1 3300050493 Bacteria 556
397 nmdc:mga06z11_166548_c1 3300050494 Bacteria 1263
398 nmdc:mga06z11_231058_c1 3300050494 Bacteria 1084
399 nmdc:mga06z11_608331_c1 3300050494 Bacteria 665
400 nmdc:mga06z11_666556_c1 3300050494 Bacteria 633
401 nmdc:mga06z11_693302_c1 3300050494 Bacteria 620
402 nmdc:mga06z11_946908_c1 3300050494 Bacteria 525
403 nmdc:mga04h51_138917_c1 3300050495 Bacteria 920
404 nmdc:mga07m45_186945_c1 3300050496 Bacteria 1204
405 nmdc:mga07m45_21663_c1 3300050496 Bacteria 3501
406 nmdc:mga07m45_488220_c1 3300050496 Bacteria 713
407 nmdc:mga07m45_71126_c1 3300050496 Bacteria 1077
408 nmdc:mga07m45_79785_c1 3300050496 Bacteria 1868
409 nmdc:mga05p37_1232224_c1 3300050507 Bacteria 770
410 nmdc:mga05p37_18584_c1 3300050507 Bacteria 8401
411 nmdc:mga09592_39424_c1 3300050508 Bacteria 3968
412 nmdc:mga09592_55343_c1 3300050508 Bacteria 3353
413 nmdc:mga09592_737205_c1 3300050508 Unclassified 837
414 nmdc:mga0qj67_3566_c1 3300050509 Bacteria 11233
415 nmdc:mga0qj67_478655_c1 3300050509 Bacteria 1002
416 nmdc:mga06r32_1044_c1 3300050510 Bacteria 24972
417 nmdc:mga06r32_304853_c1 3300050510 Bacteria 1578
418 nmdc:mga06r32_448872_c1 3300050510 Bacteria 1269
419 nmdc:mga0n895_2943_c1 3300050512 Bacteria 13510
420 nmdc:mga0rr50_1128461_c1 3300050513 Bacteria 667
421 nmdc:mga0a205_129809_c1 3300050515 Bacteria 2421
422 nmdc:mga0sz30_10879_c1 3300050516 Bacteria 3498
423 nmdc:mga0sz30_17471_c1 3300050516 Bacteria 2861
424 nmdc:mga0sz30_84234_c1 3300050516 Bacteria 1378
425 Ga0500610_0148667 3300053079 Bacteria 1176
426 Ga0495655_0016524 3300053083 Bacteria 1591
427 Ga0495655_0322059 3300053083 Bacteria 536
428 Ga0495619_0101780 3300053085 Bacteria 1956
429 Ga0500643_057043 3300053087 Bacteria 1103
430 Ga0500651_0675196 3300053093 Bacteria 554
431 Ga0500555_004132 3300053103 Bacteria 4130
432 Ga0500592_031971 3300053116 Bacteria 849
433 Ga0500595_053821 3300053119 Bacteria 1238
434 Ga0500658_0261418 3300053134 Bacteria 796
435 Ga0500604_0019073 3300053151 Bacteria 1917
436 Ga0500604_0082255 3300053151 Bacteria 1042
437 Ga0500616_0112006 3300053153 Bacteria 1317
438 Ga0500620_000301 3300053155 Bacteria 9422
439 Ga0500627_0038343 3300053158 Bacteria 2048
440 Ga0500627_0052658 3300053158 Bacteria 1777
441 Ga0500627_0135299 3300053158 Bacteria 1113
442 Ga0500611_008828 3300053727 Bacteria 1575
443 Ga0501084_0013582 3300054114 Bacteria 6739
444 Ga0501082_0036442 3300060353 Bacteria 4238
445 Ga0501082_0068914 3300060353 Bacteria 3046
446 Ga0530510_0017143 3300061734 Bacteria 5130
447 2970529007 2970524798 Bacteria 6840927
448 2509398114 2509276022 Bacteria 6200534
449 2510316691 2510065059 Bacteria 6847884
450 2512964230 2512875024 Bacteria 7195110
451 2513608030 2513237090 Bacteria 7096802
452 2514423199 2513237305 Bacteria 7293571
453 2597815712 2597489875 Bacteria 7010078
454 2599938572 2599185301 Bacteria 6161860
455 2643986181 2643221595 Bacteria 6565519
456 2644152412 2643221627 Bacteria 6761570
457 2673164467 2671180531 Bacteria 9045424
458 2687235960 2684623219 Bacteria 8442773
459 2694632694 2693429783 Bacteria 7019804
460 2694639577 2693429784 Bacteria 7241525
461 2723577789 2721755686 Bacteria 7343952
462 2776272381 2775506902 Bacteria 6208009
463 2776284321 2775506904 Bacteria 5954060
464 2792753041 2791355123 Bacteria 8049106
465 2839994389 2839993093 Bacteria 5512535
466 2841735173 2841734538 Bacteria 6784580
467 2844005387 2844002411 Bacteria 7168230
468 2844015839 2844009547 Bacteria 6728125
469 2856326542 2856320880 Bacteria 7263508
470 2856349378 2856342000 Bacteria 7176905
471 2856354703 2856349417 Bacteria 6230045
472 2869163120 2869162929 Bacteria 6399702
473 2869175614 2869169390 Bacteria 6659796
474 2869236320 2869234852 Bacteria 6654993
475 2869246090 2869242130 Bacteria 6609239
476 2869261404 2869256925 Bacteria 6981691
477 2869280344 2869278585 Bacteria 7077053
478 2871437284 2871435913 Bacteria 6880295
479 2871456185 2871451962 Bacteria 7336357
480 2871467650 2871466892 Bacteria 6923287
481 2871481377 2871474448 Bacteria 6806570
482 2871483350 2871481445 Bacteria 6700002
483 2874110372 2874109183 Bacteria 6517025
484 2874117326 2874116593 Bacteria 6674494
485 2874126598 2874123672 Bacteria 7238285
486 2874144453 2874139085 Bacteria 7021506
487 2874173761 2874168670 Bacteria 8062617
488 2874619534 2874612657 Bacteria 8252029
489 2876384515 2876377896 Bacteria 6565995
490 2876392247 2876386047 Bacteria 6698674
491 2878736846 2878730984 Bacteria 6380721
492 2878744172 2878738818 Bacteria 7136951
493 2878792593 2878788777 Bacteria 6567085
494 2881154129 2881147464 Bacteria 7779814
495 2881157865 2881155292 Bacteria 6461656
496 2881858653 2881853255 Bacteria 6698367
497 2882639943 2882632389 Bacteria 8154593
498 2883293421 2883291878 Bacteria 5894118
499 2885312159 2885305155 Bacteria 7348390
500 2885315763 2885312484 Bacteria 6415165
501 2885326809 2885326080 Bacteria 7134805
502 2885339072 2885334103 Bacteria 7216818
503 2885344127 2885342637 Bacteria 7011821
504 2885351789 2885350715 Bacteria 6787678
505 2888341887 2888337043 Bacteria 6629336
506 2888349192 2888343758 Bacteria 6611049
507 2894655246 2894652903 Bacteria 4587256
508 2903515843 2903513507 Bacteria 6344008
509 2906381980 2906378014 Bacteria 6911440
510 2906405518 2906401398 Bacteria 6693206
511 2924710936 2924710171 Bacteria 6752351
512 2924722664 2924718760 Bacteria 6331356
513 2924738686 2924733363 Bacteria 7574837
514 2924741858 2924741084 Bacteria 6661321
515 2924756318 2924754689 Bacteria 6774424
516 2924766190 2924762789 Bacteria 6561353
517 2924782089 2924776078 Bacteria 7492003
518 2929202226 2929199973 Bacteria 7260745
519 2937828576 2937822353 Bacteria 7290551
520 2937840389 2937836603 Bacteria 6811263
521 2937863187 2937861824 Bacteria 6660327
522 2937877783 2937877337 Bacteria 7246526
523 2937977853 2937972304 Bacteria 7532020
524 2937980998 2937980651 Bacteria 6517427
525 2938019998 2938014810 Bacteria 6700592
526 2958036213 2958034702 Bacteria 6989922
527 2958047637 2958041894 Bacteria 13082850
528 2958075827 2958071322 Bacteria 6815895
529 2958084891 2958084443 Bacteria 7312792
530 2958093144 2958092219 Bacteria 6861151
531 2958112304 2958108152 Bacteria 6681128
532 2958146114 2958144490 Bacteria 6677056
533 2961133733 2961127735 Bacteria 7196641
534 2961184993 2961183825 Bacteria 6688536
535 2968022149 2968016561 Bacteria 7022047
536 2968144677 2968138860 Bacteria 6605449
537 2970474739 2970469710 Bacteria 6969209
538 2970494405 2970489779 Bacteria 6517260
539 2970510769 2970510686 Bacteria 7006402
540 2970537901 2970532167 Bacteria 6553173
541 2970543789 2970540015 Bacteria 6977556
542 2970594942 2970593180 Bacteria 7073582
543 2970626718 2970619444 Bacteria 6986144
544 2970630210 2970627176 Bacteria 6680862
545 2977857515 2977851361 Bacteria 6694324
546 2977898677 2977898635 Bacteria 6675551
547 2977909865 2977907340 Bacteria 6577984
548 2979768462 2979764755 Bacteria 6610066
549 2979775241 2979772303 Bacteria 6618277
550 2987670730 2987666974 Bacteria 6509233
551 2996354149 2996348954 Bacteria 7239054
552 2996387430 2996386984 Bacteria 6978667
553 3002142868 3002141150 Bacteria 5254435
554 3004171333 3004167301 Bacteria 8330599
555 3004233375 3004232784 Bacteria 6662140
556 3004249118 3004248173 Bacteria 6563236
557 3004270400 3004268573 Bacteria 7043476
558 3004280817 3004275668 Bacteria 7114440
559 3004291637 3004289098 Bacteria 6135450
560 8004319899 8004312739 Bacteria 7444653
561 8004396702 8004395343 Bacteria 6620908
562 8004638885 8004633249 Bacteria 6723080
563 8004728046 8004727605 Bacteria 6643904
564 8055623609 8055617313 Bacteria 7548464
565 8055916643 8055909800 Bacteria 7278581
566 JGI24740J21852_10195603
567 JGI24739J22299_10192473
568 JGI25165J46597_1000016
569 Ga0055542_1000172
570 Ga0065704_10079924
571 Ga0065715_10437595
572 Ga0070658_10521933
573 Ga0070676_10004641
574 Ga0070683_100236060
575 Ga0070690_100043614
576 Ga0070670_100254643
577 Ga0070677_10593923
578 Ga0068869_100434289
579 Ga0070666_10009622
580 Ga0070666_10134421
581 Ga0070689_100110142
582 Ga0070689_101076382
583 Ga0070668_100350062
584 Ga0070668_100566270
585 Ga0070668_101062029
586 Ga0070669_100920442
587 Ga0070675_100007265
588 Ga0070675_100951267
589 Ga0070675_100958374
590 Ga0070671_100046594
591 Ga0070671_100121661
592 Ga0070674_100918380
593 Ga0070659_100089716
594 Ga0070667_100007565
595 Ga0070667_101016132
596 Ga0070667_102325545
597 Ga0070663_100315012
598 Ga0070678_100009598
599 Ga0070681_10477278
600 Ga0070681_10567970
601 Ga0068867_100004874
602 Ga0070706_100050889
603 Ga0070706_100959708
604 Ga0070684_101533354
605 Ga0068853_100009790
606 Ga0068853_100152218
607 Ga0068853_100747910
608 Ga0070672_100004907
609 Ga0070695_100620698
610 Ga0070695_101396365
611 Ga0070696_100221454
612 Ga0070665_100028490
613 Ga0070704_100207832
614 Ga0068855_100225116
615 Ga0068855_101513486
616 Ga0068857_100007844
617 Ga0068857_102228687
618 Ga0068856_101143853
619 Ga0070702_101133844
620 Ga0068852_100175522
621 Ga0068859_100155575
622 Ga0068859_100213471
623 Ga0068864_100007408
624 Ga0068864_100367631
625 Ga0068866_10114917
626 Ga0068861_101762318
627 Ga0068870_10009071
628 Ga0068863_100064252
629 Ga0068863_100258004
630 Ga0068858_100025579
631 Ga0068858_100199918
632 Ga0068858_100291962
633 Ga0068858_100938407
634 Ga0068860_100006112
635 Ga0068860_100013607
636 Ga0068860_100124056
637 Ga0068860_100283735
638 Ga0068862_100196144
639 Ga0068862_100524830
640 Ga0081455_10602368
641 Ga0075365_10010622
642 Ga0075365_10011552
643 Ga0075365_10083877
644 Ga0075365_10155982
645 Ga0075365_10192328
646 Ga0075365_10229147
647 Ga0075365_10394381
648 Ga0075365_10417795
649 Ga0075368_10123415
650 Ga0075368_10304650
651 Ga0075368_10398936
652 Ga0075363_100114661
653 Ga0075364_10115826
654 Ga0075364_10354760
655 Ga0075364_10646453
656 Ga0075362_10016284
657 Ga0075362_10026139
658 Ga0075362_10054880
659 Ga0075362_10136168
660 Ga0075362_10285990
661 Ga0075367_10055496
662 Ga0075367_10103053
663 Ga0075367_10228070
664 Ga0075367_10477211
665 Ga0075369_10004094
666 Ga0075369_10207651
667 Ga0075369_10326044
668 Ga0075366_10129952
669 Ga0075366_10133416
670 Ga0075366_10257512
671 Ga0075366_10609354
672 Ga0097621_100011941
673 Ga0097621_101528807
674 Ga0075370_10243353
675 Ga0075370_10246098
676 Ga0075370_10644535
677 Ga0068871_100010536
678 Ga0068871_100076035
679 Ga0075428_100045172
680 Ga0075428_100118979
681 Ga0075428_100840968
682 Ga0075430_100000987
683 Ga0075430_100507389
684 Ga0075431_100007436
685 Ga0075431_100093249
686 Ga0075431_101925512
687 Ga0075433_10087097
688 Ga0075434_100005931
689 Ga0075429_100003695
690 Ga0075429_100067171
691 Ga0075429_100790391
692 Ga0075429_100871653
693 Ga0068865_100006382
694 Ga0075436_100953843
695 Ga0097620_100155571
696 Ga0097620_100213463
697 Ga0075435_101189982
698 Ga0099795_10227851
699 Ga0105251_10450926
700 Ga0105240_10041488
701 Ga0105247_11223055
702 Ga0114129_10013251
703 Ga0114129_10173444
704 Ga0114129_10450423
705 Ga0114129_11826534
706 Ga0114129_12430833
707 Ga0105243_10423399
708 Ga0105243_12393024
709 Ga0105241_10013134
710 Ga0105241_10153764
711 Ga0105241_10524994
712 Ga0105248_10001222
713 Ga0105248_10214679
714 Ga0105248_10274189
715 Ga0105237_10027026
716 Ga0105237_10537599
717 Ga0105237_10572824
718 Ga0105237_11137840
719 Ga0105238_10002917
720 Ga0105238_10652726
721 Ga0105238_11019382
722 Ga0105249_10061692
723 Ga0105249_10338327
724 Ga0105249_11884673
725 Ga0105249_12911190
726 Ga0105239_10063343
727 Ga0105239_10101350
728 Ga0105239_11262766
729 Ga0105239_11732074
730 Ga0105239_12881395
731 Ga0157370_10153410
732 Ga0157370_10638273
733 Ga0157369_10153056
734 Ga0157369_10714163
735 Ga0157374_10003730
736 Ga0157374_11181262
737 Ga0157374_11220324
738 Ga0157378_10852950
739 Ga0163162_10024800
740 Ga0163162_10193758
741 Ga0157372_10265707
742 Ga0157375_10131589
743 Ga0163163_11347715
744 Ga0163163_11435874
745 Ga0163163_12608712
746 Ga0157377_11495523
747 Ga0157379_10003011
748 Ga0157379_10381896
749 Ga0157376_10175529
750 Ga0157376_10732966
751 Ga0209148_1000057
752 Ga0209233_1000068
753 Ga0209233_1038271
754 Ga0209455_1000240
755 Ga0207697_10007205
756 Ga0207682_10116111
757 Ga0207688_10692798
758 Ga0207680_10023691
759 Ga0207680_10449502
760 Ga0207647_10547454
761 Ga0207645_10306472
762 Ga0207654_10022478
763 Ga0207654_10519744
764 Ga0207654_10531290
765 Ga0207695_10433692
766 Ga0207695_10812519
767 Ga0207695_10934874
768 Ga0207671_10008635
769 Ga0207681_10034544
770 Ga0207694_10051034
771 Ga0207694_10241127
772 Ga0207650_10031741
773 Ga0207659_10008074
774 Ga0207659_10577609
775 Ga0207690_10214845
776 Ga0207670_10033884
777 Ga0207704_10101761
778 Ga0207691_10000328
779 Ga0207711_10015761
780 Ga0207711_10165119
781 Ga0207711_10180317
782 Ga0207711_11734275
783 Ga0207661_10181718
784 Ga0207651_10007297
785 Ga0207712_10326018
786 Ga0207712_11764235
787 Ga0207668_10014932
788 Ga0207668_10087046
789 Ga0207668_10846406
790 Ga0207658_10006246
791 Ga0207658_10284028
792 Ga0207703_10017883
793 Ga0207703_10139067
794 Ga0207703_10217405
795 Ga0207639_10120441
796 Ga0207639_10800148
797 Ga0207678_10753388
798 Ga0207641_10012496
799 Ga0207641_10420170
800 Ga0207648_10001220
801 Ga0207676_10079807
802 Ga0207676_10165166
803 Ga0207674_10000920
804 Ga0207674_10990507
805 Ga0207674_11036550
806 Ga0207683_10000807
807 Ga0209813_10125120
808 Ga0209813_10237355
809 Ga0268266_10055814
810 Ga0268266_10174164
811 Ga0268266_11555298
812 Ga0268264_10011189
813 Ga0268264_10203306
814 Ga0268264_11249735
815 Ga0307405_11388519
816 Ga0307413_10318731
817 Ga0307413_10891821
818 Ga0307416_100194572
819 Ga0307415_100843640
820 Ga0307415_101221566
821 Ga0373944_0019077
822 Ga0373936_0115008
823 Ga0373945_0019775
824 Ga0373943_0088303
825 Ga0373946_0027960
826 Ga0373942_0140422
827 Ga0373962_0389870
828 Ga0373931_0266587
829 Ga0373931_0696684
830 Ga0373931_0930464
831 Ga0373935_0109556
832 Ga0373927_0025832
833 Ga0373927_0143638
834 Ga0373947_0083528
835 Ga0373925_0125637
836 Ga0395900_0202444
837 Ga0395900_0236455
838 Ga0395905_0148537
839 Ga0395905_0520744
840 Ga0395901_0088383
841 Ga0395901_0493964
842 Ga0451795_0098730
843 Ga0451833_1481792
844 Ga0451841_0049401
845 Ga0451847_0674360
846 Ga0451843_1316481
847 Ga0451853_2932347
848 Ga0466963_0452201
849 Ga0466959_0309020
850 Ga0466959_0622942
851 Ga0451576_0140380
852 Ga0495603_0032915
853 Ga0495590_0065011
854 Ga0495629_1100620
855 Ga0495638_0168596
856 Ga0495638_0337643
857 Ga0495580_0649628
858 Ga0495582_0090773
859 Ga0495639_0137386
860 Ga0495585_0084571
861 Ga0495594_0020793
862 Ga0495616_0291601
863 Ga0495620_0277538
864 Ga0495631_0322466
865 Ga0495632_0093077
866 Ga0495637_0138414
867 Ga0495666_0140448
868 Ga0495598_0023831
869 Ga0495621_0109329
870 Ga0495656_0047113
871 Ga0495668_0321127
872 Ga0495634_0206834
873 Ga0495625_0045532
874 Ga0495588_0141669
875 Ga0495647_0321413
876 Ga0495658_0387302
877 Ga0495658_0696114
878 Ga0495669_0077137
879 Ga0495613_0333293
880 Ga0495624_0132313
881 Ga0495670_0100235
882 Ga0495581_0327431
883 Ga0495676_0052076
884 Ga0495684_0164393
885 Ga0495686_0341804
886 Ga0495686_0401078
887 Ga0495593_0187486
888 Ga0495615_0326514
889 Ga0495626_0374504
890 Ga0496101_0300666
891 Ga0496103_0700554
892 Ga0496104_0137539
893 Ga0496104_0335579
894 Ga0496105_0106828
895 Ga0496106_0750865
896 Ga0496107_0120890
897 Ga0496108_0377546
898 Ga0496110_1088314
899 Ga0496114_1067136
900 Ga0496115_0283856
901 Ga0496115_0328263
902 Ga0496115_1440761
903 Ga0496119_0023858
904 Ga0496119_0105353
905 Ga0496120_0002038
906 Ga0496121_0400809
907 Ga0496125_0059505
908 Ga0496126_0072915
909 Ga0496126_0515968
910 Ga0501032_0170746
911 Ga0501033_0012011
912 Ga0501034_0378986
913 Ga0501034_0997027
914 Ga0501034_1368940
915 Ga0501036_0018128
916 Ga0501037_1001182
917 Ga0501038_0033554
918 Ga0501040_0057575
919 Ga0501041_0074248
920 Ga0501042_0020709
921 Ga0501046_0010995
922 Ga0501048_0034745
923 Ga0501071_0095260
924 Ga0501072_0040309
925 Ga0501073_0014169
926 Ga0501074_0186084
927 Ga0501075_0020152
928 Ga0501076_0004321
929 Ga0501076_1715801
930 Ga0501077_0126303
931 Ga0501079_0035305
932 Ga0501080_0366581
933 Ga0501081_0157548
934 Ga0501083_0077308
935 Ga0501083_0660106
936 Ga0501035_0355064
937 Ga0501045_0020458
938 nmdc:mga03683_152792_c1
939 nmdc:mga03683_265784_c1
940 nmdc:mga03683_364460_c1
941 nmdc:mga03683_413365_c1
942 nmdc:mga03683_42642_c1
943 nmdc:mga03683_43084_c1
944 nmdc:mga03n38_29837_c1
945 nmdc:mga03n38_316954_c1
946 nmdc:mga03n38_43019_c1
947 nmdc:mga00v17_106451_c1
948 nmdc:mga00v17_505690_c1
949 nmdc:mga00v17_741770_c1
950 nmdc:mga0yw44_1230611_c1
951 nmdc:mga0yw44_302171_c1
952 nmdc:mga0yw44_331948_c1
953 nmdc:mga0yw44_3617_c1
954 nmdc:mga0yw44_440275_c1
955 nmdc:mga0yw44_48924_c1
956 nmdc:mga0yw44_52111_c1
957 nmdc:mga0yw44_528426_c1
958 nmdc:mga0k408_125982_c1
959 nmdc:mga0k408_521151_c1
960 nmdc:mga0k408_77766_c1
961 nmdc:mga0k408_783368_c1
962 nmdc:mga06z11_166548_c1
963 nmdc:mga06z11_231058_c1
964 nmdc:mga06z11_608331_c1
965 nmdc:mga06z11_666556_c1
966 nmdc:mga06z11_693302_c1
967 nmdc:mga06z11_946908_c1
968 nmdc:mga04h51_138917_c1
969 nmdc:mga07m45_186945_c1
970 nmdc:mga07m45_21663_c1
971 nmdc:mga07m45_488220_c1
972 nmdc:mga07m45_71126_c1
973 nmdc:mga07m45_79785_c1
974 nmdc:mga05p37_1232224_c1
975 nmdc:mga05p37_18584_c1
976 nmdc:mga09592_39424_c1
977 nmdc:mga09592_55343_c1
978 nmdc:mga09592_737205_c1
979 nmdc:mga0qj67_3566_c1
980 nmdc:mga0qj67_478655_c1
981 nmdc:mga06r32_1044_c1
982 nmdc:mga06r32_304853_c1
983 nmdc:mga06r32_448872_c1
984 nmdc:mga0n895_2943_c1
985 nmdc:mga0rr50_1128461_c1
986 nmdc:mga0a205_129809_c1
987 nmdc:mga0sz30_10879_c1
988 nmdc:mga0sz30_17471_c1
989 nmdc:mga0sz30_84234_c1
990 Ga0500610_0148667
991 Ga0495655_0016524
992 Ga0495655_0322059
993 Ga0495619_0101780
994 Ga0500643_057043
995 Ga0500651_0675196
996 Ga0500555_004132
997 Ga0500592_031971
998 Ga0500595_053821
999 Ga0500658_0261418
1000 Ga0500604_0019073
1001 Ga0500604_0082255
1002 Ga0500616_0112006
1003 Ga0500620_000301
1004 Ga0500627_0038343
1005 Ga0500627_0052658
1006 Ga0500627_0135299
1007 Ga0500611_008828
1008 Ga0501084_0013582
1009 Ga0501082_0036442
1010 Ga0501082_0068914
1011 Ga0530510_0017143
1012 2970529007
1013 2509398114
1014 2510316691
1015 2512964230
1016 2513608030
1017 2514423199
1018 2597815712
1019 2599938572
1020 2643986181
1021 2644152412
1022 2673164467
1023 2687235960
1024 2694632694
1025 2694639577
1026 2723577789
1027 2776272381
1028 2776284321
1029 2792753041
1030 2839994389
1031 2841735173
1032 2844005387
1033 2844015839
1034 2856326542
1035 2856349378
1036 2856354703
1037 2869163120
1038 2869175614
1039 2869236320
1040 2869246090
1041 2869261404
1042 2869280344
1043 2871437284
1044 2871456185
1045 2871467650
1046 2871481377
1047 2871483350
1048 2874110372
1049 2874117326
1050 2874126598
1051 2874144453
1052 2874173761
1053 2874619534
1054 2876384515
1055 2876392247
1056 2878736846
1057 2878744172
1058 2878792593
1059 2881154129
1060 2881157865
1061 2881858653
1062 2882639943
1063 2883293421
1064 2885312159
1065 2885315763
1066 2885326809
1067 2885339072
1068 2885344127
1069 2885351789
1070 2888341887
1071 2888349192
1072 2894655246
1073 2903515843
1074 2906381980
1075 2906405518
1076 2924710936
1077 2924722664
1078 2924738686
1079 2924741858
1080 2924756318
1081 2924766190
1082 2924782089
1083 2929202226
1084 2937828576
1085 2937840389
1086 2937863187
1087 2937877783
1088 2937977853
1089 2937980998
1090 2938019998
1091 2958036213
1092 2958047637
1093 2958075827
1094 2958084891
1095 2958093144
1096 2958112304
1097 2958146114
1098 2961133733
1099 2961184993
1100 2968022149
1101 2968144677
1102 2970474739
1103 2970494405
1104 2970510769
1105 2970537901
1106 2970543789
1107 2970594942
1108 2970626718
1109 2970630210
1110 2977857515
1111 2977898677
1112 2977909865
1113 2979768462
1114 2979775241
1115 2987670730
1116 2996354149
1117 2996387430
1118 3002142868
1119 3004171333
1120 3004233375
1121 3004249118
1122 3004270400
1123 3004280817
1124 3004291637
1125 8004319899
1126 8004396702
1127 8004638885
1128 8004728046
1129 8055623609
1130 8055916643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

39

85

0.98

PF12840

HTH_20

Helix-turn-helix domain

37

86

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9609 13 100
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9569 13 94
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9561 11 100
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9496 13 97
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9267 23 80
ID Description Score Start End Superfamily
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9609 13 100 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9562 13 93 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 13 92 1.10.10.10
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9267 23 80 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9203 13 100 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9954 13 93 GO:0003700
AF-A0A0F4RFV9-F1-model_v4 ArsR family transcriptional regulator 0.9924 13 100 GO:0003700
AF-A0A4R8VFF7-F1-model_v4 deleted 0.9885 13 95
AF-A0A238K834-F1-model_v4 Transcriptional repressor SdpR 0.9842 14 104 GO:0003700
AF-A0A0K0XZQ4-F1-model_v4 ArsR family transcriptional regulator 0.9796 16 97 GO:0003700

Map