F464339

General Info

Members Datasets Scaffolds Average Seq Length
566 352 1133 326

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10035550|rootH1_100355501
Length 351
Sequence MDWFTDLFAQAQQALFESVIQPIVFHLGYGNLLEDAFDATGWLLVGLIQIVVMLAVIGSLQRWRPAEAVTDRQAIRVDIVYTLIQRLGVFRLAMFFSLDPVVDGLVGEMRMLGLPSFQLDAIWPGVTDQAWVSFVLYLVAFDLLQYWLHRAQHSWHWWWALHALHHSQRQMTMWSDSRNHLLDDLLIDSAVALTAVLIGVGPGQFVALVAISQLLENLQHANLRLSFGAIGERLLVSPRFHRLHHSIGIGHEGFGRGTLGGHNFAVMLPIWDVLFRTANFEDRWDPTGVRDQLPEEGGRDYGRGFWAQQWLGLKRLAGRDKIAAAPGSGSLPPGGATMDIAGQAPAGGNQG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
139 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
140 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
171 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
255 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
256 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
259 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
260 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
261 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
262 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
267 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
270 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
271 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
272 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
273 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
274 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
275 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
276 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
277 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
278 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
279 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
280 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
281 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
282 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
283 2643221569 Achromobacter sp. Root565 Isolate Unclassified
284 2643221594 Achromobacter sp. Root170 Isolate Unclassified
285 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
286 2643221621 Achromobacter sp. Root83 Isolate Unclassified
287 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
288 2643221658 Variovorax sp. Root411 Isolate Unclassified
289 2643221660 Methylibium sp. Root1272 Isolate Unclassified
290 2643221672 Variovorax sp. Root434 Isolate Unclassified
291 2643221683 Variovorax sp. Root473 Isolate Unclassified
292 2738541277 Variovorax sp. GV051 Isolate Unclassified
293 2738541307 Variovorax sp. GV008 Isolate Unclassified
294 2738543019 Variovorax sp. GV040 Isolate Unclassified
295 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
296 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
297 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
298 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
299 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
300 2818991436 Collimonas arenae 515 Isolate Unclassified
301 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
302 2818991446 Variovorax sp. 1180 Isolate Unclassified
303 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
304 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
305 2831864461 Roseateles noduli HZ7 Isolate Nodule
306 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
307 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
308 2842677519 Variovorax sp. R-72495 Isolate Unclassified
309 2842733646 Variovorax sp. R-72446 Isolate Unclassified
310 2842747753 Variovorax sp. R-72060 Isolate Unclassified
311 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
312 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
313 2858950400 Achromobacter sp. K91 Isolate Unclassified
314 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
315 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
316 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
317 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
318 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
319 2885198086 Variovorax sp. 679 Isolate Unclassified
320 2885211737 Variovorax sp. 553 Isolate Unclassified
321 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
322 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
323 2899924645 Variovorax sp. 369 Isolate Unclassified
324 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
325 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
326 2904456579 Variovorax sp. 2002 Isolate Unclassified
327 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
328 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
329 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
330 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
331 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
332 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
333 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
334 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
335 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
336 2928037797 Variovorax sp. 1126 Isolate Unclassified
337 2928044640 Variovorax sp. 1128 Isolate Unclassified
338 2928051484 Variovorax sp. 1133 Isolate Unclassified
339 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
340 2928070936 Variovorax gossypii 1167 Isolate Unclassified
341 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
342 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
343 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
344 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
345 2929520902 Variovorax beijingensis 502 Isolate Unclassified
346 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
347 2941479691
348 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
349 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
350 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
351 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
352 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.34
Metatranscriptomes 0.18
Isolates 14.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.39
Nodule 1.94
Rhizoplane 3.53
Rhizosphere 40.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10035550 3300003316 Bacteria 3538
2 JGI25155J39150_1000126 3300002704 Bacteria 37345
3 JGI25155J39150_1000177 3300002704 Bacteria 27568
4 JGI25156J39149_1000057 3300002705 Bacteria 86392
5 JGI25156J39149_1006062 3300002705 Bacteria 3363
6 JGI25162J39368_1000052 3300002737 Bacteria 152144
7 JGI25154J39366_1000087 3300002738 Bacteria 86392
8 JGI25154J39366_1000206 3300002738 Bacteria 42302
9 JGI25158J39367_1005046 3300002739 Bacteria 1952
10 JGI25157J39369_1000156 3300002741 Bacteria 56715
11 JGI25152J39213_1003884 3300002773 Bacteria 4914
12 JGI25152J39213_1009188 3300002773 Bacteria 2369
13 JGI25159J45721_1006323 3300002987 Bacteria 3565
14 JGI25151J46595_10004233 3300003187 Bacteria 7633
15 JGI25151J46595_10010350 3300003187 Bacteria 4346
16 JGI25151J46595_10022003 3300003187 Bacteria 2655
17 JGI25165J46597_1000105 3300003214 Bacteria 152144
18 JGI25153J46596_10018916 3300003215 Bacteria 2655
19 rootH2_10065870 3300003320 Bacteria 1743
20 rootL2_10002813 3300003322 Bacteria 19046
21 rootL2_10055286 3300003322 Bacteria 1361
22 rootH1_10012523 3300003316 Bacteria 19300
23 rootH1_10012523 3300003323 Bacteria 7871
24 rootH1_10045942 3300003323 Bacteria 2423
25 rootH1_10074545 3300003323 Bacteria 4047
26 JGI25160J50197_1006552 3300003354 Bacteria 4697
27 JGI25161J50226_1004315 3300003374 Bacteria 3005
28 Ga0006562J51391_1028493 3300003578 Bacteria 8120
29 Ga0055538_1000043 3300003751 Bacteria 152144
30 Ga0055538_1000045 3300003751 Bacteria 139066
31 Ga0055539_1000057 3300003752 Bacteria 152144
32 Ga0055539_1000064 3300003752 Bacteria 139066
33 Ga0055533_1000071 3300003756 Bacteria 152144
34 Ga0055533_1000074 3300003756 Bacteria 139066
35 Ga0055532_1000016 3300003758 Bacteria 327509
36 Ga0055525_1000085 3300003759 Bacteria 152144
37 Ga0055525_1000092 3300003759 Bacteria 139066
38 Ga0055535_1000086 3300003761 Bacteria 104327
39 Ga0055542_1000009 3300003762 Bacteria 416550
40 Ga0055526_1001717 3300003771 Bacteria 15247
41 Ga0055537_1001318 3300003773 Bacteria 10151
42 Ga0055524_1000755 3300003775 Bacteria 21925
43 Ga0055536_1007090 3300003781 Bacteria 5086
44 Ga0055536_1013053 3300003781 Bacteria 3028
45 Ga0055536_1016192 3300003781 Bacteria 2505
46 Ga0055534_1000440 3300003784 Bacteria 24514
47 Ga0055534_1001277 3300003784 Bacteria 10222
48 Ga0055534_1001930 3300003784 Bacteria 7618
49 Ga0055528_1002574 3300003790 Bacteria 9607
50 Ga0055528_1005974 3300003790 Bacteria 5576
51 Ga0055530_10001144 3300003791 Bacteria 20648
52 Ga0055530_10006393 3300003791 Bacteria 5278
53 Ga0055540_1004372 3300003792 Bacteria 6407
54 Ga0055540_1004891 3300003792 Bacteria 5855
55 Ga0055540_1005964 3300003792 Bacteria 4952
56 Ga0055540_1011653 3300003792 Bacteria 2815
57 Ga0055531_10007619 3300003794 Bacteria 5865
58 Ga0055531_10007699 3300003794 Bacteria 5821
59 Ga0055531_10020389 3300003794 Bacteria 2624
60 Ga0055541_1000044 3300003841 Bacteria 152144
61 Ga0055541_1000046 3300003841 Bacteria 139066
62 Ga0055543_1006494 3300004625 Bacteria 2819
63 Ga0065165_1000354 3300005262 Bacteria 75337
64 Ga0065165_1000431 3300005262 Bacteria 65970
65 Ga0065714_10076198 3300005288 Bacteria 2818
66 Ga0070661_100330999 3300005344 Bacteria 1191
67 Ga0070675_100266576 3300005354 Bacteria 1502
68 Ga0070659_100125899 3300005366 Bacteria 2078
69 Ga0070667_100138569 3300005367 Bacteria 2129
70 Ga0070667_100218220 3300005367 Bacteria 1697
71 Ga0068853_100120219 3300005539 Bacteria 2342
72 Ga0070672_100146962 3300005543 Bacteria 1948
73 Ga0070665_100094358 3300005548 Bacteria 2997
74 Ga0068855_100000072 3300005563 Bacteria 121486
75 Ga0068855_100103100 3300005563 Bacteria 3283
76 Ga0070664_100008585 3300005564 Bacteria 8265
77 Ga0068857_100074832 3300005577 Bacteria 3019
78 Ga0068857_100250662 3300005577 Bacteria 1623
79 Ga0068854_100001277 3300005578 Bacteria 15138
80 Ga0068854_100112726 3300005578 Bacteria 2053
81 Ga0068852_100206566 3300005616 Bacteria 1861
82 Ga0068852_100400582 3300005616 Bacteria 1350
83 Ga0075365_10003506 3300006038 Bacteria 8109
84 Ga0075365_10056750 3300006038 Bacteria 2604
85 Ga0075368_10052364 3300006042 Bacteria 1624
86 Ga0075363_100005424 3300006048 Bacteria 5668
87 Ga0075363_100006287 3300006048 Bacteria 5379
88 Ga0075363_100071018 3300006048 Bacteria 1892
89 Ga0075364_10090964 3300006051 Bacteria 2024
90 Ga0075364_10291739 3300006051 Bacteria 1110
91 Ga0070712_100003224 3300006175 Bacteria 10054
92 Ga0075362_10002649 3300006177 Bacteria 6073
93 Ga0075362_10048373 3300006177 Bacteria 1897
94 Ga0075362_10071953 3300006177 Bacteria 1581
95 Ga0075362_10090791 3300006177 Bacteria 1418
96 Ga0075362_10134041 3300006177 Bacteria 1180
97 Ga0075367_10007008 3300006178 Bacteria 5742
98 Ga0075367_10086973 3300006178 Bacteria 1898
99 Ga0075366_10000846 3300006195 Bacteria 14740
100 Ga0075366_10023610 3300006195 Bacteria 3584
101 Ga0075366_10185927 3300006195 Bacteria 1262
102 Ga0075370_10000611 3300006353 Bacteria 13819
103 Ga0075370_10001545 3300006353 Bacteria 10070
104 Ga0075370_10013714 3300006353 Bacteria 4313
105 Ga0075370_10013900 3300006353 Bacteria 4285
106 Ga0075370_10016385 3300006353 Bacteria 3988
107 Ga0075370_10120476 3300006353 Bacteria 1527
108 Ga0075370_10170337 3300006353 Bacteria 1280
109 Ga0099823_1029870 3300006944 Bacteria 4595
110 Ga0079104_1030289 3300006946 Bacteria 1353
111 Ga0099826_10036324 3300006948 Bacteria 3489
112 Ga0099826_10039119 3300006948 Bacteria 3322
113 Ga0105244_10009292 3300009036 Bacteria 6059
114 Ga0105240_10000569 3300009093 Bacteria 68389
115 Ga0105240_10583770 3300009093 Bacteria 1232
116 Ga0105243_10001422 3300009148 Bacteria 21125
117 Ga0105243_10007750 3300009148 Bacteria 8257
118 Ga0105241_10101110 3300009174 Bacteria 2292
119 Ga0105242_10046905 3300009176 Bacteria 3507
120 Ga0105237_10008022 3300009545 Bacteria 11490
121 Ga0105237_10059955 3300009545 Bacteria 3807
122 Ga0105237_10265047 3300009545 Bacteria 1721
123 Ga0105238_10000318 3300009551 Bacteria 52620
124 Ga0105238_10062715 3300009551 Bacteria 3717
125 Ga0105239_10026228 3300010375 Bacteria 6414
126 Ga0105239_10194962 3300010375 Bacteria 2268
127 Ga0105246_10041769 3300011119 Bacteria 3102
128 Ga0157319_1000017 3300012497 Bacteria 110340
129 Ga0157373_10006156 3300013100 Bacteria 8971
130 Ga0157373_10076719 3300013100 Bacteria 2358
131 Ga0157371_10039685 3300013102 Bacteria 3366
132 Ga0157370_10045256 3300013104 Bacteria 4223
133 Ga0157369_10063158 3300013105 Bacteria 3990
134 Ga0157372_10161322 3300013307 Bacteria 2591
135 Ga0163163_10009104 3300014325 Bacteria 8847
136 Ga0182008_10005016 3300014497 Bacteria 7616
137 Ga0182008_10007288 3300014497 Bacteria 6116
138 Ga0182008_10037413 3300014497 Bacteria 2427
139 Ga0157379_10001985 3300014968 Bacteria 16922
140 Ga0182006_1005603 3300015261 Bacteria 5959
141 Ga0182006_1065838 3300015261 Bacteria 1356
142 Ga0182007_10001722 3300015262 Bacteria 11538
143 Ga0182007_10001954 3300015262 Bacteria 10660
144 Ga0182007_10007332 3300015262 Bacteria 4633
145 Ga0182005_1000365 3300015265 Bacteria 25241
146 Ga0183362_10003 3300015683 Bacteria 977584
147 Ga0163161_10000803 3300017792 Bacteria 24579
148 Ga0163161_10010378 3300017792 Bacteria 6449
149 Ga0163161_10035475 3300017792 Bacteria 3570
150 Ga0163161_10070642 3300017792 Bacteria 2553
151 Ga0163161_10199985 3300017792 Bacteria 1540
152 Ga0213872_10000034 3300021361 Bacteria 133158
153 Ga0213872_10008332 3300021361 Bacteria 5022
154 Ga0209435_100016 3300025206 Bacteria 305566
155 Ga0209435_100038 3300025206 Bacteria 120273
156 Ga0209435_100856 3300025206 Bacteria 4722
157 Ga0209784_100002 3300025224 Bacteria 1753105
158 Ga0209784_100069 3300025224 Bacteria 152424
159 Ga0209566_100003 3300025225 Bacteria 1753105
160 Ga0209566_100083 3300025225 Bacteria 152424
161 Ga0209674_100004 3300025226 Bacteria 1753105
162 Ga0209674_100106 3300025226 Bacteria 152424
163 Ga0209147_100023 3300025229 Bacteria 437803
164 Ga0209147_102894 3300025229 Bacteria 3770
165 Ga0209563_100006 3300025230 Bacteria 1753105
166 Ga0209563_100100 3300025230 Bacteria 152424
167 Ga0207427_100279 3300025231 Bacteria 37306
168 Ga0209437_100156 3300025233 Bacteria 152424
169 Ga0209437_100166 3300025233 Bacteria 144787
170 Ga0209258_100009 3300025242 Bacteria 996276
171 Ga0209258_100368 3300025242 Bacteria 59722
172 Ga0209646_1000033 3300025246 Bacteria 369507
173 Ga0209646_1000093 3300025246 Bacteria 183840
174 Ga0209026_1000031 3300025250 Bacteria 325747
175 Ga0209026_1003457 3300025250 Bacteria 5164
176 Ga0209677_100003 3300025253 Bacteria 1753105
177 Ga0209677_100061 3300025253 Bacteria 152424
178 Ga0209148_1000007 3300025254 Bacteria 1592273
179 Ga0209759_1000045 3300025256 Bacteria 235654
180 Ga0209759_1000248 3300025256 Bacteria 80537
181 Ga0209129_1000013 3300025258 Bacteria 524874
182 Ga0209129_1005263 3300025258 Bacteria 4663
183 Ga0209129_1006522 3300025258 Bacteria 3743
184 Ga0209233_1000165 3300025261 Bacteria 152424
185 Ga0209565_1000058 3300025263 Bacteria 194126
186 Ga0209565_1001103 3300025263 Bacteria 13288
187 Ga0209565_1002218 3300025263 Bacteria 7267
188 Ga0209673_1000053 3300025273 Bacteria 279449
189 Ga0209673_1000648 3300025273 Bacteria 51507
190 Ga0209673_1002359 3300025273 Bacteria 13288
191 Ga0209673_1003441 3300025273 Bacteria 9331
192 Ga0209673_1003742 3300025273 Bacteria 8680
193 Ga0209130_1000230 3300025284 Bacteria 73335
194 Ga0209130_1000513 3300025284 Bacteria 39057
195 Ga0209675_1001191 3300025291 Bacteria 15776
196 Ga0209675_1001632 3300025291 Bacteria 12562
197 Ga0209675_1002205 3300025291 Bacteria 10208
198 Ga0209675_1002332 3300025291 Bacteria 9816
199 Ga0209676_1000004 3300025292 Bacteria 1138360
200 Ga0209676_1000368 3300025292 Bacteria 83764
201 Ga0209676_1000497 3300025292 Bacteria 63087
202 Ga0209676_1007221 3300025292 Bacteria 5284
203 Ga0209676_1009557 3300025292 Bacteria 4170
204 Ga0209025_1001889 3300025294 Bacteria 24471
205 Ga0209025_1002491 3300025294 Bacteria 19369
206 Ga0209025_1004165 3300025294 Bacteria 12806
207 Ga0209025_1009256 3300025294 Bacteria 6900
208 Ga0209025_1013248 3300025294 Bacteria 5201
209 Ga0209564_1000051 3300025295 Bacteria 357748
210 Ga0209564_1000214 3300025295 Bacteria 132937
211 Ga0209564_1000319 3300025295 Bacteria 93563
212 Ga0209758_1000067 3300025297 Bacteria 288575
213 Ga0209758_1005598 3300025297 Bacteria 9554
214 Ga0209050_1000002 3300025298 Bacteria 1792849
215 Ga0209050_1001264 3300025298 Bacteria 29155
216 Ga0209050_1003087 3300025298 Bacteria 12799
217 Ga0209050_1014864 3300025298 Bacteria 3317
218 Ga0209256_1000060 3300025299 Bacteria 262342
219 Ga0209256_1000166 3300025299 Bacteria 133549
220 Ga0209256_1000249 3300025299 Bacteria 95279
221 Ga0209256_1002607 3300025299 Bacteria 14284
222 Ga0209256_1038558 3300025299 Bacteria 1237
223 Ga0207426_1000100 3300025302 Bacteria 262342
224 Ga0207426_1000469 3300025302 Bacteria 62457
225 Ga0209051_1000002 3300025303 Bacteria 1631846
226 Ga0209051_1000240 3300025303 Bacteria 92221
227 Ga0209051_1000584 3300025303 Bacteria 43173
228 Ga0209051_1003160 3300025303 Bacteria 11050
229 Ga0209051_1003248 3300025303 Bacteria 10804
230 Ga0209257_1000002 3300025304 Bacteria 1767052
231 Ga0209257_1001174 3300025304 Bacteria 33130
232 Ga0209257_1002034 3300025304 Bacteria 21566
233 Ga0209257_1003692 3300025304 Bacteria 12746
234 Ga0209257_1011829 3300025304 Bacteria 4131
235 Ga0207656_10029113 3300025321 Bacteria 2272
236 Ga0207655_1012960 3300025728 Bacteria 4822
237 Ga0207682_10015262 3300025893 Bacteria 2989
238 Ga0207695_10004759 3300025913 Bacteria 18356
239 Ga0207695_10008793 3300025913 Bacteria 12589
240 Ga0207671_10030805 3300025914 Bacteria 3999
241 Ga0207693_10044719 3300025915 Bacteria 3480
242 Ga0207649_10278187 3300025920 Bacteria 1216
243 Ga0207681_10020395 3300025923 Bacteria 4200
244 Ga0207694_10003032 3300025924 Bacteria 13465
245 Ga0207694_10162275 3300025924 Bacteria 1806
246 Ga0207686_10172067 3300025934 Bacteria 1528
247 Ga0207709_10000589 3300025935 Bacteria 30358
248 Ga0207709_10000633 3300025935 Bacteria 28782
249 Ga0207711_10003782 3300025941 Bacteria 13027
250 Ga0207679_10008087 3300025945 Bacteria 6688
251 Ga0207667_10000055 3300025949 Bacteria 223770
252 Ga0207667_10133522 3300025949 Bacteria 2557
253 Ga0207658_10155507 3300025986 Bacteria 1868
254 Ga0207639_10014847 3300026041 Bacteria 5485
255 Ga0207674_10215183 3300026116 Bacteria 1870
256 Ga0207683_10030416 3300026121 Bacteria 4679
257 Ga0207698_10197962 3300026142 Bacteria 1796
258 Ga0207698_10315881 3300026142 Bacteria 1461
259 Ga0209389_1030170 3300027296 Bacteria 4581
260 Ga0209282_1000719 3300027666 Bacteria 16587
261 Ga0307515_10000487 3300028794 Bacteria 94783
262 Ga0307515_10054979 3300028794 Bacteria 5830
263 Ga0307515_10177942 3300028794 Bacteria 2090
264 Ga0314311_1178047 3300030733 Bacteria 4437
265 Ga0316183_1083828 3300030742 Bacteria 4072
266 Ga0316182_1000683 3300030745 Bacteria 3530
267 Ga0265331_10006808 3300031250 Bacteria 6695
268 Ga0265327_10000012 3300031251 Bacteria 530403
269 Ga0265327_10073313 3300031251 Bacteria 1708
270 Ga0265316_10000225 3300031344 Bacteria 65532
271 Ga0307509_10306189 3300031507 Bacteria 1334
272 Ga0307408_100011346 3300031548 Bacteria 5886
273 Ga0307408_100056343 3300031548 Bacteria 2850
274 Ga0307514_10001231 3300031649 Bacteria 33814
275 Ga0307514_10074985 3300031649 Bacteria 2524
276 Ga0307405_10011747 3300031731 Bacteria 4607
277 Ga0307405_10111340 3300031731 Bacteria 1855
278 Ga0307410_10379582 3300031852 Bacteria 1137
279 Ga0307406_10006477 3300031901 Bacteria 6467
280 Ga0307412_10000663 3300031911 Bacteria 19973
281 Ga0307412_10007893 3300031911 Bacteria 6062
282 Ga0307412_10008430 3300031911 Bacteria 5883
283 Ga0307412_10047588 3300031911 Bacteria 2817
284 Ga0307412_10061106 3300031911 Bacteria 2531
285 Ga0307416_100069235 3300032002 Bacteria 2919
286 Ga0307416_100118933 3300032002 Bacteria 2349
287 Ga0307414_10042711 3300032004 Bacteria 3082
288 Ga0307411_10149934 3300032005 Bacteria 1731
289 Ga0395905_0000455 3300037471 Bacteria 57161
290 Ga0436361_0254808 3300039447 Bacteria 14252
291 Ga0436361_0436689 3300039447 Bacteria 47478
292 Ga0436361_0767394 3300039447 Bacteria 56110
293 Ga0436361_0955311 3300039447 Bacteria 18858
294 Ga0439436_0006866 3300041404 Bacteria 3497
295 Ga0439436_0041546 3300041404 Bacteria 1316
296 Ga0439438_021887 3300041405 Bacteria 1779
297 Ga0439447_014866 3300041407 Bacteria 2172
298 Ga0439466_0003503 3300041411 Bacteria 6074
299 Ga0439466_0008567 3300041411 Bacteria 3854
300 Ga0439465_0001409 3300041413 Bacteria 7772
301 Ga0439431_0001296 3300041997 Bacteria 5499
302 Ga0439431_0004211 3300041997 Bacteria 3156
303 Ga0439431_0011614 3300041997 Bacteria 2014
304 Ga0439433_0000635 3300041999 Bacteria 6719
305 Ga0439442_001259 3300042002 Bacteria 5036
306 Ga0439442_002007 3300042002 Bacteria 4004
307 Ga0439445_0002064 3300042004 Bacteria 4441
308 Ga0439432_003666 3300042006 Bacteria 5679
309 Ga0439432_003984 3300042006 Bacteria 5425
310 Ga0439449_0000729 3300042007 Bacteria 12626
311 Ga0439449_0003132 3300042007 Bacteria 6437
312 Ga0439452_003831 3300042010 Bacteria 5165
313 Ga0439457_005060 3300042014 Bacteria 3360
314 Ga0439462_0001258 3300042015 Bacteria 5555
315 Ga0439462_0002443 3300042015 Bacteria 4316
316 Ga0450890_000849 3300042127 Bacteria 4398
317 Ga0450898_000672 3300042134 Bacteria 4119
318 Ga0439446_0004168 3300042156 Bacteria 3645
319 Ga0439446_0021143 3300042156 Bacteria 1838
320 Ga0450908_009618 3300042184 Bacteria 1793
321 Ga0439434_0002254 3300042435 Bacteria 5596
322 Ga0439434_0004921 3300042435 Bacteria 3905
323 Ga0450918_005117 3300042531 Bacteria 2362
324 Ga0451577_0007345 3300042876 Bacteria 10838
325 Ga0466969_0059020 3300044656 Bacteria 1866
326 Ga0466972_0000414 3300044658 Bacteria 22321
327 Ga0466977_0003004 3300044666 Bacteria 7969
328 Ga0453683_0001424 3300044673 Bacteria 20806
329 Ga0453684_0367405 3300044712 Bacteria 1618
330 Ga0451576_0001940 3300045051 Bacteria 33033
331 Ga0451576_0054907 3300045051 Bacteria 4169
332 Ga0451576_0220550 3300045051 Bacteria 1980
333 Ga0495627_021590 3300046453 Bacteria 2132
334 Ga0495627_025452 3300046453 Bacteria 1919
335 Ga0495592_0002730 3300046454 Bacteria 12500
336 Ga0495638_0030440 3300046460 Bacteria 3475
337 Ga0495651_0034068 3300046462 Bacteria 3970
338 Ga0495651_0044520 3300046462 Bacteria 3439
339 Ga0495653_0028155 3300046463 Bacteria 4495
340 Ga0495650_0010860 3300046471 Bacteria 5047
341 Ga0495608_0015808 3300046511 Bacteria 5224
342 Ga0495608_0018321 3300046511 Bacteria 4832
343 Ga0495610_0034596 3300046512 Bacteria 2601
344 Ga0495616_0015463 3300046513 Bacteria 4245
345 Ga0495620_0011223 3300046515 Bacteria 4683
346 Ga0495628_0002569 3300046516 Bacteria 16335
347 Ga0495628_0003270 3300046516 Bacteria 14508
348 Ga0495628_0259643 3300046516 Bacteria 1295
349 Ga0495631_0004099 3300046518 Bacteria 7825
350 Ga0495637_0010541 3300046520 Bacteria 4465
351 Ga0495652_0008564 3300046529 Bacteria 9329
352 Ga0495652_0037349 3300046529 Bacteria 4214
353 Ga0495609_0072151 3300046538 Bacteria 1516
354 Ga0495621_0007767 3300046539 Bacteria 3188
355 Ga0495645_0047656 3300046543 Bacteria 3122
356 Ga0495656_0001934 3300046615 Bacteria 6833
357 Ga0495656_0006748 3300046615 Bacteria 4033
358 Ga0495656_0012528 3300046615 Bacteria 3132
359 Ga0495656_0040336 3300046615 Bacteria 1945
360 Ga0495625_0001424 3300046660 Bacteria 29199
361 Ga0495625_0006576 3300046660 Bacteria 10315
362 Ga0495625_0108270 3300046660 Bacteria 1901
363 Ga0495635_0044392 3300046663 Bacteria 3067
364 Ga0495588_0023958 3300046674 Bacteria 3028
365 Ga0495599_0015872 3300046678 Bacteria 4675
366 Ga0495623_0037936 3300046679 Bacteria 3081
367 Ga0495646_0002878 3300046680 Bacteria 10659
368 Ga0495646_0010618 3300046680 Bacteria 5849
369 Ga0495646_0153573 3300046680 Bacteria 1279
370 Ga0495658_0007369 3300046683 Bacteria 5441
371 Ga0495624_0020311 3300046690 Bacteria 4424
372 Ga0495670_0004700 3300046691 Bacteria 6703
373 Ga0495671_0076529 3300046692 Bacteria 1641
374 Ga0495600_0001814 3300046809 Bacteria 11949
375 Ga0495604_0003896 3300047317 Bacteria 11883
376 Ga0495676_0007117 3300047321 Bacteria 10270
377 Ga0495685_004759 3300047447 Bacteria 4402
378 Ga0495593_0013090 3300047673 Bacteria 4736
379 Ga0495602_0196695 3300048088 Bacteria 1541
380 Ga0495614_0007704 3300048089 Bacteria 4783
381 Ga0495615_0004143 3300048090 Bacteria 2502
382 Ga0496101_0012475 3300048904 Bacteria 5671
383 Ga0496101_0357480 3300048904 Bacteria 1148
384 Ga0496102_0008041 3300048905 Bacteria 9019
385 Ga0496102_0027699 3300048905 Bacteria 5061
386 Ga0496102_0107302 3300048905 Bacteria 2600
387 Ga0496102_0110881 3300048905 Bacteria 2558
388 Ga0496104_0071747 3300048907 Bacteria 3292
389 Ga0496105_0151813 3300048908 Bacteria 1904
390 Ga0496107_0028764 3300048910 Bacteria 3951
391 Ga0496107_0043227 3300048910 Bacteria 3237
392 Ga0496109_0109302 3300048912 Bacteria 2570
393 Ga0496110_0071844 3300048913 Bacteria 3069
394 Ga0496111_0099468 3300048914 Bacteria 2136
395 Ga0496112_0122968 3300048915 Bacteria 2565
396 Ga0496113_0054033 3300048916 Bacteria 3005
397 Ga0496114_0080420 3300048917 Bacteria 2752
398 Ga0496116_0007861 3300048919 Bacteria 9357
399 Ga0496116_0010729 3300048919 Bacteria 7648
400 Ga0496116_0022723 3300048919 Bacteria 4692
401 Ga0496116_0034981 3300048919 Bacteria 3534
402 Ga0496117_0014930 3300048920 Bacteria 6658
403 Ga0496117_0020711 3300048920 Bacteria 5353
404 Ga0496117_0025907 3300048920 Bacteria 4598
405 Ga0496117_0044726 3300048920 Bacteria 3204
406 Ga0496118_0009286 3300048921 Bacteria 9974
407 Ga0496118_0018500 3300048921 Bacteria 6283
408 Ga0496118_0024665 3300048921 Bacteria 5183
409 Ga0496118_0049911 3300048921 Bacteria 3217
410 Ga0496120_0010394 3300048923 Bacteria 6496
411 Ga0496121_0002843 3300048924 Bacteria 25547
412 Ga0496121_0009359 3300048924 Bacteria 11284
413 Ga0496121_0017745 3300048924 Bacteria 7240
414 Ga0496121_0043858 3300048924 Bacteria 3866
415 Ga0496121_0049833 3300048924 Bacteria 3545
416 Ga0496122_0000375 3300048925 Bacteria 95681
417 Ga0496122_0000410 3300048925 Bacteria 91128
418 Ga0496122_0023610 3300048925 Bacteria 5410
419 Ga0496122_0061738 3300048925 Bacteria 2748
420 Ga0496122_0212225 3300048925 Bacteria 1120
421 Ga0496123_0000267 3300048926 Bacteria 104282
422 Ga0496123_0001174 3300048926 Bacteria 38674
423 Ga0496123_0003782 3300048926 Bacteria 16575
424 Ga0496123_0059679 3300048926 Bacteria 2464
425 Ga0496124_0012150 3300048927 Bacteria 8529
426 Ga0496124_0014108 3300048927 Bacteria 7746
427 Ga0496124_0026702 3300048927 Bacteria 5203
428 Ga0496124_0098196 3300048927 Bacteria 2377
429 Ga0496124_0116832 3300048927 Bacteria 2138
430 Ga0496125_0000166 3300048928 Bacteria 147432
431 Ga0496125_0002855 3300048928 Bacteria 21745
432 Ga0496125_0011729 3300048928 Bacteria 8736
433 Ga0496125_0020196 3300048928 Bacteria 6260
434 Ga0496125_0021514 3300048928 Bacteria 6014
435 Ga0496125_0029723 3300048928 Bacteria 4904
436 Ga0496126_0031176 3300048929 Bacteria 5042
437 Ga0496126_0044376 3300048929 Bacteria 4094
438 Ga0496126_0280490 3300048929 Bacteria 1380
439 Ga0501249_026488 3300049679 Bacteria 1282
440 Ga0501225_0006610 3300049705 Bacteria 3382
441 Ga0501262_000681 3300049759 Bacteria 3937
442 nmdc:mga03683_58480_c1 3300050489 Bacteria 1625
443 nmdc:mga03683_9475_c1 3300050489 Bacteria 3465
444 nmdc:mga03n38_108918_c1 3300050490 Bacteria 1346
445 nmdc:mga03n38_2356_c1 3300050490 Bacteria 5815
446 nmdc:mga00v17_13035_c1 3300050491 Bacteria 4606
447 nmdc:mga0k408_24779_c1 3300050493 Bacteria 3394
448 nmdc:mga0k408_28690_c1 3300050493 Bacteria 3164
449 nmdc:mga0k408_4659_c1 3300050493 Bacteria 7267
450 nmdc:mga0k408_70364_c1 3300050493 Bacteria 2042
451 nmdc:mga0k408_8638_c1 3300050493 Bacteria 3527
452 nmdc:mga06z11_40543_c1 3300050494 Bacteria 2324
453 nmdc:mga06z11_57773_c1 3300050494 Bacteria 2011
454 nmdc:mga07m45_19058_c1 3300050496 Bacteria 3714
455 nmdc:mga07m45_41959_c1 3300050496 Bacteria 2563
456 nmdc:mga07m45_8257_c1 3300050496 Bacteria 5344
457 nmdc:mga07m45_85857_c1 3300050496 Bacteria 1800
458 nmdc:mga0sz30_75984_c1 3300050516 Bacteria 1450
459 Ga0495601_0018864 3300053077 Bacteria 4202
460 Ga0500610_0008482 3300053079 Bacteria 4482
461 Ga0500643_008611 3300053087 Bacteria 3994
462 Ga0500651_0000345 3300053093 Bacteria 26058
463 Ga0500571_002156 3300053110 Bacteria 9653
464 Ga0500593_000864 3300053117 Bacteria 11255
465 Ga0500593_003454 3300053117 Bacteria 5977
466 Ga0500594_0004886 3300053118 Bacteria 2964
467 Ga0500595_001911 3300053119 Bacteria 10732
468 Ga0500597_051894 3300053120 Bacteria 1749
469 Ga0500607_007464 3300053121 Bacteria 6755
470 Ga0500618_000877 3300053125 Bacteria 16018
471 Ga0500618_002085 3300053125 Bacteria 7968
472 Ga0500618_015056 3300053125 Bacteria 1962
473 Ga0500626_070558 3300053128 Bacteria 1555
474 Ga0500655_000997 3300053133 Bacteria 5464
475 Ga0500658_0000825 3300053134 Bacteria 12746
476 Ga0500658_0003061 3300053134 Bacteria 6398
477 Ga0500559_0005364 3300053136 Bacteria 5901
478 Ga0500559_0027063 3300053136 Bacteria 2446
479 Ga0500568_0013585 3300053139 Bacteria 3707
480 Ga0500574_000776 3300053141 Bacteria 4294
481 Ga0500619_000083 3300053154 Bacteria 26339
482 Ga0500622_0001025 3300053156 Bacteria 23432
483 Ga0500624_004921 3300053157 Bacteria 1768
484 Ga0500634_0031985 3300053161 Bacteria 2870
485 Ga0500638_050914 3300053162 Bacteria 2002
486 2511248963 2511231003 Bacteria 5606035
487 2511387485 2511231026 Bacteria 5225445
488 2513227212 2513020051 Bacteria 6053213
489 2521557591 2521172590 Bacteria 5047645
490 2550696240 2548876994 Bacteria 4904866
491 2553006620 2551306416 Bacteria 6152985
492 2599627310 2599185214 Bacteria 8209958
493 2599676725 2599185226 Bacteria 8233575
494 2599679981 2599185227 Bacteria 8246414
495 2599691997 2599185229 Bacteria 8216126
496 2599902613 2599185292 Bacteria 6290804
497 2643861406 2643221569 Bacteria 6064337
498 2643979599 2643221594 Bacteria 5811388
499 2644026698 2643221603 Bacteria 6147767
500 2644123738 2643221621 Bacteria 6212786
501 2644160383 2643221628 Bacteria 5745828
502 2644324779 2643221658 Bacteria 6064537
503 2644337521 2643221660 Bacteria 4208257
504 2644396651 2643221672 Bacteria 6322190
505 2644465238 2643221683 Bacteria 5749203
506 2738719685 2738541277 Bacteria 7458140
507 2738879877 2738541307 Bacteria 8606193
508 2739278884 2738543019 Bacteria 7459457
509 2765570244 2765235838 Bacteria 5445269
510 2808984383 2808606386 Bacteria 4471946
511 2809032963 2808606395 Bacteria 6020352
512 2809130737 2808606415 Bacteria 4576710
513 2809149785 2808606419 Bacteria 4576925
514 2819544237 2818991436 Bacteria 5376622
515 2819591426 2818991445 Bacteria 4955017
516 2819600113 2818991446 Bacteria 7757362
517 2819615269 2818991449 Bacteria 5518009
518 2831267529 2831265667 Bacteria 7184833
519 2831865776 2831864461 Bacteria 6502356
520 2838056034 2838054893 Bacteria 7451788
521 2839096811 2839094727 Bacteria 5534556
522 2842678010 2842677519 Bacteria 5615038
523 2842734523 2842733646 Bacteria 5716726
524 2842749245 2842747753 Bacteria 5578255
525 2852620074 2852618963 Bacteria 4577824
526 2857541709 2857537821 Bacteria 5248181
527 2858952324 2858950400 Bacteria 6783797
528 2881105423 2881101125 Bacteria 4590519
529 2884815608 2884811622 Bacteria 5552861
530 2884837230 2884836552 Bacteria 5219991
531 2884853521 2884852848 Bacteria 5221161
532 2885195419 2885192300 Bacteria 5882526
533 2885204970 2885198086 Bacteria 7212419
534 2885218343 2885211737 Bacteria 7212420
535 2886850990 2886848708 Bacteria 5632523
536 2886851101 2886848708 Bacteria 5632523
537 2896155362 2896154374 Bacteria 5221518
538 2899925948 2899924645 Bacteria 7487985
539 2904441698 2904439833 Bacteria 5931679
540 2904450287 2904449895 Bacteria 6927402
541 2904456891 2904456579 Bacteria 6819253
542 2904531380 2904530477 Bacteria 5876334
543 2904544221 2904541872 Bacteria 8915136
544 2904586965 2904584206 Bacteria 6028872
545 2904593002 2904589729 Bacteria 6113573
546 2904603185 2904601388 Bacteria 5884906
547 2919050980 2919046199 Bacteria 5567169
548 2919082036 2919079590 Bacteria 5946433
549 2919463274 2919462493 Bacteria 5817112
550 2923516289 2923510766 Bacteria 5926163
551 2928041665 2928037797 Bacteria 7273642
552 2928049229 2928044640 Bacteria 7271509
553 2928052164 2928051484 Bacteria 7773759
554 2928065157 2928064002 Bacteria 7419480
555 2928076706 2928070936 Bacteria 8062541
556 2928089180 2928084124 Bacteria 7159212
557 2928116411 2928115317 Bacteria 6477646
558 2928135082 2928130867 Bacteria 5467269
559 2929162207 2929160207 Bacteria 9075316
560 2929520991 2929520902 Bacteria 6765052
561 2939631593 2939631187 Bacteria 6118131
562 2941482807
563 2945913392 2945909444 Bacteria 7065066
564 2945948951 2945945610 Bacteria 5951079
565 2945973061 2945972063 Bacteria 6086495
566 2945991216 2945984333 Bacteria 7358892
567 2954773073 2954767861 Bacteria 5535784
568 rootH1_10035550
569 JGI25155J39150_1000126
570 JGI25155J39150_1000177
571 JGI25156J39149_1000057
572 JGI25156J39149_1006062
573 JGI25162J39368_1000052
574 JGI25154J39366_1000087
575 JGI25154J39366_1000206
576 JGI25158J39367_1005046
577 JGI25157J39369_1000156
578 JGI25152J39213_1003884
579 JGI25152J39213_1009188
580 JGI25159J45721_1006323
581 JGI25151J46595_10004233
582 JGI25151J46595_10010350
583 JGI25151J46595_10022003
584 JGI25165J46597_1000105
585 JGI25153J46596_10018916
586 rootH2_10065870
587 rootL2_10002813
588 rootL2_10055286
589 rootH1_10012523
590 rootH1_10045942
591 rootH1_10074545
592 JGI25160J50197_1006552
593 JGI25161J50226_1004315
594 Ga0006562J51391_1028493
595 Ga0055538_1000043
596 Ga0055538_1000045
597 Ga0055539_1000057
598 Ga0055539_1000064
599 Ga0055533_1000071
600 Ga0055533_1000074
601 Ga0055532_1000016
602 Ga0055525_1000085
603 Ga0055525_1000092
604 Ga0055535_1000086
605 Ga0055542_1000009
606 Ga0055526_1001717
607 Ga0055537_1001318
608 Ga0055524_1000755
609 Ga0055536_1007090
610 Ga0055536_1013053
611 Ga0055536_1016192
612 Ga0055534_1000440
613 Ga0055534_1001277
614 Ga0055534_1001930
615 Ga0055528_1002574
616 Ga0055528_1005974
617 Ga0055530_10001144
618 Ga0055530_10006393
619 Ga0055540_1004372
620 Ga0055540_1004891
621 Ga0055540_1005964
622 Ga0055540_1011653
623 Ga0055531_10007619
624 Ga0055531_10007699
625 Ga0055531_10020389
626 Ga0055541_1000044
627 Ga0055541_1000046
628 Ga0055543_1006494
629 Ga0065165_1000354
630 Ga0065165_1000431
631 Ga0065714_10076198
632 Ga0070661_100330999
633 Ga0070675_100266576
634 Ga0070659_100125899
635 Ga0070667_100138569
636 Ga0070667_100218220
637 Ga0068853_100120219
638 Ga0070672_100146962
639 Ga0070665_100094358
640 Ga0068855_100000072
641 Ga0068855_100103100
642 Ga0070664_100008585
643 Ga0068857_100074832
644 Ga0068857_100250662
645 Ga0068854_100001277
646 Ga0068854_100112726
647 Ga0068852_100206566
648 Ga0068852_100400582
649 Ga0075365_10003506
650 Ga0075365_10056750
651 Ga0075368_10052364
652 Ga0075363_100005424
653 Ga0075363_100006287
654 Ga0075363_100071018
655 Ga0075364_10090964
656 Ga0075364_10291739
657 Ga0070712_100003224
658 Ga0075362_10002649
659 Ga0075362_10048373
660 Ga0075362_10071953
661 Ga0075362_10090791
662 Ga0075362_10134041
663 Ga0075367_10007008
664 Ga0075367_10086973
665 Ga0075366_10000846
666 Ga0075366_10023610
667 Ga0075366_10185927
668 Ga0075370_10000611
669 Ga0075370_10001545
670 Ga0075370_10013714
671 Ga0075370_10013900
672 Ga0075370_10016385
673 Ga0075370_10120476
674 Ga0075370_10170337
675 Ga0099823_1029870
676 Ga0079104_1030289
677 Ga0099826_10036324
678 Ga0099826_10039119
679 Ga0105244_10009292
680 Ga0105240_10000569
681 Ga0105240_10583770
682 Ga0105243_10001422
683 Ga0105243_10007750
684 Ga0105241_10101110
685 Ga0105242_10046905
686 Ga0105237_10008022
687 Ga0105237_10059955
688 Ga0105237_10265047
689 Ga0105238_10000318
690 Ga0105238_10062715
691 Ga0105239_10026228
692 Ga0105239_10194962
693 Ga0105246_10041769
694 Ga0157319_1000017
695 Ga0157373_10006156
696 Ga0157373_10076719
697 Ga0157371_10039685
698 Ga0157370_10045256
699 Ga0157369_10063158
700 Ga0157372_10161322
701 Ga0163163_10009104
702 Ga0182008_10005016
703 Ga0182008_10007288
704 Ga0182008_10037413
705 Ga0157379_10001985
706 Ga0182006_1005603
707 Ga0182006_1065838
708 Ga0182007_10001722
709 Ga0182007_10001954
710 Ga0182007_10007332
711 Ga0182005_1000365
712 Ga0183362_10003
713 Ga0163161_10000803
714 Ga0163161_10010378
715 Ga0163161_10035475
716 Ga0163161_10070642
717 Ga0163161_10199985
718 Ga0213872_10000034
719 Ga0213872_10008332
720 Ga0209435_100016
721 Ga0209435_100038
722 Ga0209435_100856
723 Ga0209784_100002
724 Ga0209784_100069
725 Ga0209566_100003
726 Ga0209566_100083
727 Ga0209674_100004
728 Ga0209674_100106
729 Ga0209147_100023
730 Ga0209147_102894
731 Ga0209563_100006
732 Ga0209563_100100
733 Ga0207427_100279
734 Ga0209437_100156
735 Ga0209437_100166
736 Ga0209258_100009
737 Ga0209258_100368
738 Ga0209646_1000033
739 Ga0209646_1000093
740 Ga0209026_1000031
741 Ga0209026_1003457
742 Ga0209677_100003
743 Ga0209677_100061
744 Ga0209148_1000007
745 Ga0209759_1000045
746 Ga0209759_1000248
747 Ga0209129_1000013
748 Ga0209129_1005263
749 Ga0209129_1006522
750 Ga0209233_1000165
751 Ga0209565_1000058
752 Ga0209565_1001103
753 Ga0209565_1002218
754 Ga0209673_1000053
755 Ga0209673_1000648
756 Ga0209673_1002359
757 Ga0209673_1003441
758 Ga0209673_1003742
759 Ga0209130_1000230
760 Ga0209130_1000513
761 Ga0209675_1001191
762 Ga0209675_1001632
763 Ga0209675_1002205
764 Ga0209675_1002332
765 Ga0209676_1000004
766 Ga0209676_1000368
767 Ga0209676_1000497
768 Ga0209676_1007221
769 Ga0209676_1009557
770 Ga0209025_1001889
771 Ga0209025_1002491
772 Ga0209025_1004165
773 Ga0209025_1009256
774 Ga0209025_1013248
775 Ga0209564_1000051
776 Ga0209564_1000214
777 Ga0209564_1000319
778 Ga0209758_1000067
779 Ga0209758_1005598
780 Ga0209050_1000002
781 Ga0209050_1001264
782 Ga0209050_1003087
783 Ga0209050_1014864
784 Ga0209256_1000060
785 Ga0209256_1000166
786 Ga0209256_1000249
787 Ga0209256_1002607
788 Ga0209256_1038558
789 Ga0207426_1000100
790 Ga0207426_1000469
791 Ga0209051_1000002
792 Ga0209051_1000240
793 Ga0209051_1000584
794 Ga0209051_1003160
795 Ga0209051_1003248
796 Ga0209257_1000002
797 Ga0209257_1001174
798 Ga0209257_1002034
799 Ga0209257_1003692
800 Ga0209257_1011829
801 Ga0207656_10029113
802 Ga0207655_1012960
803 Ga0207682_10015262
804 Ga0207695_10004759
805 Ga0207695_10008793
806 Ga0207671_10030805
807 Ga0207693_10044719
808 Ga0207649_10278187
809 Ga0207681_10020395
810 Ga0207694_10003032
811 Ga0207694_10162275
812 Ga0207686_10172067
813 Ga0207709_10000589
814 Ga0207709_10000633
815 Ga0207711_10003782
816 Ga0207679_10008087
817 Ga0207667_10000055
818 Ga0207667_10133522
819 Ga0207658_10155507
820 Ga0207639_10014847
821 Ga0207674_10215183
822 Ga0207683_10030416
823 Ga0207698_10197962
824 Ga0207698_10315881
825 Ga0209389_1030170
826 Ga0209282_1000719
827 Ga0307515_10000487
828 Ga0307515_10054979
829 Ga0307515_10177942
830 Ga0314311_1178047
831 Ga0316183_1083828
832 Ga0316182_1000683
833 Ga0265331_10006808
834 Ga0265327_10000012
835 Ga0265327_10073313
836 Ga0265316_10000225
837 Ga0307509_10306189
838 Ga0307408_100011346
839 Ga0307408_100056343
840 Ga0307514_10001231
841 Ga0307514_10074985
842 Ga0307405_10011747
843 Ga0307405_10111340
844 Ga0307410_10379582
845 Ga0307406_10006477
846 Ga0307412_10000663
847 Ga0307412_10007893
848 Ga0307412_10008430
849 Ga0307412_10047588
850 Ga0307412_10061106
851 Ga0307416_100069235
852 Ga0307416_100118933
853 Ga0307414_10042711
854 Ga0307411_10149934
855 Ga0395905_0000455
856 Ga0436361_0254808
857 Ga0436361_0436689
858 Ga0436361_0767394
859 Ga0436361_0955311
860 Ga0439436_0006866
861 Ga0439436_0041546
862 Ga0439438_021887
863 Ga0439447_014866
864 Ga0439466_0003503
865 Ga0439466_0008567
866 Ga0439465_0001409
867 Ga0439431_0001296
868 Ga0439431_0004211
869 Ga0439431_0011614
870 Ga0439433_0000635
871 Ga0439442_001259
872 Ga0439442_002007
873 Ga0439445_0002064
874 Ga0439432_003666
875 Ga0439432_003984
876 Ga0439449_0000729
877 Ga0439449_0003132
878 Ga0439452_003831
879 Ga0439457_005060
880 Ga0439462_0001258
881 Ga0439462_0002443
882 Ga0450890_000849
883 Ga0450898_000672
884 Ga0439446_0004168
885 Ga0439446_0021143
886 Ga0450908_009618
887 Ga0439434_0002254
888 Ga0439434_0004921
889 Ga0450918_005117
890 Ga0451577_0007345
891 Ga0466969_0059020
892 Ga0466972_0000414
893 Ga0466977_0003004
894 Ga0453683_0001424
895 Ga0453684_0367405
896 Ga0451576_0001940
897 Ga0451576_0054907
898 Ga0451576_0220550
899 Ga0495627_021590
900 Ga0495627_025452
901 Ga0495592_0002730
902 Ga0495638_0030440
903 Ga0495651_0034068
904 Ga0495651_0044520
905 Ga0495653_0028155
906 Ga0495650_0010860
907 Ga0495608_0015808
908 Ga0495608_0018321
909 Ga0495610_0034596
910 Ga0495616_0015463
911 Ga0495620_0011223
912 Ga0495628_0002569
913 Ga0495628_0003270
914 Ga0495628_0259643
915 Ga0495631_0004099
916 Ga0495637_0010541
917 Ga0495652_0008564
918 Ga0495652_0037349
919 Ga0495609_0072151
920 Ga0495621_0007767
921 Ga0495645_0047656
922 Ga0495656_0001934
923 Ga0495656_0006748
924 Ga0495656_0012528
925 Ga0495656_0040336
926 Ga0495625_0001424
927 Ga0495625_0006576
928 Ga0495625_0108270
929 Ga0495635_0044392
930 Ga0495588_0023958
931 Ga0495599_0015872
932 Ga0495623_0037936
933 Ga0495646_0002878
934 Ga0495646_0010618
935 Ga0495646_0153573
936 Ga0495658_0007369
937 Ga0495624_0020311
938 Ga0495670_0004700
939 Ga0495671_0076529
940 Ga0495600_0001814
941 Ga0495604_0003896
942 Ga0495676_0007117
943 Ga0495685_004759
944 Ga0495593_0013090
945 Ga0495602_0196695
946 Ga0495614_0007704
947 Ga0495615_0004143
948 Ga0496101_0012475
949 Ga0496101_0357480
950 Ga0496102_0008041
951 Ga0496102_0027699
952 Ga0496102_0107302
953 Ga0496102_0110881
954 Ga0496104_0071747
955 Ga0496105_0151813
956 Ga0496107_0028764
957 Ga0496107_0043227
958 Ga0496109_0109302
959 Ga0496110_0071844
960 Ga0496111_0099468
961 Ga0496112_0122968
962 Ga0496113_0054033
963 Ga0496114_0080420
964 Ga0496116_0007861
965 Ga0496116_0010729
966 Ga0496116_0022723
967 Ga0496116_0034981
968 Ga0496117_0014930
969 Ga0496117_0020711
970 Ga0496117_0025907
971 Ga0496117_0044726
972 Ga0496118_0009286
973 Ga0496118_0018500
974 Ga0496118_0024665
975 Ga0496118_0049911
976 Ga0496120_0010394
977 Ga0496121_0002843
978 Ga0496121_0009359
979 Ga0496121_0017745
980 Ga0496121_0043858
981 Ga0496121_0049833
982 Ga0496122_0000375
983 Ga0496122_0000410
984 Ga0496122_0023610
985 Ga0496122_0061738
986 Ga0496122_0212225
987 Ga0496123_0000267
988 Ga0496123_0001174
989 Ga0496123_0003782
990 Ga0496123_0059679
991 Ga0496124_0012150
992 Ga0496124_0014108
993 Ga0496124_0026702
994 Ga0496124_0098196
995 Ga0496124_0116832
996 Ga0496125_0000166
997 Ga0496125_0002855
998 Ga0496125_0011729
999 Ga0496125_0020196
1000 Ga0496125_0021514
1001 Ga0496125_0029723
1002 Ga0496126_0031176
1003 Ga0496126_0044376
1004 Ga0496126_0280490
1005 Ga0501249_026488
1006 Ga0501225_0006610
1007 Ga0501262_000681
1008 nmdc:mga03683_58480_c1
1009 nmdc:mga03683_9475_c1
1010 nmdc:mga03n38_108918_c1
1011 nmdc:mga03n38_2356_c1
1012 nmdc:mga00v17_13035_c1
1013 nmdc:mga0k408_24779_c1
1014 nmdc:mga0k408_28690_c1
1015 nmdc:mga0k408_4659_c1
1016 nmdc:mga0k408_70364_c1
1017 nmdc:mga0k408_8638_c1
1018 nmdc:mga06z11_40543_c1
1019 nmdc:mga06z11_57773_c1
1020 nmdc:mga07m45_19058_c1
1021 nmdc:mga07m45_41959_c1
1022 nmdc:mga07m45_8257_c1
1023 nmdc:mga07m45_85857_c1
1024 nmdc:mga0sz30_75984_c1
1025 Ga0495601_0018864
1026 Ga0500610_0008482
1027 Ga0500643_008611
1028 Ga0500651_0000345
1029 Ga0500571_002156
1030 Ga0500593_000864
1031 Ga0500593_003454
1032 Ga0500594_0004886
1033 Ga0500595_001911
1034 Ga0500597_051894
1035 Ga0500607_007464
1036 Ga0500618_000877
1037 Ga0500618_002085
1038 Ga0500618_015056
1039 Ga0500626_070558
1040 Ga0500655_000997
1041 Ga0500658_0000825
1042 Ga0500658_0003061
1043 Ga0500559_0005364
1044 Ga0500559_0027063
1045 Ga0500568_0013585
1046 Ga0500574_000776
1047 Ga0500619_000083
1048 Ga0500622_0001025
1049 Ga0500624_004921
1050 Ga0500634_0031985
1051 Ga0500638_050914
1052 2511248963
1053 2511387485
1054 2513227212
1055 2521557591
1056 2550696240
1057 2553006620
1058 2599627310
1059 2599676725
1060 2599679981
1061 2599691997
1062 2599902613
1063 2643861406
1064 2643979599
1065 2644026698
1066 2644123738
1067 2644160383
1068 2644324779
1069 2644337521
1070 2644396651
1071 2644465238
1072 2738719685
1073 2738879877
1074 2739278884
1075 2765570244
1076 2808984383
1077 2809032963
1078 2809130737
1079 2809149785
1080 2819544237
1081 2819591426
1082 2819600113
1083 2819615269
1084 2831267529
1085 2831865776
1086 2838056034
1087 2839096811
1088 2842678010
1089 2842734523
1090 2842749245
1091 2852620074
1092 2857541709
1093 2858952324
1094 2881105423
1095 2884815608
1096 2884837230
1097 2884853521
1098 2885195419
1099 2885204970
1100 2885218343
1101 2886850990
1102 2886851101
1103 2896155362
1104 2899925948
1105 2904441698
1106 2904450287
1107 2904456891
1108 2904531380
1109 2904544221
1110 2904586965
1111 2904593002
1112 2904603185
1113 2919050980
1114 2919082036
1115 2919463274
1116 2923516289
1117 2928041665
1118 2928049229
1119 2928052164
1120 2928065157
1121 2928076706
1122 2928089180
1123 2928116411
1124 2928135082
1125 2929162207
1126 2929520991
1127 2939631593
1128 2941482807
1129 2945913392
1130 2945948951
1131 2945973061
1132 2945991216
1133 2954773073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

134

277

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l22-assembly1.cif.gz_A prtd t1ss abc transporter 0.2731 9 225
7zc2-assembly1.cif.gz_A dipeptide and tripeptide permease c (dtpc) 0.2703 3 223
7ki0-assembly1.cif.gz_R semaglutide-bound glucagon-like peptide-1 (glp-1) receptor in complex with gs protein 0.2426 36 234
6xox-assembly1.cif.gz_R cryo-em of human glp-1r bound to non-peptide agonist ly3502970 0.2391 35 235
7ki1-assembly1.cif.gz_R taspoglutide-bound glucagon-like peptide-1 (glp-1) receptor in complex with gs protein 0.2334 38 235
ID Description Score Start End Superfamily
af_Q19153_286_501_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3003 2 211 1.20.1640.10
af_Q19153_286_501_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.2658 2 211 1.20.1640.10
af_I1MDI7_1_157_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2645 49 225 1.20.1080.10
af_I1MDI7_1_157_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2438 49 225 1.20.1080.10
af_Q9BXK5_11_208_1.10.437.10 Mainly Alpha;Orthogonal Bundle;Apoptosis Regulator Bcl-x;Blc2-like 0.2376 45 218 1.10.437.10
ID Description Score Start End GO Terms
AF-J3C2T7-F1-model_v4 Sterol desaturase 0.9746 5 331 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-J3C2T7-F1-model_v4 Sterol desaturase 0.9688 5 331 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-G0F0F4-F1-model_v4 C-5 sterol desaturase Erg 0.9684 6 324 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A0U3MSA0-F1-model_v4 Fatty acid hydroxylase superfamily protein 0.9667 6 325 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A7X4GLJ4-F1-model_v4 Fatty acid hydroxylase 0.9652 5 331 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479

Map