F464346

General Info

Members Datasets Scaffolds Average Seq Length
566 281 565 446

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100017908|Ga0068868_1000179082
Length 526
Sequence MLTLAMPVVLAELGWMTMGMVDTLMVGRLGPEAIGAVGVGSSLFMGIVIFAMGLMLGLDALVSRAFGAGDLEACHRWLVHGVTLALVVSLPFMVVLFQIGGALEGWGLAPSVLALTRPYLDALTWSVPPLLLYSAFRRYLQGMGVVKPIMIALAAANVVNLLGNWILIYGHVGAPAMGVRGSAWATVLARMIMAALLXVVILVRERGRRPGLFETPLRVEAPLMRRLIALGLPAASQITLEVGVFASATALAGRLPPAALAAHQIALNIAAFTFMVPLGVASAAAVRVGHAVGRRDLEAASRSGWTAIVVGVTFMMCSALSFLLVPRALIGGFTSDAAVMAIGVRLLTVGAVFQLFDGVQAVATGALRGLGDTRTAMIWNLAGHWFVGLPLGYVLCFGVGVGVVGLWWGLTSGLVICGISLLIAWSRRIAAAPGLLSGADRRHPRMADQNRGIDDTSVPQEENAGQRQSDATPDLVGGREIAPTEMSDRADGRGSDANGTPAFDEVEGEQRRKLYEKGATLVSKID

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.53
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 2.3
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10155563 3300003323 Bacteria 2545
2 Ga0070676_10001662 3300005328 Bacteria 11308
3 Ga0070683_100000004 3300005329 Bacteria 373231
4 Ga0070683_100000107 3300005329 Bacteria 54632
5 Ga0070683_100034706 3300005329 Bacteria 4610
6 Ga0070683_100121931 3300005329 Unclassified 2463
7 Ga0070670_100004258 3300005331 Bacteria 11967
8 Ga0070670_100016672 3300005331 Bacteria 6305
9 Ga0068869_100005430 3300005334 Bacteria 8018
10 Ga0068869_100073784 3300005334 Bacteria 2531
11 Ga0070680_100000986 3300005336 Bacteria 20202
12 Ga0070680_100008929 3300005336 Bacteria 7686
13 Ga0070680_100029999 3300005336 Bacteria 4367
14 Ga0070680_100042235 3300005336 Unclassified 3699
15 Ga0070682_100067618 3300005337 Bacteria 2276
16 Ga0068868_100017093 3300005338 Bacteria 5398
17 Ga0068868_100017908 3300005338 Bacteria 5285
18 Ga0068868_100131240 3300005338 Bacteria 2050
19 Ga0070660_100020559 3300005339 Bacteria 4853
20 Ga0070660_100056574 3300005339 Unclassified 3035
21 Ga0070689_100040610 3300005340 Bacteria 3568
22 Ga0070689_100131636 3300005340 Unclassified 2006
23 Ga0070689_100143464 3300005340 Bacteria 1922
24 Ga0070661_100002247 3300005344 Bacteria 13248
25 Ga0070692_10022267 3300005345 Bacteria 3093
26 Ga0070668_100000787 3300005347 Bacteria 21854
27 Ga0070668_100189031 3300005347 Bacteria 1686
28 Ga0070669_100000315 3300005353 Bacteria 37863
29 Ga0070669_100070631 3300005353 Bacteria 2582
30 Ga0070675_100010538 3300005354 Bacteria 7222
31 Ga0070675_100021287 3300005354 Bacteria 5181
32 Ga0070671_100079825 3300005355 Bacteria 2735
33 Ga0070671_100221410 3300005355 Bacteria 1605
34 Ga0070671_100236264 3300005355 Bacteria 1551
35 Ga0070674_100035964 3300005356 Bacteria 3321
36 Ga0070674_100077647 3300005356 Bacteria 2364
37 Ga0070688_100012517 3300005365 Bacteria 4754
38 Ga0070659_100029355 3300005366 Bacteria 4250
39 Ga0070659_100100268 3300005366 Bacteria 2330
40 Ga0070659_100219970 3300005366 Bacteria 1567
41 Ga0070667_100012957 3300005367 Bacteria 6894
42 Ga0070667_100032041 3300005367 Bacteria 4383
43 Ga0070667_100179386 3300005367 Bacteria 1873
44 Ga0070714_100097213 3300005435 Bacteria 2588
45 Ga0070713_100066366 3300005436 Bacteria 3034
46 Ga0070713_100076145 3300005436 Bacteria 2848
47 Ga0070711_100004181 3300005439 Bacteria 8480
48 Ga0070711_100212013 3300005439 Bacteria 1500
49 Ga0070700_100027192 3300005441 Bacteria 3389
50 Ga0070700_100046918 3300005441 Bacteria 2671
51 Ga0070700_100141036 3300005441 Bacteria 1638
52 Ga0070694_100014822 3300005444 Bacteria 4883
53 Ga0070694_100112206 3300005444 Bacteria 1944
54 Ga0070708_100002984 3300005445 Bacteria 13148
55 Ga0070663_100031200 3300005455 Bacteria 3661
56 Ga0070678_100050568 3300005456 Bacteria 3008
57 Ga0070681_10002927 3300005458 Bacteria 15821
58 Ga0070681_10004893 3300005458 Bacteria 12853
59 Ga0070681_10019728 3300005458 Bacteria 6752
60 Ga0070681_10051668 3300005458 Bacteria 4100
61 Ga0070681_10054910 3300005458 Bacteria 3968
62 Ga0070681_10123975 3300005458 Bacteria 2516
63 Ga0070681_10293983 3300005458 Unclassified 1534
64 Ga0070685_10029149 3300005466 Bacteria 3063
65 Ga0070685_10080402 3300005466 Bacteria 1953
66 Ga0070706_100000188 3300005467 Bacteria 78186
67 Ga0070699_100034241 3300005518 Bacteria 4390
68 Ga0070679_100002414 3300005530 Bacteria 16929
69 Ga0070679_100007054 3300005530 Bacteria 10481
70 Ga0070679_100056537 3300005530 Bacteria 3909
71 Ga0070679_100068183 3300005530 Bacteria 3549
72 Ga0070684_100000009 3300005535 Bacteria 209881
73 Ga0070684_100000837 3300005535 Bacteria 21638
74 Ga0070684_100039674 3300005535 Bacteria 4052
75 Ga0070684_100043761 3300005535 Bacteria 3869
76 Ga0070697_100000146 3300005536 Bacteria 57392
77 Ga0070697_100009629 3300005536 Bacteria 7548
78 Ga0068853_100098757 3300005539 Bacteria 2578
79 Ga0068853_100194835 3300005539 Bacteria 1842
80 Ga0070672_100008057 3300005543 Bacteria 7198
81 Ga0070672_100160069 3300005543 Bacteria 1867
82 Ga0070696_100000158 3300005546 Bacteria 37863
83 Ga0070665_100030763 3300005548 Bacteria 5402
84 Ga0070665_100034346 3300005548 Bacteria 5100
85 Ga0070665_100036891 3300005548 Bacteria 4915
86 Ga0070665_100039697 3300005548 Bacteria 4733
87 Ga0070665_100218372 3300005548 Bacteria 1907
88 Ga0070704_100017967 3300005549 Bacteria 4511
89 Ga0068855_100007977 3300005563 Bacteria 12790
90 Ga0068855_100033716 3300005563 Bacteria 6108
91 Ga0068855_100060273 3300005563 Bacteria 4439
92 Ga0068855_100066136 3300005563 Bacteria 4214
93 Ga0068855_100207310 3300005563 Bacteria 2205
94 Ga0070664_100000303 3300005564 Bacteria 35797
95 Ga0070664_100002537 3300005564 Bacteria 14728
96 Ga0068857_100002675 3300005577 Bacteria 14628
97 Ga0068857_100002944 3300005577 Bacteria 14029
98 Ga0068857_100005907 3300005577 Bacteria 10454
99 Ga0068857_100028605 3300005577 Bacteria 4918
100 Ga0068854_100140025 3300005578 Unclassified 1856
101 Ga0068856_100015831 3300005614 Bacteria 7293
102 Ga0068856_100041904 3300005614 Bacteria 4501
103 Ga0068856_100085184 3300005614 Bacteria 3140
104 Ga0068856_100109030 3300005614 Bacteria 2765
105 Ga0068856_100221633 3300005614 Unclassified 1907
106 Ga0068852_100004445 3300005616 Bacteria 9910
107 Ga0068852_100014322 3300005616 Bacteria 6100
108 Ga0068852_100183373 3300005616 Bacteria 1970
109 Ga0068859_100060194 3300005617 Bacteria 3826
110 Ga0068859_100062331 3300005617 Bacteria 3759
111 Ga0068859_100115181 3300005617 Bacteria 2753
112 Ga0068864_100004735 3300005618 Bacteria 11145
113 Ga0068864_100124152 3300005618 Bacteria 2311
114 Ga0068866_10032363 3300005718 Bacteria 2528
115 Ga0068861_100000535 3300005719 Bacteria 22271
116 Ga0068861_100001808 3300005719 Bacteria 13774
117 Ga0068861_100113590 3300005719 Bacteria 2173
118 Ga0068870_10001490 3300005840 Bacteria 9481
119 Ga0068863_100013797 3300005841 Bacteria 7787
120 Ga0068863_100041886 3300005841 Bacteria 4353
121 Ga0068863_100050770 3300005841 Bacteria 3931
122 Ga0068863_100058121 3300005841 Bacteria 3661
123 Ga0068863_100077745 3300005841 Bacteria 3141
124 Ga0068863_100211332 3300005841 Bacteria 1868
125 Ga0068858_100002229 3300005842 Bacteria 19593
126 Ga0068858_100080193 3300005842 Bacteria 3033
127 Ga0068858_100302201 3300005842 Bacteria 1527
128 Ga0068860_100002295 3300005843 Bacteria 20100
129 Ga0068860_100007566 3300005843 Bacteria 10869
130 Ga0068862_100000532 3300005844 Bacteria 39799
131 Ga0068862_100005713 3300005844 Bacteria 10379
132 Ga0068862_100054971 3300005844 Bacteria 3409
133 Ga0081455_10025848 3300005937 Bacteria 5412
134 Ga0081455_10030549 3300005937 Bacteria 4892
135 Ga0081455_10154373 3300005937 Bacteria 1767
136 Ga0081540_1007681 3300005983 Bacteria 7645
137 Ga0081540_1044275 3300005983 Bacteria 2273
138 Ga0070717_10013140 3300006028 Bacteria 6329
139 Ga0070712_100000450 3300006175 Bacteria 23564
140 Ga0075367_10023965 3300006178 Bacteria 3439
141 Ga0075367_10109536 3300006178 Bacteria 1694
142 Ga0075366_10007763 3300006195 Bacteria 5939
143 Ga0075366_10120583 3300006195 Unclassified 1580
144 Ga0097621_100064398 3300006237 Bacteria 3015
145 Ga0075370_10025508 3300006353 Bacteria 3271
146 Ga0068871_100099564 3300006358 Bacteria 2434
147 Ga0068871_100228512 3300006358 Bacteria 1614
148 Ga0075428_100009967 3300006844 Bacteria 10557
149 Ga0075428_100064338 3300006844 Bacteria 4016
150 Ga0075428_100119558 3300006844 Bacteria 2868
151 Ga0075428_100153638 3300006844 Bacteria 2500
152 Ga0075428_100179758 3300006844 Bacteria 2290
153 Ga0075431_100028185 3300006847 Bacteria 5767
154 Ga0075433_10011530 3300006852 Bacteria 7119
155 Ga0075433_10022821 3300006852 Bacteria 5258
156 Ga0075433_10141301 3300006852 Bacteria 2140
157 Ga0075433_10164104 3300006852 Bacteria 1977
158 Ga0075433_10257571 3300006852 Bacteria 1547
159 Ga0075434_100027070 3300006871 Bacteria 5627
160 Ga0075434_100069545 3300006871 Bacteria 3510
161 Ga0075434_100075943 3300006871 Bacteria 3355
162 Ga0075434_100096590 3300006871 Bacteria 2960
163 Ga0075434_100105404 3300006871 Bacteria 2829
164 Ga0075434_100121121 3300006871 Bacteria 2632
165 Ga0075429_100044536 3300006880 Bacteria 3860
166 Ga0075429_100085567 3300006880 Bacteria 2748
167 Ga0075429_100104424 3300006880 Bacteria 2475
168 Ga0068865_100179176 3300006881 Bacteria 1631
169 Ga0075436_100018868 3300006914 Unclassified 4723
170 Ga0075436_100055704 3300006914 Bacteria 2731
171 Ga0097620_100060192 3300006931 Bacteria 3826
172 Ga0097620_100062331 3300006931 Bacteria 3759
173 Ga0097620_100115180 3300006931 Bacteria 2753
174 Ga0075435_100108856 3300007076 Bacteria 2303
175 Ga0099794_10003184 3300007265 Bacteria 6221
176 Ga0105240_10004254 3300009093 Bacteria 21890
177 Ga0105240_10024079 3300009093 Bacteria 8038
178 Ga0105240_10044941 3300009093 Bacteria 5606
179 Ga0105240_10147513 3300009093 Bacteria 2805
180 Ga0111539_10002814 3300009094 Bacteria 23108
181 Ga0111539_10013257 3300009094 Bacteria 10305
182 Ga0111539_10137530 3300009094 Bacteria 2861
183 Ga0111539_10144005 3300009094 Bacteria 2790
184 Ga0111539_10191232 3300009094 Bacteria 2388
185 Ga0111539_10252315 3300009094 Bacteria 2054
186 Ga0105245_10011422 3300009098 Bacteria 7733
187 Ga0105245_10047675 3300009098 Bacteria 3830
188 Ga0105245_10081326 3300009098 Bacteria 2961
189 Ga0105245_10092678 3300009098 Bacteria 2782
190 Ga0105245_10112731 3300009098 Unclassified 2531
191 Ga0105245_10141748 3300009098 Bacteria 2264
192 Ga0114129_10017690 3300009147 Bacteria 10147
193 Ga0114129_10031623 3300009147 Bacteria 7481
194 Ga0114129_10049576 3300009147 Bacteria 5899
195 Ga0114129_10319180 3300009147 Bacteria 2065
196 Ga0105241_10039492 3300009174 Bacteria 3560
197 Ga0105241_10118178 3300009174 Unclassified 2131
198 Ga0105241_10141160 3300009174 Bacteria 1961
199 Ga0105242_10235104 3300009176 Bacteria 1644
200 Ga0105248_10010899 3300009177 Bacteria 10030
201 Ga0105248_10015951 3300009177 Bacteria 8273
202 Ga0105248_10021187 3300009177 Bacteria 7202
203 Ga0105248_10041438 3300009177 Bacteria 5162
204 Ga0105248_10053778 3300009177 Bacteria 4517
205 Ga0105248_10162913 3300009177 Bacteria 2515
206 Ga0105237_10058503 3300009545 Bacteria 3857
207 Ga0105237_10148042 3300009545 Bacteria 2343
208 Ga0105238_10042838 3300009551 Bacteria 4582
209 Ga0105249_10000075 3300009553 Bacteria 145150
210 Ga0105249_10001616 3300009553 Bacteria 19734
211 Ga0105249_10003487 3300009553 Bacteria 13628
212 Ga0105249_10018855 3300009553 Bacteria 6149
213 Ga0105249_10153129 3300009553 Bacteria 2221
214 Ga0105239_10003833 3300010375 Bacteria 18263
215 Ga0105239_10004471 3300010375 Bacteria 16709
216 Ga0105239_10064265 3300010375 Bacteria 4029
217 Ga0157373_10154120 3300013100 Unclassified 1617
218 Ga0157373_10180165 3300013100 Unclassified 1487
219 Ga0157371_10158047 3300013102 Bacteria 1618
220 Ga0157370_10001248 3300013104 Bacteria 31761
221 Ga0157370_10002893 3300013104 Bacteria 20474
222 Ga0157370_10002972 3300013104 Bacteria 20158
223 Ga0157370_10051500 3300013104 Bacteria 3933
224 Ga0157370_10119837 3300013104 Bacteria 2457
225 Ga0157370_10256605 3300013104 Bacteria 1616
226 Ga0157369_10008063 3300013105 Bacteria 12078
227 Ga0157369_10054644 3300013105 Bacteria 4312
228 Ga0157369_10222162 3300013105 Bacteria 1977
229 Ga0157374_10011135 3300013296 Bacteria 7775
230 Ga0157374_10013301 3300013296 Bacteria 7180
231 Ga0157374_10020961 3300013296 Bacteria 5807
232 Ga0157378_10033360 3300013297 Unclassified 4550
233 Ga0163162_10005049 3300013306 Bacteria 12716
234 Ga0163162_10016179 3300013306 Bacteria 7294
235 Ga0157372_10000636 3300013307 Bacteria 38481
236 Ga0157372_10023277 3300013307 Bacteria 6714
237 Ga0157372_10068546 3300013307 Bacteria 3988
238 Ga0157372_10132573 3300013307 Bacteria 2868
239 Ga0157372_10187236 3300013307 Bacteria 2397
240 Ga0157372_10275023 3300013307 Bacteria 1957
241 Ga0157375_10001896 3300013308 Bacteria 17977
242 Ga0163163_10054577 3300014325 Bacteria 3948
243 Ga0163163_10103201 3300014325 Bacteria 2876
244 Ga0163163_10283404 3300014325 Unclassified 1709
245 Ga0163163_10290497 3300014325 Bacteria 1687
246 Ga0157380_10031126 3300014326 Bacteria 4094
247 Ga0157380_10053361 3300014326 Bacteria 3205
248 Ga0157379_10000377 3300014968 Bacteria 36018
249 Ga0157379_10004256 3300014968 Bacteria 12220
250 Ga0157379_10035045 3300014968 Bacteria 4474
251 Ga0157376_10023071 3300014969 Bacteria 4864
252 Ga0157376_10070801 3300014969 Bacteria 2961
253 Ga0213872_10001135 3300021361 Bacteria 18210
254 Ga0213876_10006068 3300021384 Bacteria 6603
255 Ga0213875_10000764 3300021388 Bacteria 24218
256 Ga0228598_1000011 3300024227 Bacteria 26445
257 Ga0209437_101450 3300025233 Bacteria 5770
258 Ga0207697_10001044 3300025315 Bacteria 15356
259 Ga0207697_10031479 3300025315 Bacteria 2170
260 Ga0207682_10036932 3300025893 Unclassified 1978
261 Ga0207688_10121980 3300025901 Bacteria 1521
262 Ga0207680_10047111 3300025903 Bacteria 2552
263 Ga0207699_10112903 3300025906 Unclassified 1744
264 Ga0207645_10000294 3300025907 Bacteria 41976
265 Ga0207643_10001203 3300025908 Bacteria 15301
266 Ga0207684_10001145 3300025910 Bacteria 29602
267 Ga0207654_10018384 3300025911 Bacteria 3666
268 Ga0207707_10002005 3300025912 Bacteria 18476
269 Ga0207707_10005331 3300025912 Bacteria 11237
270 Ga0207707_10045503 3300025912 Bacteria 3824
271 Ga0207695_10011850 3300025913 Bacteria 10517
272 Ga0207695_10019230 3300025913 Bacteria 7866
273 Ga0207671_10030165 3300025914 Bacteria 4045
274 Ga0207671_10078083 3300025914 Bacteria 2479
275 Ga0207693_10000740 3300025915 Bacteria 29433
276 Ga0207663_10001920 3300025916 Bacteria 9844
277 Ga0207660_10003975 3300025917 Bacteria 9635
278 Ga0207660_10010784 3300025917 Bacteria 5939
279 Ga0207660_10174626 3300025917 Bacteria 1665
280 Ga0207662_10001571 3300025918 Bacteria 11178
281 Ga0207657_10007399 3300025919 Bacteria 11261
282 Ga0207657_10086093 3300025919 Bacteria 2631
283 Ga0207657_10179881 3300025919 Unclassified 1710
284 Ga0207649_10006940 3300025920 Bacteria 6156
285 Ga0207649_10016840 3300025920 Bacteria 4134
286 Ga0207652_10016114 3300025921 Bacteria 6096
287 Ga0207652_10025118 3300025921 Bacteria 4950
288 Ga0207652_10053417 3300025921 Unclassified 3470
289 Ga0207681_10002911 3300025923 Bacteria 10813
290 Ga0207681_10003187 3300025923 Bacteria 10297
291 Ga0207681_10009430 3300025923 Bacteria 5965
292 Ga0207694_10045311 3300025924 Bacteria 3397
293 Ga0207694_10096491 3300025924 Bacteria 2338
294 Ga0207650_10146621 3300025925 Bacteria 1859
295 Ga0207650_10211553 3300025925 Bacteria 1557
296 Ga0207659_10097554 3300025926 Bacteria 2208
297 Ga0207659_10131124 3300025926 Bacteria 1935
298 Ga0207687_10056683 3300025927 Bacteria 2749
299 Ga0207687_10176455 3300025927 Bacteria 1652
300 Ga0207700_10053104 3300025928 Bacteria 3034
301 Ga0207664_10060266 3300025929 Bacteria 3024
302 Ga0207664_10203013 3300025929 Bacteria 1712
303 Ga0207644_10026555 3300025931 Bacteria 3991
304 Ga0207690_10027692 3300025932 Bacteria 3583
305 Ga0207690_10028889 3300025932 Bacteria 3519
306 Ga0207690_10033141 3300025932 Bacteria 3320
307 Ga0207706_10000472 3300025933 Bacteria 43032
308 Ga0207686_10029822 3300025934 Bacteria 3223
309 Ga0207669_10006981 3300025937 Bacteria 5195
310 Ga0207665_10020845 3300025939 Bacteria 4309
311 Ga0207691_10000248 3300025940 Bacteria 53460
312 Ga0207691_10050361 3300025940 Bacteria 3813
313 Ga0207691_10077693 3300025940 Bacteria 2990
314 Ga0207711_10089500 3300025941 Bacteria 2705
315 Ga0207711_10185194 3300025941 Bacteria 1895
316 Ga0207689_10000810 3300025942 Bacteria 30206
317 Ga0207661_10000017 3300025944 Bacteria 289163
318 Ga0207661_10327251 3300025944 Unclassified 1379
319 Ga0207679_10002710 3300025945 Bacteria 10955
320 Ga0207679_10015334 3300025945 Bacteria 5061
321 Ga0207679_10077234 3300025945 Bacteria 2532
322 Ga0207667_10000814 3300025949 Bacteria 40498
323 Ga0207667_10033625 3300025949 Bacteria 5511
324 Ga0207667_10076950 3300025949 Bacteria 3462
325 Ga0207667_10081857 3300025949 Bacteria 3344
326 Ga0207667_10283136 3300025949 Bacteria 1694
327 Ga0207712_10001640 3300025961 Bacteria 15074
328 Ga0207712_10001936 3300025961 Bacteria 13605
329 Ga0207712_10003750 3300025961 Bacteria 9591
330 Ga0207668_10027203 3300025972 Bacteria 3724
331 Ga0207668_10163687 3300025972 Bacteria 1736
332 Ga0207658_10238448 3300025986 Bacteria 1539
333 Ga0207677_10012606 3300026023 Bacteria 4869
334 Ga0207677_10052830 3300026023 Bacteria 2763
335 Ga0207703_10029945 3300026035 Bacteria 4298
336 Ga0207708_10062825 3300026075 Bacteria 2837
337 Ga0207702_10047500 3300026078 Bacteria 3618
338 Ga0207702_10058122 3300026078 Bacteria 3290
339 Ga0207702_10083166 3300026078 Bacteria 2785
340 Ga0207641_10042241 3300026088 Bacteria 3824
341 Ga0207641_10131123 3300026088 Bacteria 2251
342 Ga0207648_10015089 3300026089 Bacteria 7113
343 Ga0207648_10016684 3300026089 Bacteria 6701
344 Ga0207676_10134835 3300026095 Bacteria 2105
345 Ga0207674_10001081 3300026116 Bacteria 35413
346 Ga0207674_10010697 3300026116 Bacteria 10364
347 Ga0207674_10018383 3300026116 Bacteria 7599
348 Ga0207674_10032332 3300026116 Bacteria 5489
349 Ga0207675_100000373 3300026118 Bacteria 43010
350 Ga0207675_100008014 3300026118 Bacteria 9957
351 Ga0207675_100036082 3300026118 Bacteria 4611
352 Ga0207675_100068305 3300026118 Bacteria 3322
353 Ga0207698_10008821 3300026142 Bacteria 6391
354 Ga0207698_10012808 3300026142 Bacteria 5507
355 Ga0207698_10019143 3300026142 Bacteria 4680
356 Ga0207698_10150211 3300026142 Bacteria 2021
357 Ga0207698_10226952 3300026142 Unclassified 1692
358 Ga0207428_10005106 3300027907 Bacteria 12320
359 Ga0207428_10006382 3300027907 Bacteria 10898
360 Ga0207428_10026033 3300027907 Bacteria 4887
361 Ga0268266_10019916 3300028379 Bacteria 5717
362 Ga0268265_10002731 3300028380 Bacteria 13047
363 Ga0268265_10007702 3300028380 Bacteria 7266
364 Ga0268265_10061222 3300028380 Bacteria 2888
365 Ga0268264_10008130 3300028381 Bacteria 8720
366 Ga0268264_10043664 3300028381 Bacteria 3716
367 Ga0265323_10000578 3300028653 Bacteria 20270
368 Ga0265770_1000931 3300030878 Bacteria 4053
369 Ga0265760_10010248 3300031090 Bacteria 2674
370 Ga0265760_10020308 3300031090 Bacteria 1917
371 Ga0265330_10040056 3300031235 Bacteria 2081
372 Ga0265332_10008447 3300031238 Bacteria 4627
373 Ga0265320_10048767 3300031240 Unclassified 2065
374 Ga0265339_10001474 3300031249 Bacteria 17384
375 Ga0265316_10093482 3300031344 Bacteria 2291
376 Ga0307408_100002025 3300031548 Bacteria 14622
377 Ga0307408_100032799 3300031548 Bacteria 3623
378 Ga0265314_10000265 3300031711 Bacteria 76736
379 Ga0265314_10003899 3300031711 Bacteria 14177
380 Ga0265314_10037637 3300031711 Unclassified 3504
381 Ga0265342_10020643 3300031712 Bacteria 4219
382 Ga0307405_10024888 3300031731 Bacteria 3428
383 Ga0307405_10060463 3300031731 Bacteria 2391
384 Ga0307410_10014301 3300031852 Bacteria 4666
385 Ga0307410_10030587 3300031852 Bacteria 3443
386 Ga0307410_10036042 3300031852 Unclassified 3218
387 Ga0307410_10069903 3300031852 Bacteria 2430
388 Ga0307406_10008031 3300031901 Bacteria 5875
389 Ga0307407_10098157 3300031903 Unclassified 1812
390 Ga0307407_10110674 3300031903 Bacteria 1723
391 Ga0307409_100053360 3300031995 Bacteria 3106
392 Ga0307409_100098095 3300031995 Bacteria 2422
393 Ga0307416_100068852 3300032002 Unclassified 2926
394 Ga0307416_100191291 3300032002 Unclassified 1930
395 Ga0307414_10026853 3300032004 Bacteria 3711
396 Ga0307411_10025449 3300032005 Bacteria 3546
397 Ga0307415_100012860 3300032126 Bacteria 4859
398 Ga0307415_100092788 3300032126 Bacteria 2190
399 Ga0307415_100192150 3300032126 Bacteria 1612
400 Ga0307507_10023294 3300033179 Bacteria 6803
401 Ga0373926_0034429 3300035083 Bacteria 1793
402 Ga0373945_0044208 3300035116 Unclassified 1619
403 Ga0373935_0015892 3300035692 Bacteria 4555
404 Ga0373927_0029269 3300035695 Bacteria 3589
405 Ga0373947_0000515 3300035725 Bacteria 22532
406 Ga0373947_0007766 3300035725 Bacteria 6197
407 Ga0373947_0058334 3300035725 Unclassified 2339
408 Ga0373947_0058719 3300035725 Bacteria 2331
409 Ga0373947_0075713 3300035725 Bacteria 2073
410 Ga0316582_0071653 3300036647 Bacteria 2245
411 Ga0373925_0000805 3300037068 Bacteria 28892
412 Ga0373925_0005848 3300037068 Bacteria 9123
413 Ga0373925_0011291 3300037068 Bacteria 6480
414 Ga0373925_0053576 3300037068 Bacteria 3016
415 Ga0373925_0056398 3300037068 Bacteria 2943
416 Ga0395900_0084751 3300037418 Bacteria 3257
417 Ga0395900_0179252 3300037418 Bacteria 2154
418 Ga0395898_0089512 3300037466 Bacteria 2962
419 Ga0395905_0001469 3300037471 Bacteria 28257
420 Ga0395905_0002922 3300037471 Bacteria 18626
421 Ga0395905_0013165 3300037471 Bacteria 7939
422 Ga0395905_0026517 3300037471 Bacteria 5463
423 Ga0395905_0029454 3300037471 Bacteria 5172
424 Ga0395905_0291737 3300037471 Unclassified 1518
425 Ga0436364_0165597 3300037853 Bacteria 24805
426 Ga0436364_0419311 3300037853 Bacteria 3408
427 Ga0395901_0099465 3300038443 Bacteria 3050
428 Ga0395901_0153709 3300038443 Unclassified 2417
429 Ga0436365_0102863 3300039437 Bacteria 1830
430 Ga0436365_0887495 3300039437 Bacteria 13822
431 Ga0436365_1128249 3300039437 Unclassified 2898
432 Ga0436360_0731860 3300039438 Bacteria 7720
433 Ga0436361_0596240 3300039447 Bacteria 18495
434 Ga0436363_1248950 3300039450 Bacteria 9096
435 Ga0450923_003199 3300042125 Bacteria 2444
436 Ga0451577_0012747 3300042876 Bacteria 7886
437 Ga0466961_0081450 3300044693 Bacteria 2048
438 Ga0466963_0004370 3300044694 Bacteria 8209
439 Ga0466963_0102205 3300044694 Unclassified 1963
440 Ga0466964_0082304 3300044706 Unclassified 1384
441 Ga0453684_0139684 3300044712 Bacteria 2895
442 Ga0466957_0000211 3300044842 Bacteria 27323
443 Ga0466957_0047820 3300044842 Bacteria 2600
444 Ga0451576_0051303 3300045051 Archaea 4325
445 Ga0466958_0135745 3300045836 Bacteria 1547
446 Ga0466967_0270362 3300045976 Bacteria 1629
447 Ga0495638_0012569 3300046460 Bacteria 5795
448 Ga0495641_0046971 3300046461 Bacteria 1983
449 Ga0495580_0001952 3300046472 Bacteria 18101
450 Ga0495580_0004381 3300046472 Bacteria 11858
451 Ga0495580_0040622 3300046472 Bacteria 3322
452 Ga0495580_0046872 3300046472 Bacteria 3065
453 Ga0495580_0048686 3300046472 Bacteria 2999
454 Ga0495582_0018018 3300046473 Bacteria 3861
455 Ga0495664_0027369 3300046477 Bacteria 3324
456 Ga0495664_0040101 3300046477 Bacteria 2768
457 Ga0495594_0051796 3300046499 Bacteria 2259
458 Ga0495631_0090071 3300046518 Bacteria 1321
459 Ga0495652_0199931 3300046529 Bacteria 1517
460 Ga0495665_0017121 3300046531 Bacteria 3899
461 Ga0495640_0045916 3300046533 Bacteria 3030
462 Ga0495586_0053910 3300046535 Bacteria 2179
463 Ga0495598_0004375 3300046537 Bacteria 3054
464 Ga0495645_0002242 3300046543 Bacteria 13150
465 Ga0495635_0030952 3300046663 Bacteria 3717
466 Ga0495588_0013246 3300046674 Bacteria 3925
467 Ga0495599_0061093 3300046678 Bacteria 2355
468 Ga0495623_0042029 3300046679 Bacteria 2914
469 Ga0495658_0021335 3300046683 Bacteria 3414
470 Ga0495669_0002195 3300046684 Bacteria 8011
471 Ga0495613_0161819 3300046689 Bacteria 1592
472 Ga0495624_0019818 3300046690 Bacteria 4482
473 Ga0495636_0020276 3300047318 Bacteria 2679
474 Ga0495674_0011676 3300047319 Bacteria 8285
475 Ga0495674_0103697 3300047319 Bacteria 2418
476 Ga0495676_0019273 3300047321 Bacteria 6003
477 Ga0495680_0176547 3300047322 Bacteria 1544
478 Ga0495675_0004864 3300047444 Bacteria 8173
479 Ga0495675_0033858 3300047444 Unclassified 3261
480 Ga0495684_0000834 3300047471 Bacteria 24968
481 Ga0495686_0009251 3300047472 Bacteria 7119
482 Ga0495602_0025838 3300048088 Bacteria 5677
483 Ga0496102_0422483 3300048905 Bacteria 1252
484 Ga0496104_0001482 3300048907 Bacteria 20248
485 Ga0496104_0246631 3300048907 Bacteria 1699
486 Ga0496105_0014831 3300048908 Bacteria 6204
487 Ga0496108_0000282 3300048911 Bacteria 43586
488 Ga0496109_0003251 3300048912 Bacteria 13544
489 Ga0496110_0011781 3300048913 Bacteria 7177
490 Ga0496110_0118054 3300048913 Bacteria 2389
491 Ga0496111_0000460 3300048914 Bacteria 20673
492 Ga0496112_0001067 3300048915 Bacteria 20244
493 Ga0496112_0067014 3300048915 Bacteria 3542
494 Ga0496112_0184138 3300048915 Bacteria 2052
495 Ga0496115_0015481 3300048918 Bacteria 5786
496 Ga0496126_0000012 3300048929 Bacteria 727789
497 Ga0501033_0066662 3300049570 Unclassified 2647
498 Ga0501034_0188202 3300049571 Bacteria 2027
499 Ga0501038_0140629 3300049574 Bacteria 1975
500 Ga0501038_0194572 3300049574 Bacteria 1630
501 Ga0501040_0021280 3300049576 Bacteria 4330
502 Ga0501043_0113724 3300049579 Bacteria 2125
503 Ga0501047_0012968 3300049581 Bacteria 7891
504 Ga0501047_0016610 3300049581 Bacteria 7027
505 Ga0501047_0150093 3300049581 Bacteria 2207
506 Ga0501071_0014003 3300049587 Bacteria 5480
507 Ga0501072_0013363 3300049588 Bacteria 6285
508 Ga0501072_0130510 3300049588 Bacteria 2003
509 Ga0501073_0011518 3300049589 Bacteria 6467
510 Ga0501075_0016115 3300049591 Bacteria 5379
511 Ga0501075_0026433 3300049591 Bacteria 4273
512 Ga0501076_0027275 3300049592 Bacteria 4430
513 Ga0501076_0067571 3300049592 Bacteria 2854
514 Ga0501076_0078159 3300049592 Bacteria 2655
515 Ga0501076_0085279 3300049592 Bacteria 2538
516 Ga0501076_0098618 3300049592 Bacteria 2354
517 Ga0501077_0006966 3300049593 Bacteria 6964
518 Ga0501077_0065403 3300049593 Bacteria 2306
519 Ga0501079_0119727 3300049741 Bacteria 2047
520 Ga0501081_0059640 3300049743 Unclassified 2642
521 Ga0501081_0071743 3300049743 Bacteria 2415
522 Ga0501035_0005699 3300049822 Bacteria 11753
523 Ga0501035_0081860 3300049822 Bacteria 2849
524 Ga0501035_0153904 3300049822 Bacteria 1994
525 Ga0501044_0000391 3300049823 Bacteria 54344
526 Ga0501044_0001179 3300049823 Bacteria 30978
527 Ga0501044_0005369 3300049823 Bacteria 14241
528 Ga0501045_0004716 3300049824 Bacteria 9410
529 Ga0501045_0069252 3300049824 Bacteria 2593
530 nmdc:mga00v17_59311_c1 3300050491 Bacteria 2348
531 nmdc:mga0k408_45932_c1 3300050493 Bacteria 2521
532 nmdc:mga0k408_7210_c1 3300050493 Bacteria 4243
533 nmdc:mga04h51_34753_c1 3300050495 Bacteria 1612
534 nmdc:mga07m45_26394_c1 3300050496 Bacteria 3193
535 nmdc:mga05p37_128956_c1 3300050507 Bacteria 3105
536 nmdc:mga05p37_7289_c1 3300050507 Bacteria 13048
537 nmdc:mga05p37_87053_c1 3300050507 Bacteria 3098
538 nmdc:mga0qj67_81065_c1 3300050509 Unclassified 2601
539 nmdc:mga06r32_122420_c1 3300050510 Bacteria 2567
540 nmdc:mga06r32_59853_c1 3300050510 Bacteria 2989
541 nmdc:mga08y16_137997_c1 3300050511 Bacteria 2535
542 nmdc:mga08y16_41120_c1 3300050511 Bacteria 4843
543 nmdc:mga08y16_48370_c1 3300050511 Bacteria 4451
544 nmdc:mga08y16_7848_c1 3300050511 Bacteria 11180
545 nmdc:mga0n895_11757_c1 3300050512 Bacteria 7824
546 nmdc:mga0n895_122336_c1 3300050512 Bacteria 2624
547 nmdc:mga0n895_124571_c1 3300050512 Bacteria 2600
548 nmdc:mga0n895_131547_c1 3300050512 Bacteria 2527
549 nmdc:mga0n895_19591_c1 3300050512 Bacteria 6290
550 nmdc:mga0n895_67720_c1 3300050512 Bacteria 3536
551 nmdc:mga0a205_14407_c1 3300050515 Unclassified 2002
552 nmdc:mga0a205_146529_c1 3300050515 Bacteria 2261
553 nmdc:mga0a205_35212_c2 3300050515 Bacteria 2598
554 nmdc:mga0a205_73367_c2 3300050515 Bacteria 2097
555 nmdc:mga0a205_7790_c1 3300050515 Bacteria 9724
556 Ga0495612_0009486 3300053078 Bacteria 3947
557 Ga0495619_0101806 3300053085 Bacteria 1956
558 Ga0500643_000001 3300053087 Bacteria 1440111
559 Ga0500616_0007013 3300053153 Bacteria 7235
560 Ga0501084_0019109 3300054114 Bacteria 5707
561 Ga0501084_0291196 3300054114 Bacteria 1379
562 Ga0590074_000647 3300059423 Bacteria 5252
563 Ga0590077_000251 3300059426 Bacteria 15342
564 Ga0501082_0000586 3300060353 Bacteria 32220
565 Ga0530510_0021950 3300061734 Bacteria 4544

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046518 Ga0495631_0090071 Ga0495631_0090071_20_1177 331
2 3300048905 Ga0496102_0422483 Ga0496102_0422483_11_1177 359
3 3300013307 Ga0157372_10275023 Ga0157372_102750232 371
4 3300006028 Ga0070717_10013140 Ga0070717_100131408 373
5 3300014968 Ga0157379_10000377 Ga0157379_1000037725 381
6 3300024227 Ga0228598_1000011 Ga0228598_10000116 381
7 3300025949 Ga0207667_10076950 Ga0207667_100769503 386
8 3300006237 Ga0097621_100064398 Ga0097621_1000643985 393
9 3300005548 Ga0070665_100036891 Ga0070665_1000368914 394
10 3300033179 Ga0307507_10023294 Ga0307507_100232946 395
11 3300005329 Ga0070683_100000004 Ga0070683_100000004190 396
12 3300005535 Ga0070684_100000009 Ga0070684_1000000092 396
13 3300025944 Ga0207661_10000017 Ga0207661_10000017109 396
14 3300035725 Ga0373947_0075713 Ga0373947_0075713_632_2041 396
15 3300050493 nmdc:mga0k408_45932_c1 nmdc:mga0k408_45932_c1_245_1630 396
16 3300053087 Ga0500643_000001 Ga0500643_000001_151049_152446 396
17 3300009094 Ga0111539_10144005 Ga0111539_101440053 397
18 3300036647 Ga0316582_0071653 Ga0316582_0071653_633_2030 398
19 3300053153 Ga0500616_0007013 Ga0500616_0007013_5325_6722 398
20 3300005340 Ga0070689_100143464 Ga0070689_1001434641 399
21 3300005466 Ga0070685_10080402 Ga0070685_100804022 399
22 3300005617 Ga0068859_100060194 Ga0068859_1000601942 399
23 3300006931 Ga0097620_100060192 Ga0097620_1000601922 399
24 3300005353 Ga0070669_100000315 Ga0070669_10000031530 400
25 3300005441 Ga0070700_100141036 Ga0070700_1001410362 400
26 3300005543 Ga0070672_100160069 Ga0070672_1001600693 400
27 3300005844 Ga0068862_100005713 Ga0068862_1000057136 400
28 3300009094 Ga0111539_10002814 Ga0111539_100028145 400
29 3300009553 Ga0105249_10001616 Ga0105249_1000161615 400
30 3300025923 Ga0207681_10002911 Ga0207681_100029115 400
31 3300025940 Ga0207691_10077693 Ga0207691_100776933 400
32 3300025961 Ga0207712_10003750 Ga0207712_100037503 400
33 3300026095 Ga0207676_10134835 Ga0207676_101348353 400
34 3300027907 Ga0207428_10005106 Ga0207428_1000510611 400
35 3300035083 Ga0373926_0034429 Ga0373926_0034429_76_1461 400
36 3300035692 Ga0373935_0015892 Ga0373935_0015892_176_1561 400
37 3300035695 Ga0373927_0029269 Ga0373927_0029269_135_1520 400
38 3300035725 Ga0373947_0058719 Ga0373947_0058719_116_1501 400
39 3300037068 Ga0373925_0011291 Ga0373925_0011291_1814_3199 400
40 3300050511 nmdc:mga08y16_41120_c1 nmdc:mga08y16_41120_c1_3204_4610 400
41 3300005577 Ga0068857_100028605 Ga0068857_1000286051 401
42 3300013307 Ga0157372_10187236 Ga0157372_101872363 401
43 3300021384 Ga0213876_10006068 Ga0213876_100060684 401
44 3300025949 Ga0207667_10081857 Ga0207667_100818573 401
45 3300026116 Ga0207674_10032332 Ga0207674_100323325 401
46 3300039437 Ga0436365_0102863 Ga0436365_0102863_62_1384 401
47 3300039437 Ga0436365_0887495 Ga0436365_0887495_4023_5384 401
48 3300005366 Ga0070659_100100268 Ga0070659_1001002682 402
49 3300005614 Ga0068856_100041904 Ga0068856_1000419042 402
50 3300006852 Ga0075433_10022821 Ga0075433_100228212 402
51 3300025932 Ga0207690_10033141 Ga0207690_100331413 402
52 3300050515 nmdc:mga0a205_7790_c1 nmdc:mga0a205_7790_c1_5368_6705 402
53 3300006871 Ga0075434_100027070 Ga0075434_1000270701 403
54 3300013104 Ga0157370_10051500 Ga0157370_100515004 403
55 3300025901 Ga0207688_10121980 Ga0207688_101219801 403
56 3300026142 Ga0207698_10226952 Ga0207698_102269521 403
57 3300050512 nmdc:mga0n895_11757_c1 nmdc:mga0n895_11757_c1_6379_7704 403
58 3300005355 Ga0070671_100221410 Ga0070671_1002214101 404
59 3300005578 Ga0068854_100140025 Ga0068854_1001400252 404
60 3300005339 Ga0070660_100056574 Ga0070660_1000565742 405
61 3300005563 Ga0068855_100060273 Ga0068855_1000602732 405
62 3300005614 Ga0068856_100109030 Ga0068856_1001090302 405
63 3300007265 Ga0099794_10003184 Ga0099794_100031846 405
64 3300025919 Ga0207657_10179881 Ga0207657_101798812 405
65 3300026078 Ga0207702_10058122 Ga0207702_100581222 405
66 3300049591 Ga0501075_0016115 Ga0501075_0016115_453_1823 405
67 3300049743 Ga0501081_0059640 Ga0501081_0059640_232_1602 405
68 3300027907 Ga0207428_10006382 Ga0207428_100063823 406
69 3300005577 Ga0068857_100005907 Ga0068857_1000059072 407
70 3300005614 Ga0068856_100015831 Ga0068856_1000158315 407
71 3300009147 Ga0114129_10319180 Ga0114129_103191802 407
72 3300009174 Ga0105241_10118178 Ga0105241_101181782 407
73 3300010375 Ga0105239_10004471 Ga0105239_1000447121 407
74 3300013100 Ga0157373_10180165 Ga0157373_101801652 407
75 3300013296 Ga0157374_10011135 Ga0157374_100111352 407
76 3300014969 Ga0157376_10023071 Ga0157376_100230712 407
77 3300025914 Ga0207671_10030165 Ga0207671_100301653 407
78 3300025949 Ga0207667_10283136 Ga0207667_102831362 407
79 3300026078 Ga0207702_10083166 Ga0207702_100831662 407
80 3300026116 Ga0207674_10018383 Ga0207674_100183833 407
81 3300030878 Ga0265770_1000931 Ga0265770_10009312 407
82 3300031090 Ga0265760_10010248 Ga0265760_100102483 407
83 3300046460 Ga0495638_0012569 Ga0495638_0012569_1449_2852 407
84 3300048918 Ga0496115_0015481 Ga0496115_0015481_1798_3054 407
85 3300005439 Ga0070711_100004181 Ga0070711_1000041818 408
86 3300025928 Ga0207700_10053104 Ga0207700_100531042 408
87 3300028380 Ga0268265_10061222 Ga0268265_100612222 408
88 3300044842 Ga0466957_0000211 Ga0466957_0000211_8372_9829 408
89 3300005340 Ga0070689_100131636 Ga0070689_1001316362 409
90 3300006178 Ga0075367_10023965 Ga0075367_100239651 410
91 3300006195 Ga0075366_10120583 Ga0075366_101205831 410
92 3300013296 Ga0157374_10020961 Ga0157374_100209616 410
93 3300025944 Ga0207661_10327251 Ga0207661_103272511 410
94 3300049593 Ga0501077_0006966 Ga0501077_0006966_4796_6214 410
95 3300050493 nmdc:mga0k408_7210_c1 nmdc:mga0k408_7210_c1_2679_4064 410
96 3300050496 nmdc:mga07m45_26394_c1 nmdc:mga07m45_26394_c1_339_1724 410
97 3300005356 Ga0070674_100077647 Ga0070674_1000776471 411
98 3300005841 Ga0068863_100013797 Ga0068863_1000137976 411
99 3300009147 Ga0114129_10049576 Ga0114129_100495761 411
100 3300009553 Ga0105249_10153129 Ga0105249_101531292 411
101 3300031235 Ga0265330_10040056 Ga0265330_100400562 411
102 3300031238 Ga0265332_10008447 Ga0265332_100084473 411
103 3300031249 Ga0265339_10001474 Ga0265339_100014743 411
104 3300031711 Ga0265314_10000265 Ga0265314_1000026528 411
105 3300046684 Ga0495669_0002195 Ga0495669_0002195_6024_7397 411
106 3300054114 Ga0501084_0291196 Ga0501084_0291196_39_1328 411
107 3300005329 Ga0070683_100000107 Ga0070683_10000010724 412
108 3300005331 Ga0070670_100004258 Ga0070670_1000042582 412
109 3300005355 Ga0070671_100236264 Ga0070671_1002362641 412
110 3300005455 Ga0070663_100031200 Ga0070663_1000312002 412
111 3300005535 Ga0070684_100000837 Ga0070684_1000008373 412
112 3300005564 Ga0070664_100000303 Ga0070664_1000003033 412
113 3300006880 Ga0075429_100104424 Ga0075429_1001044242 412
114 3300009177 Ga0105248_10162913 Ga0105248_101629133 412
115 3300025925 Ga0207650_10146621 Ga0207650_101466212 412
116 3300025941 Ga0207711_10089500 Ga0207711_100895003 412
117 3300025945 Ga0207679_10077234 Ga0207679_100772343 412
118 3300031240 Ga0265320_10048767 Ga0265320_100487672 412
119 3300031712 Ga0265342_10020643 Ga0265342_100206432 412
120 3300046472 Ga0495580_0004381 Ga0495580_0004381_2678_4015 412
121 3300046477 Ga0495664_0040101 Ga0495664_0040101_98_1396 412
122 3300046529 Ga0495652_0199931 Ga0495652_0199931_34_1365 412
123 3300046531 Ga0495665_0017121 Ga0495665_0017121_276_1613 412
124 3300046533 Ga0495640_0045916 Ga0495640_0045916_599_1897 412
125 3300046678 Ga0495599_0061093 Ga0495599_0061093_838_2169 412
126 3300047319 Ga0495674_0011676 Ga0495674_0011676_1681_2979 412
127 3300047322 Ga0495680_0176547 Ga0495680_0176547_65_1396 412
128 3300047444 Ga0495675_0004864 Ga0495675_0004864_2482_3813 412
129 3300047471 Ga0495684_0000834 Ga0495684_0000834_9165_10496 412
130 3300048088 Ga0495602_0025838 Ga0495602_0025838_3225_4556 412
131 3300048907 Ga0496104_0001482 Ga0496104_0001482_15612_16991 412
132 3300048908 Ga0496105_0014831 Ga0496105_0014831_148_1530 412
133 3300048911 Ga0496108_0000282 Ga0496108_0000282_24952_26403 412
134 3300048913 Ga0496110_0011781 Ga0496110_0011781_3272_4723 412
135 3300048914 Ga0496111_0000460 Ga0496111_0000460_14961_16343 412
136 3300048915 Ga0496112_0001067 Ga0496112_0001067_14615_16066 412
137 3300050507 nmdc:mga05p37_7289_c1 nmdc:mga05p37_7289_c1_274_1599 412
138 3300050510 nmdc:mga06r32_122420_c1 nmdc:mga06r32_122420_c1_670_1995 412
139 3300006844 Ga0075428_100064338 Ga0075428_1000643381 413
140 3300013307 Ga0157372_10068546 Ga0157372_100685462 413
141 3300037068 Ga0373925_0056398 Ga0373925_0056398_1199_2527 413
142 3300046472 Ga0495580_0001952 Ga0495580_0001952_5246_6574 413
143 3300050509 nmdc:mga0qj67_81065_c1 nmdc:mga0qj67_81065_c1_491_1858 413
144 3300025926 Ga0207659_10131124 Ga0207659_101311241 414
145 3300027907 Ga0207428_10026033 Ga0207428_100260332 414
146 3300044694 Ga0466963_0102205 Ga0466963_0102205_620_1888 414
147 3300050511 nmdc:mga08y16_7848_c1 nmdc:mga08y16_7848_c1_9232_10527 414
148 3300005328 Ga0070676_10001662 Ga0070676_100016628 415
149 3300005329 Ga0070683_100034706 Ga0070683_1000347062 415
150 3300005334 Ga0068869_100005430 Ga0068869_1000054307 415
151 3300005336 Ga0070680_100029999 Ga0070680_1000299994 415
152 3300005337 Ga0070682_100067618 Ga0070682_1000676182 415
153 3300005338 Ga0068868_100017093 Ga0068868_1000170932 415
154 3300005339 Ga0070660_100020559 Ga0070660_1000205593 415
155 3300005344 Ga0070661_100002247 Ga0070661_10000224710 415
156 3300005345 Ga0070692_10022267 Ga0070692_100222671 415
157 3300005347 Ga0070668_100000787 Ga0070668_10000078715 415
158 3300005347 Ga0070668_100189031 Ga0070668_1001890311 415
159 3300005353 Ga0070669_100070631 Ga0070669_1000706311 415
160 3300005354 Ga0070675_100010538 Ga0070675_1000105385 415
161 3300005366 Ga0070659_100029355 Ga0070659_1000293553 415
162 3300005367 Ga0070667_100012957 Ga0070667_1000129572 415
163 3300005441 Ga0070700_100027192 Ga0070700_1000271922 415
164 3300005441 Ga0070700_100046918 Ga0070700_1000469182 415
165 3300005444 Ga0070694_100014822 Ga0070694_1000148222 415
166 3300005444 Ga0070694_100112206 Ga0070694_1001122061 415
167 3300005458 Ga0070681_10002927 Ga0070681_100029279 415
168 3300005458 Ga0070681_10293983 Ga0070681_102939831 415
169 3300005466 Ga0070685_10029149 Ga0070685_100291491 415
170 3300005530 Ga0070679_100002414 Ga0070679_1000024149 415
171 3300005535 Ga0070684_100039674 Ga0070684_1000396742 415
172 3300005535 Ga0070684_100043761 Ga0070684_1000437612 415
173 3300005543 Ga0070672_100008057 Ga0070672_1000080572 415
174 3300005563 Ga0068855_100033716 Ga0068855_1000337165 415
175 3300005563 Ga0068855_100066136 Ga0068855_1000661364 415
176 3300005564 Ga0070664_100002537 Ga0070664_1000025376 415
177 3300005577 Ga0068857_100002675 Ga0068857_1000026755 415
178 3300005577 Ga0068857_100002944 Ga0068857_1000029445 415
179 3300005616 Ga0068852_100014322 Ga0068852_1000143222 415
180 3300005719 Ga0068861_100000535 Ga0068861_10000053510 415
181 3300005719 Ga0068861_100001808 Ga0068861_10000180812 415
182 3300005840 Ga0068870_10001490 Ga0068870_100014903 415
183 3300005841 Ga0068863_100058121 Ga0068863_1000581213 415
184 3300005843 Ga0068860_100002295 Ga0068860_1000022957 415
185 3300005844 Ga0068862_100000532 Ga0068862_10000053219 415
186 3300005844 Ga0068862_100054971 Ga0068862_1000549712 415
187 3300006844 Ga0075428_100179758 Ga0075428_1001797583 415
188 3300006852 Ga0075433_10141301 Ga0075433_101413012 415
189 3300006871 Ga0075434_100069545 Ga0075434_1000695452 415
190 3300006871 Ga0075434_100121121 Ga0075434_1001211212 415
191 3300007076 Ga0075435_100108856 Ga0075435_1001088562 415
192 3300009094 Ga0111539_10013257 Ga0111539_100132572 415
193 3300009094 Ga0111539_10191232 Ga0111539_101912321 415
194 3300009098 Ga0105245_10092678 Ga0105245_100926782 415
195 3300009147 Ga0114129_10031623 Ga0114129_100316232 415
196 3300009176 Ga0105242_10235104 Ga0105242_102351042 415
197 3300009177 Ga0105248_10041438 Ga0105248_100414382 415
198 3300009545 Ga0105237_10058503 Ga0105237_100585033 415
199 3300009553 Ga0105249_10000075 Ga0105249_1000007523 415
200 3300009553 Ga0105249_10003487 Ga0105249_1000348711 415
201 3300013104 Ga0157370_10002893 Ga0157370_100028934 415
202 3300013105 Ga0157369_10008063 Ga0157369_100080632 415
203 3300013296 Ga0157374_10013301 Ga0157374_100133012 415
204 3300013306 Ga0163162_10005049 Ga0163162_100050498 415
205 3300014326 Ga0157380_10031126 Ga0157380_100311261 415
206 3300014968 Ga0157379_10004256 Ga0157379_100042569 415
207 3300025315 Ga0207697_10031479 Ga0207697_100314792 415
208 3300025893 Ga0207682_10036932 Ga0207682_100369322 415
209 3300025907 Ga0207645_10000294 Ga0207645_1000029419 415
210 3300025908 Ga0207643_10001203 Ga0207643_100012038 415
211 3300025912 Ga0207707_10002005 Ga0207707_1000200512 415
212 3300025917 Ga0207660_10010784 Ga0207660_100107842 415
213 3300025918 Ga0207662_10001571 Ga0207662_100015714 415
214 3300025919 Ga0207657_10086093 Ga0207657_100860932 415
215 3300025920 Ga0207649_10006940 Ga0207649_100069403 415
216 3300025920 Ga0207649_10016840 Ga0207649_100168402 415
217 3300025921 Ga0207652_10025118 Ga0207652_100251182 415
218 3300025923 Ga0207681_10003187 Ga0207681_100031875 415
219 3300025923 Ga0207681_10009430 Ga0207681_100094303 415
220 3300025925 Ga0207650_10211553 Ga0207650_102115531 415
221 3300025926 Ga0207659_10097554 Ga0207659_100975542 415
222 3300025932 Ga0207690_10027692 Ga0207690_100276922 415
223 3300025933 Ga0207706_10000472 Ga0207706_1000047217 415
224 3300025940 Ga0207691_10000248 Ga0207691_1000024832 415
225 3300025942 Ga0207689_10000810 Ga0207689_1000081016 415
226 3300025945 Ga0207679_10002710 Ga0207679_100027108 415
227 3300025945 Ga0207679_10015334 Ga0207679_100153341 415
228 3300025961 Ga0207712_10001640 Ga0207712_100016403 415
229 3300025961 Ga0207712_10001936 Ga0207712_1000193612 415
230 3300025972 Ga0207668_10027203 Ga0207668_100272031 415
231 3300025972 Ga0207668_10163687 Ga0207668_101636871 415
232 3300026089 Ga0207648_10016684 Ga0207648_100166842 415
233 3300026116 Ga0207674_10001081 Ga0207674_1000108111 415
234 3300026116 Ga0207674_10010697 Ga0207674_100106975 415
235 3300026118 Ga0207675_100000373 Ga0207675_10000037319 415
236 3300026118 Ga0207675_100068305 Ga0207675_1000683051 415
237 3300026142 Ga0207698_10012808 Ga0207698_100128085 415
238 3300026142 Ga0207698_10019143 Ga0207698_100191434 415
239 3300028380 Ga0268265_10002731 Ga0268265_100027312 415
240 3300028380 Ga0268265_10007702 Ga0268265_100077026 415
241 3300028381 Ga0268264_10043664 Ga0268264_100436641 415
242 3300031548 Ga0307408_100002025 Ga0307408_10000202510 415
243 3300031852 Ga0307410_10014301 Ga0307410_100143012 415
244 3300031901 Ga0307406_10008031 Ga0307406_100080312 415
245 3300031995 Ga0307409_100053360 Ga0307409_1000533603 415
246 3300037466 Ga0395898_0089512 Ga0395898_0089512_994_2304 415
247 3300046472 Ga0495580_0040622 Ga0495580_0040622_1670_2938 415
248 3300046683 Ga0495658_0021335 Ga0495658_0021335_150_1508 415
249 3300050507 nmdc:mga05p37_128956_c1 nmdc:mga05p37_128956_c1_1019_2353 415
250 3300050511 nmdc:mga08y16_48370_c1 nmdc:mga08y16_48370_c1_1344_2669 415
251 3300050512 nmdc:mga0n895_124571_c1 nmdc:mga0n895_124571_c1_275_1600 415
252 3300050512 nmdc:mga0n895_131547_c1 nmdc:mga0n895_131547_c1_615_1949 415
253 3300050515 nmdc:mga0a205_146529_c1 nmdc:mga0a205_146529_c1_721_2046 415
254 3300005937 Ga0081455_10154373 Ga0081455_101543732 416
255 3300025315 Ga0207697_10001044 Ga0207697_1000104410 416
256 3300048913 Ga0496110_0118054 Ga0496110_0118054_144_1685 416
257 3300005340 Ga0070689_100040610 Ga0070689_1000406102 417
258 3300005365 Ga0070688_100012517 Ga0070688_1000125172 417
259 3300006881 Ga0068865_100179176 Ga0068865_1001791761 417
260 3300013102 Ga0157371_10158047 Ga0157371_101580471 417
261 3300014326 Ga0157380_10053361 Ga0157380_100533612 417
262 3300031903 Ga0307407_10098157 Ga0307407_100981571 417
263 3300049571 Ga0501034_0188202 Ga0501034_0188202_19_1302 417
264 3300060353 Ga0501082_0000586 Ga0501082_0000586_2531_3874 417
265 3300028653 Ga0265323_10000578 Ga0265323_1000057814 418
266 3300031731 Ga0307405_10060463 Ga0307405_100604632 418
267 3300031852 Ga0307410_10069903 Ga0307410_100699033 418
268 3300031903 Ga0307407_10110674 Ga0307407_101106742 418
269 3300032004 Ga0307414_10026853 Ga0307414_100268532 418
270 3300032126 Ga0307415_100092788 Ga0307415_1000927883 418
271 3300037418 Ga0395900_0179252 Ga0395900_0179252_199_1500 418
272 3300046543 Ga0495645_0002242 Ga0495645_0002242_3630_4967 418
273 3300005530 Ga0070679_100056537 Ga0070679_1000565373 419
274 3300005563 Ga0068855_100007977 Ga0068855_1000079771 419
275 3300005616 Ga0068852_100183373 Ga0068852_1001833732 419
276 3300009093 Ga0105240_10024079 Ga0105240_100240797 419
277 3300013104 Ga0157370_10256605 Ga0157370_102566052 419
278 3300025906 Ga0207699_10112903 Ga0207699_101129031 419
279 3300025932 Ga0207690_10028889 Ga0207690_100288892 419
280 3300025949 Ga0207667_10033625 Ga0207667_100336252 419
281 3300026142 Ga0207698_10150211 Ga0207698_101502112 419
282 3300032002 Ga0307416_100191291 Ga0307416_1001912911 419
283 3300032126 Ga0307415_100192150 Ga0307415_1001921501 419
284 3300035116 Ga0373945_0044208 Ga0373945_0044208_21_1349 419
285 3300035725 Ga0373947_0007766 Ga0373947_0007766_3000_4340 419
286 3300037068 Ga0373925_0005848 Ga0373925_0005848_5999_7327 419
287 3300037068 Ga0373925_0053576 Ga0373925_0053576_153_1493 419
288 3300046461 Ga0495641_0046971 Ga0495641_0046971_475_1815 419
289 3300046472 Ga0495580_0048686 Ga0495580_0048686_1528_2868 419
290 3300046473 Ga0495582_0018018 Ga0495582_0018018_30_1370 419
291 3300046537 Ga0495598_0004375 Ga0495598_0004375_420_1760 419
292 3300046674 Ga0495588_0013246 Ga0495588_0013246_776_2116 419
293 3300046690 Ga0495624_0019818 Ga0495624_0019818_39_1379 419
294 3300047321 Ga0495676_0019273 Ga0495676_0019273_2665_4005 419
295 3300053078 Ga0495612_0009486 Ga0495612_0009486_1665_2993 419
296 3300053085 Ga0495619_0101806 Ga0495619_0101806_39_1367 419
297 3300005356 Ga0070674_100035964 Ga0070674_1000359643 420
298 3300005366 Ga0070659_100219970 Ga0070659_1002199702 420
299 3300005456 Ga0070678_100050568 Ga0070678_1000505682 420
300 3300005548 Ga0070665_100030763 Ga0070665_1000307635 420
301 3300005718 Ga0068866_10032363 Ga0068866_100323632 420
302 3300005841 Ga0068863_100211332 Ga0068863_1002113322 420
303 3300005937 Ga0081455_10025848 Ga0081455_100258486 420
304 3300005937 Ga0081455_10030549 Ga0081455_100305492 420
305 3300005983 Ga0081540_1007681 Ga0081540_10076812 420
306 3300005983 Ga0081540_1044275 Ga0081540_10442752 420
307 3300006844 Ga0075428_100009967 Ga0075428_1000099679 420
308 3300006844 Ga0075428_100119558 Ga0075428_1001195582 420
309 3300006847 Ga0075431_100028185 Ga0075431_1000281854 420
310 3300006871 Ga0075434_100075943 Ga0075434_1000759432 420
311 3300006871 Ga0075434_100105404 Ga0075434_1001054042 420
312 3300006880 Ga0075429_100044536 Ga0075429_1000445362 420
313 3300009093 Ga0105240_10044941 Ga0105240_100449413 420
314 3300009094 Ga0111539_10137530 Ga0111539_101375302 420
315 3300009094 Ga0111539_10252315 Ga0111539_102523151 420
316 3300009098 Ga0105245_10011422 Ga0105245_100114228 420
317 3300009147 Ga0114129_10017690 Ga0114129_100176904 420
318 3300009545 Ga0105237_10148042 Ga0105237_101480422 420
319 3300010375 Ga0105239_10003833 Ga0105239_100038339 420
320 3300014325 Ga0163163_10283404 Ga0163163_102834042 420
321 3300014969 Ga0157376_10070801 Ga0157376_100708013 420
322 3300025914 Ga0207671_10078083 Ga0207671_100780832 420
323 3300025937 Ga0207669_10006981 Ga0207669_100069815 420
324 3300026089 Ga0207648_10015089 Ga0207648_100150893 420
325 3300037471 Ga0395905_0001469 Ga0395905_0001469_16448_17755 420
326 3300037471 Ga0395905_0291737 Ga0395905_0291737_181_1488 420
327 3300042125 Ga0450923_003199 Ga0450923_003199_557_1942 420
328 3300042876 Ga0451577_0012747 Ga0451577_0012747_1116_2480 420
329 3300045051 Ga0451576_0051303 Ga0451576_0051303_2559_3926 420
330 3300046499 Ga0495594_0051796 Ga0495594_0051796_551_1954 420
331 3300048907 Ga0496104_0246631 Ga0496104_0246631_176_1579 420
332 3300049574 Ga0501038_0140629 Ga0501038_0140629_457_1899 420
333 3300049588 Ga0501072_0130510 Ga0501072_0130510_158_1573 420
334 3300049592 Ga0501076_0027275 Ga0501076_0027275_1153_2568 420
335 3300049593 Ga0501077_0065403 Ga0501077_0065403_522_1937 420
336 3300049822 Ga0501035_0153904 Ga0501035_0153904_610_1965 420
337 3300050507 nmdc:mga05p37_87053_c1 nmdc:mga05p37_87053_c1_1223_2635 420
338 3300050510 nmdc:mga06r32_59853_c1 nmdc:mga06r32_59853_c1_53_1468 420
339 3300050511 nmdc:mga08y16_137997_c1 nmdc:mga08y16_137997_c1_363_1697 420
340 3300050512 nmdc:mga0n895_122336_c1 nmdc:mga0n895_122336_c1_813_2216 420
341 3300050512 nmdc:mga0n895_67720_c1 nmdc:mga0n895_67720_c1_225_1559 420
342 iso_pu_bacteria 2643221547 2643757186 420
343 3300005458 Ga0070681_10123975 Ga0070681_101239752 421
344 3300005530 Ga0070679_100068183 Ga0070679_1000681833 421
345 3300005563 Ga0068855_100207310 Ga0068855_1002073101 421
346 3300005842 Ga0068858_100302201 Ga0068858_1003022012 421
347 3300006852 Ga0075433_10164104 Ga0075433_101641041 421
348 3300006852 Ga0075433_10257571 Ga0075433_102575712 421
349 3300006880 Ga0075429_100085567 Ga0075429_1000855672 421
350 3300009093 Ga0105240_10004254 Ga0105240_100042546 421
351 3300009174 Ga0105241_10141160 Ga0105241_101411602 421
352 3300010375 Ga0105239_10064265 Ga0105239_100642655 421
353 3300013105 Ga0157369_10222162 Ga0157369_102221622 421
354 3300013307 Ga0157372_10132573 Ga0157372_101325732 421
355 3300025912 Ga0207707_10045503 Ga0207707_100455032 421
356 3300025917 Ga0207660_10174626 Ga0207660_101746261 421
357 3300026075 Ga0207708_10062825 Ga0207708_100628251 421
358 3300026118 Ga0207675_100008014 Ga0207675_1000080145 421
359 3300031852 Ga0307410_10030587 Ga0307410_100305872 421
360 3300032005 Ga0307411_10025449 Ga0307411_100254493 421
361 3300037471 Ga0395905_0002922 Ga0395905_0002922_14058_15368 421
362 3300037471 Ga0395905_0026517 Ga0395905_0026517_3337_4737 421
363 3300037471 Ga0395905_0029454 Ga0395905_0029454_3538_4938 421
364 3300045976 Ga0466967_0270362 Ga0466967_0270362_74_1390 421
365 3300046477 Ga0495664_0027369 Ga0495664_0027369_105_1448 421
366 3300049587 Ga0501071_0014003 Ga0501071_0014003_3785_5086 421
367 3300049588 Ga0501072_0013363 Ga0501072_0013363_4561_5862 421
368 3300049592 Ga0501076_0078159 Ga0501076_0078159_1316_2617 421
369 3300049592 Ga0501076_0085279 Ga0501076_0085279_110_1453 421
370 3300049743 Ga0501081_0071743 Ga0501081_0071743_144_1445 421
371 3300049824 Ga0501045_0004716 Ga0501045_0004716_5551_6852 421
372 3300050515 nmdc:mga0a205_35212_c2 nmdc:mga0a205_35212_c2_628_1932 421
373 3300050515 nmdc:mga0a205_73367_c2 nmdc:mga0a205_73367_c2_31_1371 421
374 3300054114 Ga0501084_0019109 Ga0501084_0019109_371_1672 421
375 3300005338 Ga0068868_100131240 Ga0068868_1001312401 422
376 3300005367 Ga0070667_100032041 Ga0070667_1000320414 422
377 3300005546 Ga0070696_100000158 Ga0070696_1000001583 422
378 3300005617 Ga0068859_100115181 Ga0068859_1001151812 422
379 3300005841 Ga0068863_100077745 Ga0068863_1000777451 422
380 3300005843 Ga0068860_100007566 Ga0068860_10000756611 422
381 3300006931 Ga0097620_100115180 Ga0097620_1001151801 422
382 3300009098 Ga0105245_10047675 Ga0105245_100476754 422
383 3300009177 Ga0105248_10021187 Ga0105248_100211873 422
384 3300014968 Ga0157379_10035045 Ga0157379_100350452 422
385 3300025913 Ga0207695_10019230 Ga0207695_100192305 422
386 3300025927 Ga0207687_10056683 Ga0207687_100566832 422
387 3300026088 Ga0207641_10131123 Ga0207641_101311232 422
388 3300028381 Ga0268264_10008130 Ga0268264_100081302 422
389 3300031711 Ga0265314_10003899 Ga0265314_100038996 422
390 3300044842 Ga0466957_0047820 Ga0466957_0047820_17_1381 422
391 3300059423 Ga0590074_000647 Ga0590074_000647_1651_3078 422
392 3300059426 Ga0590077_000251 Ga0590077_000251_1874_3301 422
393 3300005334 Ga0068869_100073784 Ga0068869_1000737843 423
394 3300005436 Ga0070713_100066366 Ga0070713_1000663662 423
395 3300005445 Ga0070708_100002984 Ga0070708_10000298412 423
396 3300005467 Ga0070706_100000188 Ga0070706_10000018863 423
397 3300005518 Ga0070699_100034241 Ga0070699_1000342413 423
398 3300005536 Ga0070697_100000146 Ga0070697_10000014638 423
399 3300005549 Ga0070704_100017967 Ga0070704_1000179672 423
400 3300005719 Ga0068861_100113590 Ga0068861_1001135902 423
401 3300006175 Ga0070712_100000450 Ga0070712_10000045013 423
402 3300006178 Ga0075367_10109536 Ga0075367_101095361 423
403 3300006195 Ga0075366_10007763 Ga0075366_100077634 423
404 3300006353 Ga0075370_10025508 Ga0075370_100255082 423
405 3300006852 Ga0075433_10011530 Ga0075433_100115304 423
406 3300025910 Ga0207684_10001145 Ga0207684_100011454 423
407 3300025915 Ga0207693_10000740 Ga0207693_1000074019 423
408 3300025916 Ga0207663_10001920 Ga0207663_100019202 423
409 3300026118 Ga0207675_100036082 Ga0207675_1000360824 423
410 3300031344 Ga0265316_10093482 Ga0265316_100934822 423
411 3300031711 Ga0265314_10037637 Ga0265314_100376374 423
412 3300038443 Ga0395901_0099465 Ga0395901_0099465_746_2224 423
413 3300044712 Ga0453684_0139684 Ga0453684_0139684_715_2091 423
414 3300046472 Ga0495580_0046872 Ga0495580_0046872_667_2034 423
415 3300049570 Ga0501033_0066662 Ga0501033_0066662_206_1582 423
416 3300049574 Ga0501038_0194572 Ga0501038_0194572_240_1616 423
417 3300049579 Ga0501043_0113724 Ga0501043_0113724_459_1835 423
418 3300049581 Ga0501047_0012968 Ga0501047_0012968_904_2280 423
419 3300049589 Ga0501073_0011518 Ga0501073_0011518_177_1553 423
420 3300049822 Ga0501035_0005699 Ga0501035_0005699_9694_11070 423
421 3300049823 Ga0501044_0005369 Ga0501044_0005369_10674_12050 423
422 3300050491 nmdc:mga00v17_59311_c1 nmdc:mga00v17_59311_c1_364_1740 423
423 3300050495 nmdc:mga04h51_34753_c1 nmdc:mga04h51_34753_c1_214_1590 423
424 3300050515 nmdc:mga0a205_14407_c1 nmdc:mga0a205_14407_c1_549_1868 423
425 3300005548 Ga0070665_100218372 Ga0070665_1002183723 424
426 3300005842 Ga0068858_100080193 Ga0068858_1000801932 424
427 3300006844 Ga0075428_100153638 Ga0075428_1001536381 424
428 3300026035 Ga0207703_10029945 Ga0207703_100299454 424
429 3300005336 Ga0070680_100008929 Ga0070680_1000089292 425
430 3300005367 Ga0070667_100179386 Ga0070667_1001793862 425
431 3300005439 Ga0070711_100212013 Ga0070711_1002120131 425
432 3300005536 Ga0070697_100009629 Ga0070697_1000096292 425
433 3300005539 Ga0068853_100098757 Ga0068853_1000987571 425
434 3300005548 Ga0070665_100034346 Ga0070665_1000343464 425
435 3300005614 Ga0068856_100085184 Ga0068856_1000851843 425
436 3300005616 Ga0068852_100004445 Ga0068852_1000044458 425
437 3300005618 Ga0068864_100124152 Ga0068864_1001241522 425
438 3300005841 Ga0068863_100050770 Ga0068863_1000507702 425
439 3300005842 Ga0068858_100002229 Ga0068858_10000222916 425
440 3300006358 Ga0068871_100099564 Ga0068871_1000995641 425
441 3300006358 Ga0068871_100228512 Ga0068871_1002285121 425
442 3300009098 Ga0105245_10081326 Ga0105245_100813263 425
443 3300009098 Ga0105245_10141748 Ga0105245_101417482 425
444 3300009174 Ga0105241_10039492 Ga0105241_100394923 425
445 3300009177 Ga0105248_10015951 Ga0105248_100159511 425
446 3300009551 Ga0105238_10042838 Ga0105238_100428384 425
447 3300013104 Ga0157370_10001248 Ga0157370_100012483 425
448 3300013297 Ga0157378_10033360 Ga0157378_100333601 425
449 3300013306 Ga0163162_10016179 Ga0163162_100161799 425
450 3300013308 Ga0157375_10001896 Ga0157375_100018967 425
451 3300014325 Ga0163163_10054577 Ga0163163_100545772 425
452 3300025903 Ga0207680_10047111 Ga0207680_100471112 425
453 3300025911 Ga0207654_10018384 Ga0207654_100183842 425
454 3300025913 Ga0207695_10011850 Ga0207695_100118503 425
455 3300025919 Ga0207657_10007399 Ga0207657_100073993 425
456 3300025921 Ga0207652_10016114 Ga0207652_100161145 425
457 3300025924 Ga0207694_10045311 Ga0207694_100453112 425
458 3300025924 Ga0207694_10096491 Ga0207694_100964912 425
459 3300025927 Ga0207687_10176455 Ga0207687_101764552 425
460 3300025931 Ga0207644_10026555 Ga0207644_100265553 425
461 3300025934 Ga0207686_10029822 Ga0207686_100298222 425
462 3300025949 Ga0207667_10000814 Ga0207667_1000081412 425
463 3300025986 Ga0207658_10238448 Ga0207658_102384482 425
464 3300026023 Ga0207677_10052830 Ga0207677_100528302 425
465 3300026078 Ga0207702_10047500 Ga0207702_100475003 425
466 3300026088 Ga0207641_10042241 Ga0207641_100422414 425
467 3300026142 Ga0207698_10008821 Ga0207698_100088216 425
468 3300028379 Ga0268266_10019916 Ga0268266_100199164 425
469 3300031548 Ga0307408_100032799 Ga0307408_1000327993 425
470 3300031731 Ga0307405_10024888 Ga0307405_100248884 425
471 3300031852 Ga0307410_10036042 Ga0307410_100360422 425
472 3300031995 Ga0307409_100098095 Ga0307409_1000980952 425
473 3300032002 Ga0307416_100068852 Ga0307416_1000688522 425
474 3300032126 Ga0307415_100012860 Ga0307415_1000128602 425
475 3300046689 Ga0495613_0161819 Ga0495613_0161819_17_1339 425
476 3300049581 Ga0501047_0016610 Ga0501047_0016610_5083_6426 425
477 3300049581 Ga0501047_0150093 Ga0501047_0150093_666_1994 425
478 3300049822 Ga0501035_0081860 Ga0501035_0081860_1181_2524 425
479 3300049823 Ga0501044_0000391 Ga0501044_0000391_9464_10807 425
480 3300049823 Ga0501044_0001179 Ga0501044_0001179_11320_12648 425
481 3300005458 Ga0070681_10019728 Ga0070681_100197282 426
482 3300009093 Ga0105240_10147513 Ga0105240_101475132 426
483 3300013105 Ga0157369_10054644 Ga0157369_100546444 426
484 3300013307 Ga0157372_10000636 Ga0157372_100006369 426
485 3300037471 Ga0395905_0013165 Ga0395905_0013165_4990_6372 426
486 3300049592 Ga0501076_0067571 Ga0501076_0067571_85_1461 426
487 3300049741 Ga0501079_0119727 Ga0501079_0119727_400_1776 426
488 3300049824 Ga0501045_0069252 Ga0501045_0069252_319_1695 426
489 3300061734 Ga0530510_0021950 Ga0530510_0021950_1785_3161 426
490 3300006914 Ga0075436_100018868 Ga0075436_1000188682 427
491 3300006914 Ga0075436_100055704 Ga0075436_1000557042 427
492 3300031090 Ga0265760_10020308 Ga0265760_100203082 427
493 3300044693 Ga0466961_0081450 Ga0466961_0081450_567_1967 427
494 3300044706 Ga0466964_0082304 Ga0466964_0082304_19_1347 427
495 3300049576 Ga0501040_0021280 Ga0501040_0021280_2085_3431 427
496 3300049591 Ga0501075_0026433 Ga0501075_0026433_1345_2691 427
497 3300049592 Ga0501076_0098618 Ga0501076_0098618_73_1419 427
498 3300005435 Ga0070714_100097213 Ga0070714_1000972132 428
499 3300005436 Ga0070713_100076145 Ga0070713_1000761452 428
500 3300005614 Ga0068856_100221633 Ga0068856_1002216331 428
501 3300013307 Ga0157372_10023277 Ga0157372_100232772 428
502 3300025929 Ga0207664_10060266 Ga0207664_100602663 428
503 3300047472 Ga0495686_0009251 Ga0495686_0009251_2969_4315 428
504 3300005331 Ga0070670_100016672 Ga0070670_1000166724 429
505 3300005336 Ga0070680_100000986 Ga0070680_1000009866 429
506 3300005338 Ga0068868_100017908 Ga0068868_1000179082 429
507 3300005354 Ga0070675_100021287 Ga0070675_1000212875 429
508 3300005355 Ga0070671_100079825 Ga0070671_1000798252 429
509 3300005458 Ga0070681_10004893 Ga0070681_1000489317 429
510 3300005458 Ga0070681_10054910 Ga0070681_100549102 429
511 3300005530 Ga0070679_100007054 Ga0070679_1000070543 429
512 3300005539 Ga0068853_100194835 Ga0068853_1001948352 429
513 3300005548 Ga0070665_100039697 Ga0070665_1000396972 429
514 3300005617 Ga0068859_100062331 Ga0068859_1000623312 429
515 3300005618 Ga0068864_100004735 Ga0068864_1000047353 429
516 3300005841 Ga0068863_100041886 Ga0068863_1000418863 429
517 3300006871 Ga0075434_100096590 Ga0075434_1000965902 429
518 3300006931 Ga0097620_100062331 Ga0097620_1000623312 429
519 3300009098 Ga0105245_10112731 Ga0105245_101127311 429
520 3300009177 Ga0105248_10010899 Ga0105248_100108993 429
521 3300009177 Ga0105248_10053778 Ga0105248_100537783 429
522 3300009553 Ga0105249_10018855 Ga0105249_100188555 429
523 3300013100 Ga0157373_10154120 Ga0157373_101541201 429
524 3300014325 Ga0163163_10290497 Ga0163163_102904971 429
525 3300021388 Ga0213875_10000764 Ga0213875_1000076412 429
526 3300025912 Ga0207707_10005331 Ga0207707_100053317 429
527 3300025917 Ga0207660_10003975 Ga0207660_1000397514 429
528 3300025921 Ga0207652_10053417 Ga0207652_100534175 429
529 3300025939 Ga0207665_10020845 Ga0207665_100208452 429
530 3300025940 Ga0207691_10050361 Ga0207691_100503613 429
531 3300025941 Ga0207711_10185194 Ga0207711_101851942 429
532 3300026023 Ga0207677_10012606 Ga0207677_100126064 429
533 3300035725 Ga0373947_0000515 Ga0373947_0000515_16340_17755 429
534 3300037068 Ga0373925_0000805 Ga0373925_0000805_11199_12614 429
535 3300037853 Ga0436364_0165597 Ga0436364_0165597_12690_14012 429
536 3300037853 Ga0436364_0419311 Ga0436364_0419311_1742_3103 429
537 3300038443 Ga0395901_0153709 Ga0395901_0153709_956_2338 429
538 3300039450 Ga0436363_1248950 Ga0436363_1248950_4836_6239 429
539 3300044694 Ga0466963_0004370 Ga0466963_0004370_1580_2971 429
540 3300047319 Ga0495674_0103697 Ga0495674_0103697_112_1665 429
541 3300048912 Ga0496109_0003251 Ga0496109_0003251_11782_13173 429
542 3300048915 Ga0496112_0067014 Ga0496112_0067014_123_1514 429
543 3300050512 nmdc:mga0n895_19591_c1 nmdc:mga0n895_19591_c1_1129_2574 429
544 3300013104 Ga0157370_10119837 Ga0157370_101198372 430
545 3300014325 Ga0163163_10103201 Ga0163163_101032012 430
546 3300025929 Ga0207664_10203013 Ga0207664_102030132 430
547 3300035725 Ga0373947_0058334 Ga0373947_0058334_393_1856 430
548 3300045836 Ga0466958_0135745 Ga0466958_0135745_209_1522 430
549 3300046535 Ga0495586_0053910 Ga0495586_0053910_624_1982 430
550 3300046663 Ga0495635_0030952 Ga0495635_0030952_1840_3225 430
551 3300047318 Ga0495636_0020276 Ga0495636_0020276_718_2103 430
552 3300047444 Ga0495675_0033858 Ga0495675_0033858_483_1841 430
553 3300048915 Ga0496112_0184138 Ga0496112_0184138_231_1616 430
554 3300046679 Ga0495623_0042029 Ga0495623_0042029_1047_2450 431
555 3300005329 Ga0070683_100121931 Ga0070683_1001219311 432
556 3300005336 Ga0070680_100042235 Ga0070680_1000422351 432
557 3300005458 Ga0070681_10051668 Ga0070681_100516682 432
558 3300013104 Ga0157370_10002972 Ga0157370_1000297216 432
559 3300021361 Ga0213872_10001135 Ga0213872_1000113514 432
560 3300039438 Ga0436360_0731860 Ga0436360_0731860_826_2208 432
561 3300039447 Ga0436361_0596240 Ga0436361_0596240_14211_15641 432
562 3300003323 rootH1_10155563 rootH1_101555631 433
563 3300025233 Ga0209437_101450 Ga0209437_1014503 433
564 3300037418 Ga0395900_0084751 Ga0395900_0084751_1755_3149 433
565 3300039437 Ga0436365_1128249 Ga0436365_1128249_279_1649 433
566 3300048929 Ga0496126_0000012 Ga0496126_0000012_248638_249999 433

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

7

166

0.99

PF01554

MatE

MatE

233

394

0.98

PF14667

Polysacc_synt_C

Polysaccharide biosynthesis C-terminal domain

119

276

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7php-assembly1.cif.gz_A structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em 0.9421 2 429
7php-assembly1.cif.gz_A structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em 0.9295 2 429
7dqk-assembly1.cif.gz_A a nicotine mate transporter, nicotiana tabacum mate2 (ntmate2) 0.9139 2 422
5xjj-assembly1.cif.gz_A crystal structure of a mate family protein 0.9116 3 422
3wbn-assembly1.cif.gz_A crystal structure of mate in complex with mal6 0.8986 2 423
ID Description Score Start End Superfamily
af_Q54DM2_248_409_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9883 229 386 1.20.1250.20
af_Q9USK3_331_487_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9817 230 383 1.20.1250.20
af_Q3V050_274_435_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9787 229 385 1.20.1250.20
af_A0A1D8PCB5_370_524_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9784 230 383 1.20.1250.20
af_Q59R29_400_561_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9772 229 384 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7G8BDA3-F1-model_v4 Multidrug-efflux transporter 0.9881 2 424 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A2P6WED1-F1-model_v4 Multidrug-efflux transporter 0.9804 2 422 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A1F3XUQ9-F1-model_v4 Multidrug-efflux transporter 0.9773 1 422 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A6L3EK82-F1-model_v4 MATE family efflux transporter 0.9766 125 426 GO:0005886
GO:0015297
GO:0042910
AF-A0A2V8JA00-F1-model_v4 MATE family efflux transporter 0.9759 1 422 GO:0005886
GO:0015297
GO:0042910

Feature Viewer

pLDDT pTM Quality
88.6 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map