F464346
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 281 | 565 | 446 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100017908|Ga0068868_1000179082 |
| Length | 526 |
| Sequence | MLTLAMPVVLAELGWMTMGMVDTLMVGRLGPEAIGAVGVGSSLFMGIVIFAMGLMLGLDALVSRAFGAGDLEACHRWLVHGVTLALVVSLPFMVVLFQIGGALEGWGLAPSVLALTRPYLDALTWSVPPLLLYSAFRRYLQGMGVVKPIMIALAAANVVNLLGNWILIYGHVGAPAMGVRGSAWATVLARMIMAALLXVVILVRERGRRPGLFETPLRVEAPLMRRLIALGLPAASQITLEVGVFASATALAGRLPPAALAAHQIALNIAAFTFMVPLGVASAAAVRVGHAVGRRDLEAASRSGWTAIVVGVTFMMCSALSFLLVPRALIGGFTSDAAVMAIGVRLLTVGAVFQLFDGVQAVATGALRGLGDTRTAMIWNLAGHWFVGLPLGYVLCFGVGVGVVGLWWGLTSGLVICGISLLIAWSRRIAAAPGLLSGADRRHPRMADQNRGIDDTSVPQEENAGQRQSDATPDLVGGREIAPTEMSDRADGRGSDANGTPAFDEVEGEQRRKLYEKGATLVSKID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 104 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 195 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 201 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 202 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 265 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 267 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 276 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 277 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 279 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.53 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.3 |
| Nodule | 0 |
| Rhizoplane | 2.3 |
| Rhizosphere | 93.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10155563 | 3300003323 | Bacteria | 2545 |
| 2 | Ga0070676_10001662 | 3300005328 | Bacteria | 11308 |
| 3 | Ga0070683_100000004 | 3300005329 | Bacteria | 373231 |
| 4 | Ga0070683_100000107 | 3300005329 | Bacteria | 54632 |
| 5 | Ga0070683_100034706 | 3300005329 | Bacteria | 4610 |
| 6 | Ga0070683_100121931 | 3300005329 | Unclassified | 2463 |
| 7 | Ga0070670_100004258 | 3300005331 | Bacteria | 11967 |
| 8 | Ga0070670_100016672 | 3300005331 | Bacteria | 6305 |
| 9 | Ga0068869_100005430 | 3300005334 | Bacteria | 8018 |
| 10 | Ga0068869_100073784 | 3300005334 | Bacteria | 2531 |
| 11 | Ga0070680_100000986 | 3300005336 | Bacteria | 20202 |
| 12 | Ga0070680_100008929 | 3300005336 | Bacteria | 7686 |
| 13 | Ga0070680_100029999 | 3300005336 | Bacteria | 4367 |
| 14 | Ga0070680_100042235 | 3300005336 | Unclassified | 3699 |
| 15 | Ga0070682_100067618 | 3300005337 | Bacteria | 2276 |
| 16 | Ga0068868_100017093 | 3300005338 | Bacteria | 5398 |
| 17 | Ga0068868_100017908 | 3300005338 | Bacteria | 5285 |
| 18 | Ga0068868_100131240 | 3300005338 | Bacteria | 2050 |
| 19 | Ga0070660_100020559 | 3300005339 | Bacteria | 4853 |
| 20 | Ga0070660_100056574 | 3300005339 | Unclassified | 3035 |
| 21 | Ga0070689_100040610 | 3300005340 | Bacteria | 3568 |
| 22 | Ga0070689_100131636 | 3300005340 | Unclassified | 2006 |
| 23 | Ga0070689_100143464 | 3300005340 | Bacteria | 1922 |
| 24 | Ga0070661_100002247 | 3300005344 | Bacteria | 13248 |
| 25 | Ga0070692_10022267 | 3300005345 | Bacteria | 3093 |
| 26 | Ga0070668_100000787 | 3300005347 | Bacteria | 21854 |
| 27 | Ga0070668_100189031 | 3300005347 | Bacteria | 1686 |
| 28 | Ga0070669_100000315 | 3300005353 | Bacteria | 37863 |
| 29 | Ga0070669_100070631 | 3300005353 | Bacteria | 2582 |
| 30 | Ga0070675_100010538 | 3300005354 | Bacteria | 7222 |
| 31 | Ga0070675_100021287 | 3300005354 | Bacteria | 5181 |
| 32 | Ga0070671_100079825 | 3300005355 | Bacteria | 2735 |
| 33 | Ga0070671_100221410 | 3300005355 | Bacteria | 1605 |
| 34 | Ga0070671_100236264 | 3300005355 | Bacteria | 1551 |
| 35 | Ga0070674_100035964 | 3300005356 | Bacteria | 3321 |
| 36 | Ga0070674_100077647 | 3300005356 | Bacteria | 2364 |
| 37 | Ga0070688_100012517 | 3300005365 | Bacteria | 4754 |
| 38 | Ga0070659_100029355 | 3300005366 | Bacteria | 4250 |
| 39 | Ga0070659_100100268 | 3300005366 | Bacteria | 2330 |
| 40 | Ga0070659_100219970 | 3300005366 | Bacteria | 1567 |
| 41 | Ga0070667_100012957 | 3300005367 | Bacteria | 6894 |
| 42 | Ga0070667_100032041 | 3300005367 | Bacteria | 4383 |
| 43 | Ga0070667_100179386 | 3300005367 | Bacteria | 1873 |
| 44 | Ga0070714_100097213 | 3300005435 | Bacteria | 2588 |
| 45 | Ga0070713_100066366 | 3300005436 | Bacteria | 3034 |
| 46 | Ga0070713_100076145 | 3300005436 | Bacteria | 2848 |
| 47 | Ga0070711_100004181 | 3300005439 | Bacteria | 8480 |
| 48 | Ga0070711_100212013 | 3300005439 | Bacteria | 1500 |
| 49 | Ga0070700_100027192 | 3300005441 | Bacteria | 3389 |
| 50 | Ga0070700_100046918 | 3300005441 | Bacteria | 2671 |
| 51 | Ga0070700_100141036 | 3300005441 | Bacteria | 1638 |
| 52 | Ga0070694_100014822 | 3300005444 | Bacteria | 4883 |
| 53 | Ga0070694_100112206 | 3300005444 | Bacteria | 1944 |
| 54 | Ga0070708_100002984 | 3300005445 | Bacteria | 13148 |
| 55 | Ga0070663_100031200 | 3300005455 | Bacteria | 3661 |
| 56 | Ga0070678_100050568 | 3300005456 | Bacteria | 3008 |
| 57 | Ga0070681_10002927 | 3300005458 | Bacteria | 15821 |
| 58 | Ga0070681_10004893 | 3300005458 | Bacteria | 12853 |
| 59 | Ga0070681_10019728 | 3300005458 | Bacteria | 6752 |
| 60 | Ga0070681_10051668 | 3300005458 | Bacteria | 4100 |
| 61 | Ga0070681_10054910 | 3300005458 | Bacteria | 3968 |
| 62 | Ga0070681_10123975 | 3300005458 | Bacteria | 2516 |
| 63 | Ga0070681_10293983 | 3300005458 | Unclassified | 1534 |
| 64 | Ga0070685_10029149 | 3300005466 | Bacteria | 3063 |
| 65 | Ga0070685_10080402 | 3300005466 | Bacteria | 1953 |
| 66 | Ga0070706_100000188 | 3300005467 | Bacteria | 78186 |
| 67 | Ga0070699_100034241 | 3300005518 | Bacteria | 4390 |
| 68 | Ga0070679_100002414 | 3300005530 | Bacteria | 16929 |
| 69 | Ga0070679_100007054 | 3300005530 | Bacteria | 10481 |
| 70 | Ga0070679_100056537 | 3300005530 | Bacteria | 3909 |
| 71 | Ga0070679_100068183 | 3300005530 | Bacteria | 3549 |
| 72 | Ga0070684_100000009 | 3300005535 | Bacteria | 209881 |
| 73 | Ga0070684_100000837 | 3300005535 | Bacteria | 21638 |
| 74 | Ga0070684_100039674 | 3300005535 | Bacteria | 4052 |
| 75 | Ga0070684_100043761 | 3300005535 | Bacteria | 3869 |
| 76 | Ga0070697_100000146 | 3300005536 | Bacteria | 57392 |
| 77 | Ga0070697_100009629 | 3300005536 | Bacteria | 7548 |
| 78 | Ga0068853_100098757 | 3300005539 | Bacteria | 2578 |
| 79 | Ga0068853_100194835 | 3300005539 | Bacteria | 1842 |
| 80 | Ga0070672_100008057 | 3300005543 | Bacteria | 7198 |
| 81 | Ga0070672_100160069 | 3300005543 | Bacteria | 1867 |
| 82 | Ga0070696_100000158 | 3300005546 | Bacteria | 37863 |
| 83 | Ga0070665_100030763 | 3300005548 | Bacteria | 5402 |
| 84 | Ga0070665_100034346 | 3300005548 | Bacteria | 5100 |
| 85 | Ga0070665_100036891 | 3300005548 | Bacteria | 4915 |
| 86 | Ga0070665_100039697 | 3300005548 | Bacteria | 4733 |
| 87 | Ga0070665_100218372 | 3300005548 | Bacteria | 1907 |
| 88 | Ga0070704_100017967 | 3300005549 | Bacteria | 4511 |
| 89 | Ga0068855_100007977 | 3300005563 | Bacteria | 12790 |
| 90 | Ga0068855_100033716 | 3300005563 | Bacteria | 6108 |
| 91 | Ga0068855_100060273 | 3300005563 | Bacteria | 4439 |
| 92 | Ga0068855_100066136 | 3300005563 | Bacteria | 4214 |
| 93 | Ga0068855_100207310 | 3300005563 | Bacteria | 2205 |
| 94 | Ga0070664_100000303 | 3300005564 | Bacteria | 35797 |
| 95 | Ga0070664_100002537 | 3300005564 | Bacteria | 14728 |
| 96 | Ga0068857_100002675 | 3300005577 | Bacteria | 14628 |
| 97 | Ga0068857_100002944 | 3300005577 | Bacteria | 14029 |
| 98 | Ga0068857_100005907 | 3300005577 | Bacteria | 10454 |
| 99 | Ga0068857_100028605 | 3300005577 | Bacteria | 4918 |
| 100 | Ga0068854_100140025 | 3300005578 | Unclassified | 1856 |
| 101 | Ga0068856_100015831 | 3300005614 | Bacteria | 7293 |
| 102 | Ga0068856_100041904 | 3300005614 | Bacteria | 4501 |
| 103 | Ga0068856_100085184 | 3300005614 | Bacteria | 3140 |
| 104 | Ga0068856_100109030 | 3300005614 | Bacteria | 2765 |
| 105 | Ga0068856_100221633 | 3300005614 | Unclassified | 1907 |
| 106 | Ga0068852_100004445 | 3300005616 | Bacteria | 9910 |
| 107 | Ga0068852_100014322 | 3300005616 | Bacteria | 6100 |
| 108 | Ga0068852_100183373 | 3300005616 | Bacteria | 1970 |
| 109 | Ga0068859_100060194 | 3300005617 | Bacteria | 3826 |
| 110 | Ga0068859_100062331 | 3300005617 | Bacteria | 3759 |
| 111 | Ga0068859_100115181 | 3300005617 | Bacteria | 2753 |
| 112 | Ga0068864_100004735 | 3300005618 | Bacteria | 11145 |
| 113 | Ga0068864_100124152 | 3300005618 | Bacteria | 2311 |
| 114 | Ga0068866_10032363 | 3300005718 | Bacteria | 2528 |
| 115 | Ga0068861_100000535 | 3300005719 | Bacteria | 22271 |
| 116 | Ga0068861_100001808 | 3300005719 | Bacteria | 13774 |
| 117 | Ga0068861_100113590 | 3300005719 | Bacteria | 2173 |
| 118 | Ga0068870_10001490 | 3300005840 | Bacteria | 9481 |
| 119 | Ga0068863_100013797 | 3300005841 | Bacteria | 7787 |
| 120 | Ga0068863_100041886 | 3300005841 | Bacteria | 4353 |
| 121 | Ga0068863_100050770 | 3300005841 | Bacteria | 3931 |
| 122 | Ga0068863_100058121 | 3300005841 | Bacteria | 3661 |
| 123 | Ga0068863_100077745 | 3300005841 | Bacteria | 3141 |
| 124 | Ga0068863_100211332 | 3300005841 | Bacteria | 1868 |
| 125 | Ga0068858_100002229 | 3300005842 | Bacteria | 19593 |
| 126 | Ga0068858_100080193 | 3300005842 | Bacteria | 3033 |
| 127 | Ga0068858_100302201 | 3300005842 | Bacteria | 1527 |
| 128 | Ga0068860_100002295 | 3300005843 | Bacteria | 20100 |
| 129 | Ga0068860_100007566 | 3300005843 | Bacteria | 10869 |
| 130 | Ga0068862_100000532 | 3300005844 | Bacteria | 39799 |
| 131 | Ga0068862_100005713 | 3300005844 | Bacteria | 10379 |
| 132 | Ga0068862_100054971 | 3300005844 | Bacteria | 3409 |
| 133 | Ga0081455_10025848 | 3300005937 | Bacteria | 5412 |
| 134 | Ga0081455_10030549 | 3300005937 | Bacteria | 4892 |
| 135 | Ga0081455_10154373 | 3300005937 | Bacteria | 1767 |
| 136 | Ga0081540_1007681 | 3300005983 | Bacteria | 7645 |
| 137 | Ga0081540_1044275 | 3300005983 | Bacteria | 2273 |
| 138 | Ga0070717_10013140 | 3300006028 | Bacteria | 6329 |
| 139 | Ga0070712_100000450 | 3300006175 | Bacteria | 23564 |
| 140 | Ga0075367_10023965 | 3300006178 | Bacteria | 3439 |
| 141 | Ga0075367_10109536 | 3300006178 | Bacteria | 1694 |
| 142 | Ga0075366_10007763 | 3300006195 | Bacteria | 5939 |
| 143 | Ga0075366_10120583 | 3300006195 | Unclassified | 1580 |
| 144 | Ga0097621_100064398 | 3300006237 | Bacteria | 3015 |
| 145 | Ga0075370_10025508 | 3300006353 | Bacteria | 3271 |
| 146 | Ga0068871_100099564 | 3300006358 | Bacteria | 2434 |
| 147 | Ga0068871_100228512 | 3300006358 | Bacteria | 1614 |
| 148 | Ga0075428_100009967 | 3300006844 | Bacteria | 10557 |
| 149 | Ga0075428_100064338 | 3300006844 | Bacteria | 4016 |
| 150 | Ga0075428_100119558 | 3300006844 | Bacteria | 2868 |
| 151 | Ga0075428_100153638 | 3300006844 | Bacteria | 2500 |
| 152 | Ga0075428_100179758 | 3300006844 | Bacteria | 2290 |
| 153 | Ga0075431_100028185 | 3300006847 | Bacteria | 5767 |
| 154 | Ga0075433_10011530 | 3300006852 | Bacteria | 7119 |
| 155 | Ga0075433_10022821 | 3300006852 | Bacteria | 5258 |
| 156 | Ga0075433_10141301 | 3300006852 | Bacteria | 2140 |
| 157 | Ga0075433_10164104 | 3300006852 | Bacteria | 1977 |
| 158 | Ga0075433_10257571 | 3300006852 | Bacteria | 1547 |
| 159 | Ga0075434_100027070 | 3300006871 | Bacteria | 5627 |
| 160 | Ga0075434_100069545 | 3300006871 | Bacteria | 3510 |
| 161 | Ga0075434_100075943 | 3300006871 | Bacteria | 3355 |
| 162 | Ga0075434_100096590 | 3300006871 | Bacteria | 2960 |
| 163 | Ga0075434_100105404 | 3300006871 | Bacteria | 2829 |
| 164 | Ga0075434_100121121 | 3300006871 | Bacteria | 2632 |
| 165 | Ga0075429_100044536 | 3300006880 | Bacteria | 3860 |
| 166 | Ga0075429_100085567 | 3300006880 | Bacteria | 2748 |
| 167 | Ga0075429_100104424 | 3300006880 | Bacteria | 2475 |
| 168 | Ga0068865_100179176 | 3300006881 | Bacteria | 1631 |
| 169 | Ga0075436_100018868 | 3300006914 | Unclassified | 4723 |
| 170 | Ga0075436_100055704 | 3300006914 | Bacteria | 2731 |
| 171 | Ga0097620_100060192 | 3300006931 | Bacteria | 3826 |
| 172 | Ga0097620_100062331 | 3300006931 | Bacteria | 3759 |
| 173 | Ga0097620_100115180 | 3300006931 | Bacteria | 2753 |
| 174 | Ga0075435_100108856 | 3300007076 | Bacteria | 2303 |
| 175 | Ga0099794_10003184 | 3300007265 | Bacteria | 6221 |
| 176 | Ga0105240_10004254 | 3300009093 | Bacteria | 21890 |
| 177 | Ga0105240_10024079 | 3300009093 | Bacteria | 8038 |
| 178 | Ga0105240_10044941 | 3300009093 | Bacteria | 5606 |
| 179 | Ga0105240_10147513 | 3300009093 | Bacteria | 2805 |
| 180 | Ga0111539_10002814 | 3300009094 | Bacteria | 23108 |
| 181 | Ga0111539_10013257 | 3300009094 | Bacteria | 10305 |
| 182 | Ga0111539_10137530 | 3300009094 | Bacteria | 2861 |
| 183 | Ga0111539_10144005 | 3300009094 | Bacteria | 2790 |
| 184 | Ga0111539_10191232 | 3300009094 | Bacteria | 2388 |
| 185 | Ga0111539_10252315 | 3300009094 | Bacteria | 2054 |
| 186 | Ga0105245_10011422 | 3300009098 | Bacteria | 7733 |
| 187 | Ga0105245_10047675 | 3300009098 | Bacteria | 3830 |
| 188 | Ga0105245_10081326 | 3300009098 | Bacteria | 2961 |
| 189 | Ga0105245_10092678 | 3300009098 | Bacteria | 2782 |
| 190 | Ga0105245_10112731 | 3300009098 | Unclassified | 2531 |
| 191 | Ga0105245_10141748 | 3300009098 | Bacteria | 2264 |
| 192 | Ga0114129_10017690 | 3300009147 | Bacteria | 10147 |
| 193 | Ga0114129_10031623 | 3300009147 | Bacteria | 7481 |
| 194 | Ga0114129_10049576 | 3300009147 | Bacteria | 5899 |
| 195 | Ga0114129_10319180 | 3300009147 | Bacteria | 2065 |
| 196 | Ga0105241_10039492 | 3300009174 | Bacteria | 3560 |
| 197 | Ga0105241_10118178 | 3300009174 | Unclassified | 2131 |
| 198 | Ga0105241_10141160 | 3300009174 | Bacteria | 1961 |
| 199 | Ga0105242_10235104 | 3300009176 | Bacteria | 1644 |
| 200 | Ga0105248_10010899 | 3300009177 | Bacteria | 10030 |
| 201 | Ga0105248_10015951 | 3300009177 | Bacteria | 8273 |
| 202 | Ga0105248_10021187 | 3300009177 | Bacteria | 7202 |
| 203 | Ga0105248_10041438 | 3300009177 | Bacteria | 5162 |
| 204 | Ga0105248_10053778 | 3300009177 | Bacteria | 4517 |
| 205 | Ga0105248_10162913 | 3300009177 | Bacteria | 2515 |
| 206 | Ga0105237_10058503 | 3300009545 | Bacteria | 3857 |
| 207 | Ga0105237_10148042 | 3300009545 | Bacteria | 2343 |
| 208 | Ga0105238_10042838 | 3300009551 | Bacteria | 4582 |
| 209 | Ga0105249_10000075 | 3300009553 | Bacteria | 145150 |
| 210 | Ga0105249_10001616 | 3300009553 | Bacteria | 19734 |
| 211 | Ga0105249_10003487 | 3300009553 | Bacteria | 13628 |
| 212 | Ga0105249_10018855 | 3300009553 | Bacteria | 6149 |
| 213 | Ga0105249_10153129 | 3300009553 | Bacteria | 2221 |
| 214 | Ga0105239_10003833 | 3300010375 | Bacteria | 18263 |
| 215 | Ga0105239_10004471 | 3300010375 | Bacteria | 16709 |
| 216 | Ga0105239_10064265 | 3300010375 | Bacteria | 4029 |
| 217 | Ga0157373_10154120 | 3300013100 | Unclassified | 1617 |
| 218 | Ga0157373_10180165 | 3300013100 | Unclassified | 1487 |
| 219 | Ga0157371_10158047 | 3300013102 | Bacteria | 1618 |
| 220 | Ga0157370_10001248 | 3300013104 | Bacteria | 31761 |
| 221 | Ga0157370_10002893 | 3300013104 | Bacteria | 20474 |
| 222 | Ga0157370_10002972 | 3300013104 | Bacteria | 20158 |
| 223 | Ga0157370_10051500 | 3300013104 | Bacteria | 3933 |
| 224 | Ga0157370_10119837 | 3300013104 | Bacteria | 2457 |
| 225 | Ga0157370_10256605 | 3300013104 | Bacteria | 1616 |
| 226 | Ga0157369_10008063 | 3300013105 | Bacteria | 12078 |
| 227 | Ga0157369_10054644 | 3300013105 | Bacteria | 4312 |
| 228 | Ga0157369_10222162 | 3300013105 | Bacteria | 1977 |
| 229 | Ga0157374_10011135 | 3300013296 | Bacteria | 7775 |
| 230 | Ga0157374_10013301 | 3300013296 | Bacteria | 7180 |
| 231 | Ga0157374_10020961 | 3300013296 | Bacteria | 5807 |
| 232 | Ga0157378_10033360 | 3300013297 | Unclassified | 4550 |
| 233 | Ga0163162_10005049 | 3300013306 | Bacteria | 12716 |
| 234 | Ga0163162_10016179 | 3300013306 | Bacteria | 7294 |
| 235 | Ga0157372_10000636 | 3300013307 | Bacteria | 38481 |
| 236 | Ga0157372_10023277 | 3300013307 | Bacteria | 6714 |
| 237 | Ga0157372_10068546 | 3300013307 | Bacteria | 3988 |
| 238 | Ga0157372_10132573 | 3300013307 | Bacteria | 2868 |
| 239 | Ga0157372_10187236 | 3300013307 | Bacteria | 2397 |
| 240 | Ga0157372_10275023 | 3300013307 | Bacteria | 1957 |
| 241 | Ga0157375_10001896 | 3300013308 | Bacteria | 17977 |
| 242 | Ga0163163_10054577 | 3300014325 | Bacteria | 3948 |
| 243 | Ga0163163_10103201 | 3300014325 | Bacteria | 2876 |
| 244 | Ga0163163_10283404 | 3300014325 | Unclassified | 1709 |
| 245 | Ga0163163_10290497 | 3300014325 | Bacteria | 1687 |
| 246 | Ga0157380_10031126 | 3300014326 | Bacteria | 4094 |
| 247 | Ga0157380_10053361 | 3300014326 | Bacteria | 3205 |
| 248 | Ga0157379_10000377 | 3300014968 | Bacteria | 36018 |
| 249 | Ga0157379_10004256 | 3300014968 | Bacteria | 12220 |
| 250 | Ga0157379_10035045 | 3300014968 | Bacteria | 4474 |
| 251 | Ga0157376_10023071 | 3300014969 | Bacteria | 4864 |
| 252 | Ga0157376_10070801 | 3300014969 | Bacteria | 2961 |
| 253 | Ga0213872_10001135 | 3300021361 | Bacteria | 18210 |
| 254 | Ga0213876_10006068 | 3300021384 | Bacteria | 6603 |
| 255 | Ga0213875_10000764 | 3300021388 | Bacteria | 24218 |
| 256 | Ga0228598_1000011 | 3300024227 | Bacteria | 26445 |
| 257 | Ga0209437_101450 | 3300025233 | Bacteria | 5770 |
| 258 | Ga0207697_10001044 | 3300025315 | Bacteria | 15356 |
| 259 | Ga0207697_10031479 | 3300025315 | Bacteria | 2170 |
| 260 | Ga0207682_10036932 | 3300025893 | Unclassified | 1978 |
| 261 | Ga0207688_10121980 | 3300025901 | Bacteria | 1521 |
| 262 | Ga0207680_10047111 | 3300025903 | Bacteria | 2552 |
| 263 | Ga0207699_10112903 | 3300025906 | Unclassified | 1744 |
| 264 | Ga0207645_10000294 | 3300025907 | Bacteria | 41976 |
| 265 | Ga0207643_10001203 | 3300025908 | Bacteria | 15301 |
| 266 | Ga0207684_10001145 | 3300025910 | Bacteria | 29602 |
| 267 | Ga0207654_10018384 | 3300025911 | Bacteria | 3666 |
| 268 | Ga0207707_10002005 | 3300025912 | Bacteria | 18476 |
| 269 | Ga0207707_10005331 | 3300025912 | Bacteria | 11237 |
| 270 | Ga0207707_10045503 | 3300025912 | Bacteria | 3824 |
| 271 | Ga0207695_10011850 | 3300025913 | Bacteria | 10517 |
| 272 | Ga0207695_10019230 | 3300025913 | Bacteria | 7866 |
| 273 | Ga0207671_10030165 | 3300025914 | Bacteria | 4045 |
| 274 | Ga0207671_10078083 | 3300025914 | Bacteria | 2479 |
| 275 | Ga0207693_10000740 | 3300025915 | Bacteria | 29433 |
| 276 | Ga0207663_10001920 | 3300025916 | Bacteria | 9844 |
| 277 | Ga0207660_10003975 | 3300025917 | Bacteria | 9635 |
| 278 | Ga0207660_10010784 | 3300025917 | Bacteria | 5939 |
| 279 | Ga0207660_10174626 | 3300025917 | Bacteria | 1665 |
| 280 | Ga0207662_10001571 | 3300025918 | Bacteria | 11178 |
| 281 | Ga0207657_10007399 | 3300025919 | Bacteria | 11261 |
| 282 | Ga0207657_10086093 | 3300025919 | Bacteria | 2631 |
| 283 | Ga0207657_10179881 | 3300025919 | Unclassified | 1710 |
| 284 | Ga0207649_10006940 | 3300025920 | Bacteria | 6156 |
| 285 | Ga0207649_10016840 | 3300025920 | Bacteria | 4134 |
| 286 | Ga0207652_10016114 | 3300025921 | Bacteria | 6096 |
| 287 | Ga0207652_10025118 | 3300025921 | Bacteria | 4950 |
| 288 | Ga0207652_10053417 | 3300025921 | Unclassified | 3470 |
| 289 | Ga0207681_10002911 | 3300025923 | Bacteria | 10813 |
| 290 | Ga0207681_10003187 | 3300025923 | Bacteria | 10297 |
| 291 | Ga0207681_10009430 | 3300025923 | Bacteria | 5965 |
| 292 | Ga0207694_10045311 | 3300025924 | Bacteria | 3397 |
| 293 | Ga0207694_10096491 | 3300025924 | Bacteria | 2338 |
| 294 | Ga0207650_10146621 | 3300025925 | Bacteria | 1859 |
| 295 | Ga0207650_10211553 | 3300025925 | Bacteria | 1557 |
| 296 | Ga0207659_10097554 | 3300025926 | Bacteria | 2208 |
| 297 | Ga0207659_10131124 | 3300025926 | Bacteria | 1935 |
| 298 | Ga0207687_10056683 | 3300025927 | Bacteria | 2749 |
| 299 | Ga0207687_10176455 | 3300025927 | Bacteria | 1652 |
| 300 | Ga0207700_10053104 | 3300025928 | Bacteria | 3034 |
| 301 | Ga0207664_10060266 | 3300025929 | Bacteria | 3024 |
| 302 | Ga0207664_10203013 | 3300025929 | Bacteria | 1712 |
| 303 | Ga0207644_10026555 | 3300025931 | Bacteria | 3991 |
| 304 | Ga0207690_10027692 | 3300025932 | Bacteria | 3583 |
| 305 | Ga0207690_10028889 | 3300025932 | Bacteria | 3519 |
| 306 | Ga0207690_10033141 | 3300025932 | Bacteria | 3320 |
| 307 | Ga0207706_10000472 | 3300025933 | Bacteria | 43032 |
| 308 | Ga0207686_10029822 | 3300025934 | Bacteria | 3223 |
| 309 | Ga0207669_10006981 | 3300025937 | Bacteria | 5195 |
| 310 | Ga0207665_10020845 | 3300025939 | Bacteria | 4309 |
| 311 | Ga0207691_10000248 | 3300025940 | Bacteria | 53460 |
| 312 | Ga0207691_10050361 | 3300025940 | Bacteria | 3813 |
| 313 | Ga0207691_10077693 | 3300025940 | Bacteria | 2990 |
| 314 | Ga0207711_10089500 | 3300025941 | Bacteria | 2705 |
| 315 | Ga0207711_10185194 | 3300025941 | Bacteria | 1895 |
| 316 | Ga0207689_10000810 | 3300025942 | Bacteria | 30206 |
| 317 | Ga0207661_10000017 | 3300025944 | Bacteria | 289163 |
| 318 | Ga0207661_10327251 | 3300025944 | Unclassified | 1379 |
| 319 | Ga0207679_10002710 | 3300025945 | Bacteria | 10955 |
| 320 | Ga0207679_10015334 | 3300025945 | Bacteria | 5061 |
| 321 | Ga0207679_10077234 | 3300025945 | Bacteria | 2532 |
| 322 | Ga0207667_10000814 | 3300025949 | Bacteria | 40498 |
| 323 | Ga0207667_10033625 | 3300025949 | Bacteria | 5511 |
| 324 | Ga0207667_10076950 | 3300025949 | Bacteria | 3462 |
| 325 | Ga0207667_10081857 | 3300025949 | Bacteria | 3344 |
| 326 | Ga0207667_10283136 | 3300025949 | Bacteria | 1694 |
| 327 | Ga0207712_10001640 | 3300025961 | Bacteria | 15074 |
| 328 | Ga0207712_10001936 | 3300025961 | Bacteria | 13605 |
| 329 | Ga0207712_10003750 | 3300025961 | Bacteria | 9591 |
| 330 | Ga0207668_10027203 | 3300025972 | Bacteria | 3724 |
| 331 | Ga0207668_10163687 | 3300025972 | Bacteria | 1736 |
| 332 | Ga0207658_10238448 | 3300025986 | Bacteria | 1539 |
| 333 | Ga0207677_10012606 | 3300026023 | Bacteria | 4869 |
| 334 | Ga0207677_10052830 | 3300026023 | Bacteria | 2763 |
| 335 | Ga0207703_10029945 | 3300026035 | Bacteria | 4298 |
| 336 | Ga0207708_10062825 | 3300026075 | Bacteria | 2837 |
| 337 | Ga0207702_10047500 | 3300026078 | Bacteria | 3618 |
| 338 | Ga0207702_10058122 | 3300026078 | Bacteria | 3290 |
| 339 | Ga0207702_10083166 | 3300026078 | Bacteria | 2785 |
| 340 | Ga0207641_10042241 | 3300026088 | Bacteria | 3824 |
| 341 | Ga0207641_10131123 | 3300026088 | Bacteria | 2251 |
| 342 | Ga0207648_10015089 | 3300026089 | Bacteria | 7113 |
| 343 | Ga0207648_10016684 | 3300026089 | Bacteria | 6701 |
| 344 | Ga0207676_10134835 | 3300026095 | Bacteria | 2105 |
| 345 | Ga0207674_10001081 | 3300026116 | Bacteria | 35413 |
| 346 | Ga0207674_10010697 | 3300026116 | Bacteria | 10364 |
| 347 | Ga0207674_10018383 | 3300026116 | Bacteria | 7599 |
| 348 | Ga0207674_10032332 | 3300026116 | Bacteria | 5489 |
| 349 | Ga0207675_100000373 | 3300026118 | Bacteria | 43010 |
| 350 | Ga0207675_100008014 | 3300026118 | Bacteria | 9957 |
| 351 | Ga0207675_100036082 | 3300026118 | Bacteria | 4611 |
| 352 | Ga0207675_100068305 | 3300026118 | Bacteria | 3322 |
| 353 | Ga0207698_10008821 | 3300026142 | Bacteria | 6391 |
| 354 | Ga0207698_10012808 | 3300026142 | Bacteria | 5507 |
| 355 | Ga0207698_10019143 | 3300026142 | Bacteria | 4680 |
| 356 | Ga0207698_10150211 | 3300026142 | Bacteria | 2021 |
| 357 | Ga0207698_10226952 | 3300026142 | Unclassified | 1692 |
| 358 | Ga0207428_10005106 | 3300027907 | Bacteria | 12320 |
| 359 | Ga0207428_10006382 | 3300027907 | Bacteria | 10898 |
| 360 | Ga0207428_10026033 | 3300027907 | Bacteria | 4887 |
| 361 | Ga0268266_10019916 | 3300028379 | Bacteria | 5717 |
| 362 | Ga0268265_10002731 | 3300028380 | Bacteria | 13047 |
| 363 | Ga0268265_10007702 | 3300028380 | Bacteria | 7266 |
| 364 | Ga0268265_10061222 | 3300028380 | Bacteria | 2888 |
| 365 | Ga0268264_10008130 | 3300028381 | Bacteria | 8720 |
| 366 | Ga0268264_10043664 | 3300028381 | Bacteria | 3716 |
| 367 | Ga0265323_10000578 | 3300028653 | Bacteria | 20270 |
| 368 | Ga0265770_1000931 | 3300030878 | Bacteria | 4053 |
| 369 | Ga0265760_10010248 | 3300031090 | Bacteria | 2674 |
| 370 | Ga0265760_10020308 | 3300031090 | Bacteria | 1917 |
| 371 | Ga0265330_10040056 | 3300031235 | Bacteria | 2081 |
| 372 | Ga0265332_10008447 | 3300031238 | Bacteria | 4627 |
| 373 | Ga0265320_10048767 | 3300031240 | Unclassified | 2065 |
| 374 | Ga0265339_10001474 | 3300031249 | Bacteria | 17384 |
| 375 | Ga0265316_10093482 | 3300031344 | Bacteria | 2291 |
| 376 | Ga0307408_100002025 | 3300031548 | Bacteria | 14622 |
| 377 | Ga0307408_100032799 | 3300031548 | Bacteria | 3623 |
| 378 | Ga0265314_10000265 | 3300031711 | Bacteria | 76736 |
| 379 | Ga0265314_10003899 | 3300031711 | Bacteria | 14177 |
| 380 | Ga0265314_10037637 | 3300031711 | Unclassified | 3504 |
| 381 | Ga0265342_10020643 | 3300031712 | Bacteria | 4219 |
| 382 | Ga0307405_10024888 | 3300031731 | Bacteria | 3428 |
| 383 | Ga0307405_10060463 | 3300031731 | Bacteria | 2391 |
| 384 | Ga0307410_10014301 | 3300031852 | Bacteria | 4666 |
| 385 | Ga0307410_10030587 | 3300031852 | Bacteria | 3443 |
| 386 | Ga0307410_10036042 | 3300031852 | Unclassified | 3218 |
| 387 | Ga0307410_10069903 | 3300031852 | Bacteria | 2430 |
| 388 | Ga0307406_10008031 | 3300031901 | Bacteria | 5875 |
| 389 | Ga0307407_10098157 | 3300031903 | Unclassified | 1812 |
| 390 | Ga0307407_10110674 | 3300031903 | Bacteria | 1723 |
| 391 | Ga0307409_100053360 | 3300031995 | Bacteria | 3106 |
| 392 | Ga0307409_100098095 | 3300031995 | Bacteria | 2422 |
| 393 | Ga0307416_100068852 | 3300032002 | Unclassified | 2926 |
| 394 | Ga0307416_100191291 | 3300032002 | Unclassified | 1930 |
| 395 | Ga0307414_10026853 | 3300032004 | Bacteria | 3711 |
| 396 | Ga0307411_10025449 | 3300032005 | Bacteria | 3546 |
| 397 | Ga0307415_100012860 | 3300032126 | Bacteria | 4859 |
| 398 | Ga0307415_100092788 | 3300032126 | Bacteria | 2190 |
| 399 | Ga0307415_100192150 | 3300032126 | Bacteria | 1612 |
| 400 | Ga0307507_10023294 | 3300033179 | Bacteria | 6803 |
| 401 | Ga0373926_0034429 | 3300035083 | Bacteria | 1793 |
| 402 | Ga0373945_0044208 | 3300035116 | Unclassified | 1619 |
| 403 | Ga0373935_0015892 | 3300035692 | Bacteria | 4555 |
| 404 | Ga0373927_0029269 | 3300035695 | Bacteria | 3589 |
| 405 | Ga0373947_0000515 | 3300035725 | Bacteria | 22532 |
| 406 | Ga0373947_0007766 | 3300035725 | Bacteria | 6197 |
| 407 | Ga0373947_0058334 | 3300035725 | Unclassified | 2339 |
| 408 | Ga0373947_0058719 | 3300035725 | Bacteria | 2331 |
| 409 | Ga0373947_0075713 | 3300035725 | Bacteria | 2073 |
| 410 | Ga0316582_0071653 | 3300036647 | Bacteria | 2245 |
| 411 | Ga0373925_0000805 | 3300037068 | Bacteria | 28892 |
| 412 | Ga0373925_0005848 | 3300037068 | Bacteria | 9123 |
| 413 | Ga0373925_0011291 | 3300037068 | Bacteria | 6480 |
| 414 | Ga0373925_0053576 | 3300037068 | Bacteria | 3016 |
| 415 | Ga0373925_0056398 | 3300037068 | Bacteria | 2943 |
| 416 | Ga0395900_0084751 | 3300037418 | Bacteria | 3257 |
| 417 | Ga0395900_0179252 | 3300037418 | Bacteria | 2154 |
| 418 | Ga0395898_0089512 | 3300037466 | Bacteria | 2962 |
| 419 | Ga0395905_0001469 | 3300037471 | Bacteria | 28257 |
| 420 | Ga0395905_0002922 | 3300037471 | Bacteria | 18626 |
| 421 | Ga0395905_0013165 | 3300037471 | Bacteria | 7939 |
| 422 | Ga0395905_0026517 | 3300037471 | Bacteria | 5463 |
| 423 | Ga0395905_0029454 | 3300037471 | Bacteria | 5172 |
| 424 | Ga0395905_0291737 | 3300037471 | Unclassified | 1518 |
| 425 | Ga0436364_0165597 | 3300037853 | Bacteria | 24805 |
| 426 | Ga0436364_0419311 | 3300037853 | Bacteria | 3408 |
| 427 | Ga0395901_0099465 | 3300038443 | Bacteria | 3050 |
| 428 | Ga0395901_0153709 | 3300038443 | Unclassified | 2417 |
| 429 | Ga0436365_0102863 | 3300039437 | Bacteria | 1830 |
| 430 | Ga0436365_0887495 | 3300039437 | Bacteria | 13822 |
| 431 | Ga0436365_1128249 | 3300039437 | Unclassified | 2898 |
| 432 | Ga0436360_0731860 | 3300039438 | Bacteria | 7720 |
| 433 | Ga0436361_0596240 | 3300039447 | Bacteria | 18495 |
| 434 | Ga0436363_1248950 | 3300039450 | Bacteria | 9096 |
| 435 | Ga0450923_003199 | 3300042125 | Bacteria | 2444 |
| 436 | Ga0451577_0012747 | 3300042876 | Bacteria | 7886 |
| 437 | Ga0466961_0081450 | 3300044693 | Bacteria | 2048 |
| 438 | Ga0466963_0004370 | 3300044694 | Bacteria | 8209 |
| 439 | Ga0466963_0102205 | 3300044694 | Unclassified | 1963 |
| 440 | Ga0466964_0082304 | 3300044706 | Unclassified | 1384 |
| 441 | Ga0453684_0139684 | 3300044712 | Bacteria | 2895 |
| 442 | Ga0466957_0000211 | 3300044842 | Bacteria | 27323 |
| 443 | Ga0466957_0047820 | 3300044842 | Bacteria | 2600 |
| 444 | Ga0451576_0051303 | 3300045051 | Archaea | 4325 |
| 445 | Ga0466958_0135745 | 3300045836 | Bacteria | 1547 |
| 446 | Ga0466967_0270362 | 3300045976 | Bacteria | 1629 |
| 447 | Ga0495638_0012569 | 3300046460 | Bacteria | 5795 |
| 448 | Ga0495641_0046971 | 3300046461 | Bacteria | 1983 |
| 449 | Ga0495580_0001952 | 3300046472 | Bacteria | 18101 |
| 450 | Ga0495580_0004381 | 3300046472 | Bacteria | 11858 |
| 451 | Ga0495580_0040622 | 3300046472 | Bacteria | 3322 |
| 452 | Ga0495580_0046872 | 3300046472 | Bacteria | 3065 |
| 453 | Ga0495580_0048686 | 3300046472 | Bacteria | 2999 |
| 454 | Ga0495582_0018018 | 3300046473 | Bacteria | 3861 |
| 455 | Ga0495664_0027369 | 3300046477 | Bacteria | 3324 |
| 456 | Ga0495664_0040101 | 3300046477 | Bacteria | 2768 |
| 457 | Ga0495594_0051796 | 3300046499 | Bacteria | 2259 |
| 458 | Ga0495631_0090071 | 3300046518 | Bacteria | 1321 |
| 459 | Ga0495652_0199931 | 3300046529 | Bacteria | 1517 |
| 460 | Ga0495665_0017121 | 3300046531 | Bacteria | 3899 |
| 461 | Ga0495640_0045916 | 3300046533 | Bacteria | 3030 |
| 462 | Ga0495586_0053910 | 3300046535 | Bacteria | 2179 |
| 463 | Ga0495598_0004375 | 3300046537 | Bacteria | 3054 |
| 464 | Ga0495645_0002242 | 3300046543 | Bacteria | 13150 |
| 465 | Ga0495635_0030952 | 3300046663 | Bacteria | 3717 |
| 466 | Ga0495588_0013246 | 3300046674 | Bacteria | 3925 |
| 467 | Ga0495599_0061093 | 3300046678 | Bacteria | 2355 |
| 468 | Ga0495623_0042029 | 3300046679 | Bacteria | 2914 |
| 469 | Ga0495658_0021335 | 3300046683 | Bacteria | 3414 |
| 470 | Ga0495669_0002195 | 3300046684 | Bacteria | 8011 |
| 471 | Ga0495613_0161819 | 3300046689 | Bacteria | 1592 |
| 472 | Ga0495624_0019818 | 3300046690 | Bacteria | 4482 |
| 473 | Ga0495636_0020276 | 3300047318 | Bacteria | 2679 |
| 474 | Ga0495674_0011676 | 3300047319 | Bacteria | 8285 |
| 475 | Ga0495674_0103697 | 3300047319 | Bacteria | 2418 |
| 476 | Ga0495676_0019273 | 3300047321 | Bacteria | 6003 |
| 477 | Ga0495680_0176547 | 3300047322 | Bacteria | 1544 |
| 478 | Ga0495675_0004864 | 3300047444 | Bacteria | 8173 |
| 479 | Ga0495675_0033858 | 3300047444 | Unclassified | 3261 |
| 480 | Ga0495684_0000834 | 3300047471 | Bacteria | 24968 |
| 481 | Ga0495686_0009251 | 3300047472 | Bacteria | 7119 |
| 482 | Ga0495602_0025838 | 3300048088 | Bacteria | 5677 |
| 483 | Ga0496102_0422483 | 3300048905 | Bacteria | 1252 |
| 484 | Ga0496104_0001482 | 3300048907 | Bacteria | 20248 |
| 485 | Ga0496104_0246631 | 3300048907 | Bacteria | 1699 |
| 486 | Ga0496105_0014831 | 3300048908 | Bacteria | 6204 |
| 487 | Ga0496108_0000282 | 3300048911 | Bacteria | 43586 |
| 488 | Ga0496109_0003251 | 3300048912 | Bacteria | 13544 |
| 489 | Ga0496110_0011781 | 3300048913 | Bacteria | 7177 |
| 490 | Ga0496110_0118054 | 3300048913 | Bacteria | 2389 |
| 491 | Ga0496111_0000460 | 3300048914 | Bacteria | 20673 |
| 492 | Ga0496112_0001067 | 3300048915 | Bacteria | 20244 |
| 493 | Ga0496112_0067014 | 3300048915 | Bacteria | 3542 |
| 494 | Ga0496112_0184138 | 3300048915 | Bacteria | 2052 |
| 495 | Ga0496115_0015481 | 3300048918 | Bacteria | 5786 |
| 496 | Ga0496126_0000012 | 3300048929 | Bacteria | 727789 |
| 497 | Ga0501033_0066662 | 3300049570 | Unclassified | 2647 |
| 498 | Ga0501034_0188202 | 3300049571 | Bacteria | 2027 |
| 499 | Ga0501038_0140629 | 3300049574 | Bacteria | 1975 |
| 500 | Ga0501038_0194572 | 3300049574 | Bacteria | 1630 |
| 501 | Ga0501040_0021280 | 3300049576 | Bacteria | 4330 |
| 502 | Ga0501043_0113724 | 3300049579 | Bacteria | 2125 |
| 503 | Ga0501047_0012968 | 3300049581 | Bacteria | 7891 |
| 504 | Ga0501047_0016610 | 3300049581 | Bacteria | 7027 |
| 505 | Ga0501047_0150093 | 3300049581 | Bacteria | 2207 |
| 506 | Ga0501071_0014003 | 3300049587 | Bacteria | 5480 |
| 507 | Ga0501072_0013363 | 3300049588 | Bacteria | 6285 |
| 508 | Ga0501072_0130510 | 3300049588 | Bacteria | 2003 |
| 509 | Ga0501073_0011518 | 3300049589 | Bacteria | 6467 |
| 510 | Ga0501075_0016115 | 3300049591 | Bacteria | 5379 |
| 511 | Ga0501075_0026433 | 3300049591 | Bacteria | 4273 |
| 512 | Ga0501076_0027275 | 3300049592 | Bacteria | 4430 |
| 513 | Ga0501076_0067571 | 3300049592 | Bacteria | 2854 |
| 514 | Ga0501076_0078159 | 3300049592 | Bacteria | 2655 |
| 515 | Ga0501076_0085279 | 3300049592 | Bacteria | 2538 |
| 516 | Ga0501076_0098618 | 3300049592 | Bacteria | 2354 |
| 517 | Ga0501077_0006966 | 3300049593 | Bacteria | 6964 |
| 518 | Ga0501077_0065403 | 3300049593 | Bacteria | 2306 |
| 519 | Ga0501079_0119727 | 3300049741 | Bacteria | 2047 |
| 520 | Ga0501081_0059640 | 3300049743 | Unclassified | 2642 |
| 521 | Ga0501081_0071743 | 3300049743 | Bacteria | 2415 |
| 522 | Ga0501035_0005699 | 3300049822 | Bacteria | 11753 |
| 523 | Ga0501035_0081860 | 3300049822 | Bacteria | 2849 |
| 524 | Ga0501035_0153904 | 3300049822 | Bacteria | 1994 |
| 525 | Ga0501044_0000391 | 3300049823 | Bacteria | 54344 |
| 526 | Ga0501044_0001179 | 3300049823 | Bacteria | 30978 |
| 527 | Ga0501044_0005369 | 3300049823 | Bacteria | 14241 |
| 528 | Ga0501045_0004716 | 3300049824 | Bacteria | 9410 |
| 529 | Ga0501045_0069252 | 3300049824 | Bacteria | 2593 |
| 530 | nmdc:mga00v17_59311_c1 | 3300050491 | Bacteria | 2348 |
| 531 | nmdc:mga0k408_45932_c1 | 3300050493 | Bacteria | 2521 |
| 532 | nmdc:mga0k408_7210_c1 | 3300050493 | Bacteria | 4243 |
| 533 | nmdc:mga04h51_34753_c1 | 3300050495 | Bacteria | 1612 |
| 534 | nmdc:mga07m45_26394_c1 | 3300050496 | Bacteria | 3193 |
| 535 | nmdc:mga05p37_128956_c1 | 3300050507 | Bacteria | 3105 |
| 536 | nmdc:mga05p37_7289_c1 | 3300050507 | Bacteria | 13048 |
| 537 | nmdc:mga05p37_87053_c1 | 3300050507 | Bacteria | 3098 |
| 538 | nmdc:mga0qj67_81065_c1 | 3300050509 | Unclassified | 2601 |
| 539 | nmdc:mga06r32_122420_c1 | 3300050510 | Bacteria | 2567 |
| 540 | nmdc:mga06r32_59853_c1 | 3300050510 | Bacteria | 2989 |
| 541 | nmdc:mga08y16_137997_c1 | 3300050511 | Bacteria | 2535 |
| 542 | nmdc:mga08y16_41120_c1 | 3300050511 | Bacteria | 4843 |
| 543 | nmdc:mga08y16_48370_c1 | 3300050511 | Bacteria | 4451 |
| 544 | nmdc:mga08y16_7848_c1 | 3300050511 | Bacteria | 11180 |
| 545 | nmdc:mga0n895_11757_c1 | 3300050512 | Bacteria | 7824 |
| 546 | nmdc:mga0n895_122336_c1 | 3300050512 | Bacteria | 2624 |
| 547 | nmdc:mga0n895_124571_c1 | 3300050512 | Bacteria | 2600 |
| 548 | nmdc:mga0n895_131547_c1 | 3300050512 | Bacteria | 2527 |
| 549 | nmdc:mga0n895_19591_c1 | 3300050512 | Bacteria | 6290 |
| 550 | nmdc:mga0n895_67720_c1 | 3300050512 | Bacteria | 3536 |
| 551 | nmdc:mga0a205_14407_c1 | 3300050515 | Unclassified | 2002 |
| 552 | nmdc:mga0a205_146529_c1 | 3300050515 | Bacteria | 2261 |
| 553 | nmdc:mga0a205_35212_c2 | 3300050515 | Bacteria | 2598 |
| 554 | nmdc:mga0a205_73367_c2 | 3300050515 | Bacteria | 2097 |
| 555 | nmdc:mga0a205_7790_c1 | 3300050515 | Bacteria | 9724 |
| 556 | Ga0495612_0009486 | 3300053078 | Bacteria | 3947 |
| 557 | Ga0495619_0101806 | 3300053085 | Bacteria | 1956 |
| 558 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 559 | Ga0500616_0007013 | 3300053153 | Bacteria | 7235 |
| 560 | Ga0501084_0019109 | 3300054114 | Bacteria | 5707 |
| 561 | Ga0501084_0291196 | 3300054114 | Bacteria | 1379 |
| 562 | Ga0590074_000647 | 3300059423 | Bacteria | 5252 |
| 563 | Ga0590077_000251 | 3300059426 | Bacteria | 15342 |
| 564 | Ga0501082_0000586 | 3300060353 | Bacteria | 32220 |
| 565 | Ga0530510_0021950 | 3300061734 | Bacteria | 4544 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046518 | Ga0495631_0090071 | Ga0495631_0090071_20_1177 | 331 |
| 2 | 3300048905 | Ga0496102_0422483 | Ga0496102_0422483_11_1177 | 359 |
| 3 | 3300013307 | Ga0157372_10275023 | Ga0157372_102750232 | 371 |
| 4 | 3300006028 | Ga0070717_10013140 | Ga0070717_100131408 | 373 |
| 5 | 3300014968 | Ga0157379_10000377 | Ga0157379_1000037725 | 381 |
| 6 | 3300024227 | Ga0228598_1000011 | Ga0228598_10000116 | 381 |
| 7 | 3300025949 | Ga0207667_10076950 | Ga0207667_100769503 | 386 |
| 8 | 3300006237 | Ga0097621_100064398 | Ga0097621_1000643985 | 393 |
| 9 | 3300005548 | Ga0070665_100036891 | Ga0070665_1000368914 | 394 |
| 10 | 3300033179 | Ga0307507_10023294 | Ga0307507_100232946 | 395 |
| 11 | 3300005329 | Ga0070683_100000004 | Ga0070683_100000004190 | 396 |
| 12 | 3300005535 | Ga0070684_100000009 | Ga0070684_1000000092 | 396 |
| 13 | 3300025944 | Ga0207661_10000017 | Ga0207661_10000017109 | 396 |
| 14 | 3300035725 | Ga0373947_0075713 | Ga0373947_0075713_632_2041 | 396 |
| 15 | 3300050493 | nmdc:mga0k408_45932_c1 | nmdc:mga0k408_45932_c1_245_1630 | 396 |
| 16 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_151049_152446 | 396 |
| 17 | 3300009094 | Ga0111539_10144005 | Ga0111539_101440053 | 397 |
| 18 | 3300036647 | Ga0316582_0071653 | Ga0316582_0071653_633_2030 | 398 |
| 19 | 3300053153 | Ga0500616_0007013 | Ga0500616_0007013_5325_6722 | 398 |
| 20 | 3300005340 | Ga0070689_100143464 | Ga0070689_1001434641 | 399 |
| 21 | 3300005466 | Ga0070685_10080402 | Ga0070685_100804022 | 399 |
| 22 | 3300005617 | Ga0068859_100060194 | Ga0068859_1000601942 | 399 |
| 23 | 3300006931 | Ga0097620_100060192 | Ga0097620_1000601922 | 399 |
| 24 | 3300005353 | Ga0070669_100000315 | Ga0070669_10000031530 | 400 |
| 25 | 3300005441 | Ga0070700_100141036 | Ga0070700_1001410362 | 400 |
| 26 | 3300005543 | Ga0070672_100160069 | Ga0070672_1001600693 | 400 |
| 27 | 3300005844 | Ga0068862_100005713 | Ga0068862_1000057136 | 400 |
| 28 | 3300009094 | Ga0111539_10002814 | Ga0111539_100028145 | 400 |
| 29 | 3300009553 | Ga0105249_10001616 | Ga0105249_1000161615 | 400 |
| 30 | 3300025923 | Ga0207681_10002911 | Ga0207681_100029115 | 400 |
| 31 | 3300025940 | Ga0207691_10077693 | Ga0207691_100776933 | 400 |
| 32 | 3300025961 | Ga0207712_10003750 | Ga0207712_100037503 | 400 |
| 33 | 3300026095 | Ga0207676_10134835 | Ga0207676_101348353 | 400 |
| 34 | 3300027907 | Ga0207428_10005106 | Ga0207428_1000510611 | 400 |
| 35 | 3300035083 | Ga0373926_0034429 | Ga0373926_0034429_76_1461 | 400 |
| 36 | 3300035692 | Ga0373935_0015892 | Ga0373935_0015892_176_1561 | 400 |
| 37 | 3300035695 | Ga0373927_0029269 | Ga0373927_0029269_135_1520 | 400 |
| 38 | 3300035725 | Ga0373947_0058719 | Ga0373947_0058719_116_1501 | 400 |
| 39 | 3300037068 | Ga0373925_0011291 | Ga0373925_0011291_1814_3199 | 400 |
| 40 | 3300050511 | nmdc:mga08y16_41120_c1 | nmdc:mga08y16_41120_c1_3204_4610 | 400 |
| 41 | 3300005577 | Ga0068857_100028605 | Ga0068857_1000286051 | 401 |
| 42 | 3300013307 | Ga0157372_10187236 | Ga0157372_101872363 | 401 |
| 43 | 3300021384 | Ga0213876_10006068 | Ga0213876_100060684 | 401 |
| 44 | 3300025949 | Ga0207667_10081857 | Ga0207667_100818573 | 401 |
| 45 | 3300026116 | Ga0207674_10032332 | Ga0207674_100323325 | 401 |
| 46 | 3300039437 | Ga0436365_0102863 | Ga0436365_0102863_62_1384 | 401 |
| 47 | 3300039437 | Ga0436365_0887495 | Ga0436365_0887495_4023_5384 | 401 |
| 48 | 3300005366 | Ga0070659_100100268 | Ga0070659_1001002682 | 402 |
| 49 | 3300005614 | Ga0068856_100041904 | Ga0068856_1000419042 | 402 |
| 50 | 3300006852 | Ga0075433_10022821 | Ga0075433_100228212 | 402 |
| 51 | 3300025932 | Ga0207690_10033141 | Ga0207690_100331413 | 402 |
| 52 | 3300050515 | nmdc:mga0a205_7790_c1 | nmdc:mga0a205_7790_c1_5368_6705 | 402 |
| 53 | 3300006871 | Ga0075434_100027070 | Ga0075434_1000270701 | 403 |
| 54 | 3300013104 | Ga0157370_10051500 | Ga0157370_100515004 | 403 |
| 55 | 3300025901 | Ga0207688_10121980 | Ga0207688_101219801 | 403 |
| 56 | 3300026142 | Ga0207698_10226952 | Ga0207698_102269521 | 403 |
| 57 | 3300050512 | nmdc:mga0n895_11757_c1 | nmdc:mga0n895_11757_c1_6379_7704 | 403 |
| 58 | 3300005355 | Ga0070671_100221410 | Ga0070671_1002214101 | 404 |
| 59 | 3300005578 | Ga0068854_100140025 | Ga0068854_1001400252 | 404 |
| 60 | 3300005339 | Ga0070660_100056574 | Ga0070660_1000565742 | 405 |
| 61 | 3300005563 | Ga0068855_100060273 | Ga0068855_1000602732 | 405 |
| 62 | 3300005614 | Ga0068856_100109030 | Ga0068856_1001090302 | 405 |
| 63 | 3300007265 | Ga0099794_10003184 | Ga0099794_100031846 | 405 |
| 64 | 3300025919 | Ga0207657_10179881 | Ga0207657_101798812 | 405 |
| 65 | 3300026078 | Ga0207702_10058122 | Ga0207702_100581222 | 405 |
| 66 | 3300049591 | Ga0501075_0016115 | Ga0501075_0016115_453_1823 | 405 |
| 67 | 3300049743 | Ga0501081_0059640 | Ga0501081_0059640_232_1602 | 405 |
| 68 | 3300027907 | Ga0207428_10006382 | Ga0207428_100063823 | 406 |
| 69 | 3300005577 | Ga0068857_100005907 | Ga0068857_1000059072 | 407 |
| 70 | 3300005614 | Ga0068856_100015831 | Ga0068856_1000158315 | 407 |
| 71 | 3300009147 | Ga0114129_10319180 | Ga0114129_103191802 | 407 |
| 72 | 3300009174 | Ga0105241_10118178 | Ga0105241_101181782 | 407 |
| 73 | 3300010375 | Ga0105239_10004471 | Ga0105239_1000447121 | 407 |
| 74 | 3300013100 | Ga0157373_10180165 | Ga0157373_101801652 | 407 |
| 75 | 3300013296 | Ga0157374_10011135 | Ga0157374_100111352 | 407 |
| 76 | 3300014969 | Ga0157376_10023071 | Ga0157376_100230712 | 407 |
| 77 | 3300025914 | Ga0207671_10030165 | Ga0207671_100301653 | 407 |
| 78 | 3300025949 | Ga0207667_10283136 | Ga0207667_102831362 | 407 |
| 79 | 3300026078 | Ga0207702_10083166 | Ga0207702_100831662 | 407 |
| 80 | 3300026116 | Ga0207674_10018383 | Ga0207674_100183833 | 407 |
| 81 | 3300030878 | Ga0265770_1000931 | Ga0265770_10009312 | 407 |
| 82 | 3300031090 | Ga0265760_10010248 | Ga0265760_100102483 | 407 |
| 83 | 3300046460 | Ga0495638_0012569 | Ga0495638_0012569_1449_2852 | 407 |
| 84 | 3300048918 | Ga0496115_0015481 | Ga0496115_0015481_1798_3054 | 407 |
| 85 | 3300005439 | Ga0070711_100004181 | Ga0070711_1000041818 | 408 |
| 86 | 3300025928 | Ga0207700_10053104 | Ga0207700_100531042 | 408 |
| 87 | 3300028380 | Ga0268265_10061222 | Ga0268265_100612222 | 408 |
| 88 | 3300044842 | Ga0466957_0000211 | Ga0466957_0000211_8372_9829 | 408 |
| 89 | 3300005340 | Ga0070689_100131636 | Ga0070689_1001316362 | 409 |
| 90 | 3300006178 | Ga0075367_10023965 | Ga0075367_100239651 | 410 |
| 91 | 3300006195 | Ga0075366_10120583 | Ga0075366_101205831 | 410 |
| 92 | 3300013296 | Ga0157374_10020961 | Ga0157374_100209616 | 410 |
| 93 | 3300025944 | Ga0207661_10327251 | Ga0207661_103272511 | 410 |
| 94 | 3300049593 | Ga0501077_0006966 | Ga0501077_0006966_4796_6214 | 410 |
| 95 | 3300050493 | nmdc:mga0k408_7210_c1 | nmdc:mga0k408_7210_c1_2679_4064 | 410 |
| 96 | 3300050496 | nmdc:mga07m45_26394_c1 | nmdc:mga07m45_26394_c1_339_1724 | 410 |
| 97 | 3300005356 | Ga0070674_100077647 | Ga0070674_1000776471 | 411 |
| 98 | 3300005841 | Ga0068863_100013797 | Ga0068863_1000137976 | 411 |
| 99 | 3300009147 | Ga0114129_10049576 | Ga0114129_100495761 | 411 |
| 100 | 3300009553 | Ga0105249_10153129 | Ga0105249_101531292 | 411 |
| 101 | 3300031235 | Ga0265330_10040056 | Ga0265330_100400562 | 411 |
| 102 | 3300031238 | Ga0265332_10008447 | Ga0265332_100084473 | 411 |
| 103 | 3300031249 | Ga0265339_10001474 | Ga0265339_100014743 | 411 |
| 104 | 3300031711 | Ga0265314_10000265 | Ga0265314_1000026528 | 411 |
| 105 | 3300046684 | Ga0495669_0002195 | Ga0495669_0002195_6024_7397 | 411 |
| 106 | 3300054114 | Ga0501084_0291196 | Ga0501084_0291196_39_1328 | 411 |
| 107 | 3300005329 | Ga0070683_100000107 | Ga0070683_10000010724 | 412 |
| 108 | 3300005331 | Ga0070670_100004258 | Ga0070670_1000042582 | 412 |
| 109 | 3300005355 | Ga0070671_100236264 | Ga0070671_1002362641 | 412 |
| 110 | 3300005455 | Ga0070663_100031200 | Ga0070663_1000312002 | 412 |
| 111 | 3300005535 | Ga0070684_100000837 | Ga0070684_1000008373 | 412 |
| 112 | 3300005564 | Ga0070664_100000303 | Ga0070664_1000003033 | 412 |
| 113 | 3300006880 | Ga0075429_100104424 | Ga0075429_1001044242 | 412 |
| 114 | 3300009177 | Ga0105248_10162913 | Ga0105248_101629133 | 412 |
| 115 | 3300025925 | Ga0207650_10146621 | Ga0207650_101466212 | 412 |
| 116 | 3300025941 | Ga0207711_10089500 | Ga0207711_100895003 | 412 |
| 117 | 3300025945 | Ga0207679_10077234 | Ga0207679_100772343 | 412 |
| 118 | 3300031240 | Ga0265320_10048767 | Ga0265320_100487672 | 412 |
| 119 | 3300031712 | Ga0265342_10020643 | Ga0265342_100206432 | 412 |
| 120 | 3300046472 | Ga0495580_0004381 | Ga0495580_0004381_2678_4015 | 412 |
| 121 | 3300046477 | Ga0495664_0040101 | Ga0495664_0040101_98_1396 | 412 |
| 122 | 3300046529 | Ga0495652_0199931 | Ga0495652_0199931_34_1365 | 412 |
| 123 | 3300046531 | Ga0495665_0017121 | Ga0495665_0017121_276_1613 | 412 |
| 124 | 3300046533 | Ga0495640_0045916 | Ga0495640_0045916_599_1897 | 412 |
| 125 | 3300046678 | Ga0495599_0061093 | Ga0495599_0061093_838_2169 | 412 |
| 126 | 3300047319 | Ga0495674_0011676 | Ga0495674_0011676_1681_2979 | 412 |
| 127 | 3300047322 | Ga0495680_0176547 | Ga0495680_0176547_65_1396 | 412 |
| 128 | 3300047444 | Ga0495675_0004864 | Ga0495675_0004864_2482_3813 | 412 |
| 129 | 3300047471 | Ga0495684_0000834 | Ga0495684_0000834_9165_10496 | 412 |
| 130 | 3300048088 | Ga0495602_0025838 | Ga0495602_0025838_3225_4556 | 412 |
| 131 | 3300048907 | Ga0496104_0001482 | Ga0496104_0001482_15612_16991 | 412 |
| 132 | 3300048908 | Ga0496105_0014831 | Ga0496105_0014831_148_1530 | 412 |
| 133 | 3300048911 | Ga0496108_0000282 | Ga0496108_0000282_24952_26403 | 412 |
| 134 | 3300048913 | Ga0496110_0011781 | Ga0496110_0011781_3272_4723 | 412 |
| 135 | 3300048914 | Ga0496111_0000460 | Ga0496111_0000460_14961_16343 | 412 |
| 136 | 3300048915 | Ga0496112_0001067 | Ga0496112_0001067_14615_16066 | 412 |
| 137 | 3300050507 | nmdc:mga05p37_7289_c1 | nmdc:mga05p37_7289_c1_274_1599 | 412 |
| 138 | 3300050510 | nmdc:mga06r32_122420_c1 | nmdc:mga06r32_122420_c1_670_1995 | 412 |
| 139 | 3300006844 | Ga0075428_100064338 | Ga0075428_1000643381 | 413 |
| 140 | 3300013307 | Ga0157372_10068546 | Ga0157372_100685462 | 413 |
| 141 | 3300037068 | Ga0373925_0056398 | Ga0373925_0056398_1199_2527 | 413 |
| 142 | 3300046472 | Ga0495580_0001952 | Ga0495580_0001952_5246_6574 | 413 |
| 143 | 3300050509 | nmdc:mga0qj67_81065_c1 | nmdc:mga0qj67_81065_c1_491_1858 | 413 |
| 144 | 3300025926 | Ga0207659_10131124 | Ga0207659_101311241 | 414 |
| 145 | 3300027907 | Ga0207428_10026033 | Ga0207428_100260332 | 414 |
| 146 | 3300044694 | Ga0466963_0102205 | Ga0466963_0102205_620_1888 | 414 |
| 147 | 3300050511 | nmdc:mga08y16_7848_c1 | nmdc:mga08y16_7848_c1_9232_10527 | 414 |
| 148 | 3300005328 | Ga0070676_10001662 | Ga0070676_100016628 | 415 |
| 149 | 3300005329 | Ga0070683_100034706 | Ga0070683_1000347062 | 415 |
| 150 | 3300005334 | Ga0068869_100005430 | Ga0068869_1000054307 | 415 |
| 151 | 3300005336 | Ga0070680_100029999 | Ga0070680_1000299994 | 415 |
| 152 | 3300005337 | Ga0070682_100067618 | Ga0070682_1000676182 | 415 |
| 153 | 3300005338 | Ga0068868_100017093 | Ga0068868_1000170932 | 415 |
| 154 | 3300005339 | Ga0070660_100020559 | Ga0070660_1000205593 | 415 |
| 155 | 3300005344 | Ga0070661_100002247 | Ga0070661_10000224710 | 415 |
| 156 | 3300005345 | Ga0070692_10022267 | Ga0070692_100222671 | 415 |
| 157 | 3300005347 | Ga0070668_100000787 | Ga0070668_10000078715 | 415 |
| 158 | 3300005347 | Ga0070668_100189031 | Ga0070668_1001890311 | 415 |
| 159 | 3300005353 | Ga0070669_100070631 | Ga0070669_1000706311 | 415 |
| 160 | 3300005354 | Ga0070675_100010538 | Ga0070675_1000105385 | 415 |
| 161 | 3300005366 | Ga0070659_100029355 | Ga0070659_1000293553 | 415 |
| 162 | 3300005367 | Ga0070667_100012957 | Ga0070667_1000129572 | 415 |
| 163 | 3300005441 | Ga0070700_100027192 | Ga0070700_1000271922 | 415 |
| 164 | 3300005441 | Ga0070700_100046918 | Ga0070700_1000469182 | 415 |
| 165 | 3300005444 | Ga0070694_100014822 | Ga0070694_1000148222 | 415 |
| 166 | 3300005444 | Ga0070694_100112206 | Ga0070694_1001122061 | 415 |
| 167 | 3300005458 | Ga0070681_10002927 | Ga0070681_100029279 | 415 |
| 168 | 3300005458 | Ga0070681_10293983 | Ga0070681_102939831 | 415 |
| 169 | 3300005466 | Ga0070685_10029149 | Ga0070685_100291491 | 415 |
| 170 | 3300005530 | Ga0070679_100002414 | Ga0070679_1000024149 | 415 |
| 171 | 3300005535 | Ga0070684_100039674 | Ga0070684_1000396742 | 415 |
| 172 | 3300005535 | Ga0070684_100043761 | Ga0070684_1000437612 | 415 |
| 173 | 3300005543 | Ga0070672_100008057 | Ga0070672_1000080572 | 415 |
| 174 | 3300005563 | Ga0068855_100033716 | Ga0068855_1000337165 | 415 |
| 175 | 3300005563 | Ga0068855_100066136 | Ga0068855_1000661364 | 415 |
| 176 | 3300005564 | Ga0070664_100002537 | Ga0070664_1000025376 | 415 |
| 177 | 3300005577 | Ga0068857_100002675 | Ga0068857_1000026755 | 415 |
| 178 | 3300005577 | Ga0068857_100002944 | Ga0068857_1000029445 | 415 |
| 179 | 3300005616 | Ga0068852_100014322 | Ga0068852_1000143222 | 415 |
| 180 | 3300005719 | Ga0068861_100000535 | Ga0068861_10000053510 | 415 |
| 181 | 3300005719 | Ga0068861_100001808 | Ga0068861_10000180812 | 415 |
| 182 | 3300005840 | Ga0068870_10001490 | Ga0068870_100014903 | 415 |
| 183 | 3300005841 | Ga0068863_100058121 | Ga0068863_1000581213 | 415 |
| 184 | 3300005843 | Ga0068860_100002295 | Ga0068860_1000022957 | 415 |
| 185 | 3300005844 | Ga0068862_100000532 | Ga0068862_10000053219 | 415 |
| 186 | 3300005844 | Ga0068862_100054971 | Ga0068862_1000549712 | 415 |
| 187 | 3300006844 | Ga0075428_100179758 | Ga0075428_1001797583 | 415 |
| 188 | 3300006852 | Ga0075433_10141301 | Ga0075433_101413012 | 415 |
| 189 | 3300006871 | Ga0075434_100069545 | Ga0075434_1000695452 | 415 |
| 190 | 3300006871 | Ga0075434_100121121 | Ga0075434_1001211212 | 415 |
| 191 | 3300007076 | Ga0075435_100108856 | Ga0075435_1001088562 | 415 |
| 192 | 3300009094 | Ga0111539_10013257 | Ga0111539_100132572 | 415 |
| 193 | 3300009094 | Ga0111539_10191232 | Ga0111539_101912321 | 415 |
| 194 | 3300009098 | Ga0105245_10092678 | Ga0105245_100926782 | 415 |
| 195 | 3300009147 | Ga0114129_10031623 | Ga0114129_100316232 | 415 |
| 196 | 3300009176 | Ga0105242_10235104 | Ga0105242_102351042 | 415 |
| 197 | 3300009177 | Ga0105248_10041438 | Ga0105248_100414382 | 415 |
| 198 | 3300009545 | Ga0105237_10058503 | Ga0105237_100585033 | 415 |
| 199 | 3300009553 | Ga0105249_10000075 | Ga0105249_1000007523 | 415 |
| 200 | 3300009553 | Ga0105249_10003487 | Ga0105249_1000348711 | 415 |
| 201 | 3300013104 | Ga0157370_10002893 | Ga0157370_100028934 | 415 |
| 202 | 3300013105 | Ga0157369_10008063 | Ga0157369_100080632 | 415 |
| 203 | 3300013296 | Ga0157374_10013301 | Ga0157374_100133012 | 415 |
| 204 | 3300013306 | Ga0163162_10005049 | Ga0163162_100050498 | 415 |
| 205 | 3300014326 | Ga0157380_10031126 | Ga0157380_100311261 | 415 |
| 206 | 3300014968 | Ga0157379_10004256 | Ga0157379_100042569 | 415 |
| 207 | 3300025315 | Ga0207697_10031479 | Ga0207697_100314792 | 415 |
| 208 | 3300025893 | Ga0207682_10036932 | Ga0207682_100369322 | 415 |
| 209 | 3300025907 | Ga0207645_10000294 | Ga0207645_1000029419 | 415 |
| 210 | 3300025908 | Ga0207643_10001203 | Ga0207643_100012038 | 415 |
| 211 | 3300025912 | Ga0207707_10002005 | Ga0207707_1000200512 | 415 |
| 212 | 3300025917 | Ga0207660_10010784 | Ga0207660_100107842 | 415 |
| 213 | 3300025918 | Ga0207662_10001571 | Ga0207662_100015714 | 415 |
| 214 | 3300025919 | Ga0207657_10086093 | Ga0207657_100860932 | 415 |
| 215 | 3300025920 | Ga0207649_10006940 | Ga0207649_100069403 | 415 |
| 216 | 3300025920 | Ga0207649_10016840 | Ga0207649_100168402 | 415 |
| 217 | 3300025921 | Ga0207652_10025118 | Ga0207652_100251182 | 415 |
| 218 | 3300025923 | Ga0207681_10003187 | Ga0207681_100031875 | 415 |
| 219 | 3300025923 | Ga0207681_10009430 | Ga0207681_100094303 | 415 |
| 220 | 3300025925 | Ga0207650_10211553 | Ga0207650_102115531 | 415 |
| 221 | 3300025926 | Ga0207659_10097554 | Ga0207659_100975542 | 415 |
| 222 | 3300025932 | Ga0207690_10027692 | Ga0207690_100276922 | 415 |
| 223 | 3300025933 | Ga0207706_10000472 | Ga0207706_1000047217 | 415 |
| 224 | 3300025940 | Ga0207691_10000248 | Ga0207691_1000024832 | 415 |
| 225 | 3300025942 | Ga0207689_10000810 | Ga0207689_1000081016 | 415 |
| 226 | 3300025945 | Ga0207679_10002710 | Ga0207679_100027108 | 415 |
| 227 | 3300025945 | Ga0207679_10015334 | Ga0207679_100153341 | 415 |
| 228 | 3300025961 | Ga0207712_10001640 | Ga0207712_100016403 | 415 |
| 229 | 3300025961 | Ga0207712_10001936 | Ga0207712_1000193612 | 415 |
| 230 | 3300025972 | Ga0207668_10027203 | Ga0207668_100272031 | 415 |
| 231 | 3300025972 | Ga0207668_10163687 | Ga0207668_101636871 | 415 |
| 232 | 3300026089 | Ga0207648_10016684 | Ga0207648_100166842 | 415 |
| 233 | 3300026116 | Ga0207674_10001081 | Ga0207674_1000108111 | 415 |
| 234 | 3300026116 | Ga0207674_10010697 | Ga0207674_100106975 | 415 |
| 235 | 3300026118 | Ga0207675_100000373 | Ga0207675_10000037319 | 415 |
| 236 | 3300026118 | Ga0207675_100068305 | Ga0207675_1000683051 | 415 |
| 237 | 3300026142 | Ga0207698_10012808 | Ga0207698_100128085 | 415 |
| 238 | 3300026142 | Ga0207698_10019143 | Ga0207698_100191434 | 415 |
| 239 | 3300028380 | Ga0268265_10002731 | Ga0268265_100027312 | 415 |
| 240 | 3300028380 | Ga0268265_10007702 | Ga0268265_100077026 | 415 |
| 241 | 3300028381 | Ga0268264_10043664 | Ga0268264_100436641 | 415 |
| 242 | 3300031548 | Ga0307408_100002025 | Ga0307408_10000202510 | 415 |
| 243 | 3300031852 | Ga0307410_10014301 | Ga0307410_100143012 | 415 |
| 244 | 3300031901 | Ga0307406_10008031 | Ga0307406_100080312 | 415 |
| 245 | 3300031995 | Ga0307409_100053360 | Ga0307409_1000533603 | 415 |
| 246 | 3300037466 | Ga0395898_0089512 | Ga0395898_0089512_994_2304 | 415 |
| 247 | 3300046472 | Ga0495580_0040622 | Ga0495580_0040622_1670_2938 | 415 |
| 248 | 3300046683 | Ga0495658_0021335 | Ga0495658_0021335_150_1508 | 415 |
| 249 | 3300050507 | nmdc:mga05p37_128956_c1 | nmdc:mga05p37_128956_c1_1019_2353 | 415 |
| 250 | 3300050511 | nmdc:mga08y16_48370_c1 | nmdc:mga08y16_48370_c1_1344_2669 | 415 |
| 251 | 3300050512 | nmdc:mga0n895_124571_c1 | nmdc:mga0n895_124571_c1_275_1600 | 415 |
| 252 | 3300050512 | nmdc:mga0n895_131547_c1 | nmdc:mga0n895_131547_c1_615_1949 | 415 |
| 253 | 3300050515 | nmdc:mga0a205_146529_c1 | nmdc:mga0a205_146529_c1_721_2046 | 415 |
| 254 | 3300005937 | Ga0081455_10154373 | Ga0081455_101543732 | 416 |
| 255 | 3300025315 | Ga0207697_10001044 | Ga0207697_1000104410 | 416 |
| 256 | 3300048913 | Ga0496110_0118054 | Ga0496110_0118054_144_1685 | 416 |
| 257 | 3300005340 | Ga0070689_100040610 | Ga0070689_1000406102 | 417 |
| 258 | 3300005365 | Ga0070688_100012517 | Ga0070688_1000125172 | 417 |
| 259 | 3300006881 | Ga0068865_100179176 | Ga0068865_1001791761 | 417 |
| 260 | 3300013102 | Ga0157371_10158047 | Ga0157371_101580471 | 417 |
| 261 | 3300014326 | Ga0157380_10053361 | Ga0157380_100533612 | 417 |
| 262 | 3300031903 | Ga0307407_10098157 | Ga0307407_100981571 | 417 |
| 263 | 3300049571 | Ga0501034_0188202 | Ga0501034_0188202_19_1302 | 417 |
| 264 | 3300060353 | Ga0501082_0000586 | Ga0501082_0000586_2531_3874 | 417 |
| 265 | 3300028653 | Ga0265323_10000578 | Ga0265323_1000057814 | 418 |
| 266 | 3300031731 | Ga0307405_10060463 | Ga0307405_100604632 | 418 |
| 267 | 3300031852 | Ga0307410_10069903 | Ga0307410_100699033 | 418 |
| 268 | 3300031903 | Ga0307407_10110674 | Ga0307407_101106742 | 418 |
| 269 | 3300032004 | Ga0307414_10026853 | Ga0307414_100268532 | 418 |
| 270 | 3300032126 | Ga0307415_100092788 | Ga0307415_1000927883 | 418 |
| 271 | 3300037418 | Ga0395900_0179252 | Ga0395900_0179252_199_1500 | 418 |
| 272 | 3300046543 | Ga0495645_0002242 | Ga0495645_0002242_3630_4967 | 418 |
| 273 | 3300005530 | Ga0070679_100056537 | Ga0070679_1000565373 | 419 |
| 274 | 3300005563 | Ga0068855_100007977 | Ga0068855_1000079771 | 419 |
| 275 | 3300005616 | Ga0068852_100183373 | Ga0068852_1001833732 | 419 |
| 276 | 3300009093 | Ga0105240_10024079 | Ga0105240_100240797 | 419 |
| 277 | 3300013104 | Ga0157370_10256605 | Ga0157370_102566052 | 419 |
| 278 | 3300025906 | Ga0207699_10112903 | Ga0207699_101129031 | 419 |
| 279 | 3300025932 | Ga0207690_10028889 | Ga0207690_100288892 | 419 |
| 280 | 3300025949 | Ga0207667_10033625 | Ga0207667_100336252 | 419 |
| 281 | 3300026142 | Ga0207698_10150211 | Ga0207698_101502112 | 419 |
| 282 | 3300032002 | Ga0307416_100191291 | Ga0307416_1001912911 | 419 |
| 283 | 3300032126 | Ga0307415_100192150 | Ga0307415_1001921501 | 419 |
| 284 | 3300035116 | Ga0373945_0044208 | Ga0373945_0044208_21_1349 | 419 |
| 285 | 3300035725 | Ga0373947_0007766 | Ga0373947_0007766_3000_4340 | 419 |
| 286 | 3300037068 | Ga0373925_0005848 | Ga0373925_0005848_5999_7327 | 419 |
| 287 | 3300037068 | Ga0373925_0053576 | Ga0373925_0053576_153_1493 | 419 |
| 288 | 3300046461 | Ga0495641_0046971 | Ga0495641_0046971_475_1815 | 419 |
| 289 | 3300046472 | Ga0495580_0048686 | Ga0495580_0048686_1528_2868 | 419 |
| 290 | 3300046473 | Ga0495582_0018018 | Ga0495582_0018018_30_1370 | 419 |
| 291 | 3300046537 | Ga0495598_0004375 | Ga0495598_0004375_420_1760 | 419 |
| 292 | 3300046674 | Ga0495588_0013246 | Ga0495588_0013246_776_2116 | 419 |
| 293 | 3300046690 | Ga0495624_0019818 | Ga0495624_0019818_39_1379 | 419 |
| 294 | 3300047321 | Ga0495676_0019273 | Ga0495676_0019273_2665_4005 | 419 |
| 295 | 3300053078 | Ga0495612_0009486 | Ga0495612_0009486_1665_2993 | 419 |
| 296 | 3300053085 | Ga0495619_0101806 | Ga0495619_0101806_39_1367 | 419 |
| 297 | 3300005356 | Ga0070674_100035964 | Ga0070674_1000359643 | 420 |
| 298 | 3300005366 | Ga0070659_100219970 | Ga0070659_1002199702 | 420 |
| 299 | 3300005456 | Ga0070678_100050568 | Ga0070678_1000505682 | 420 |
| 300 | 3300005548 | Ga0070665_100030763 | Ga0070665_1000307635 | 420 |
| 301 | 3300005718 | Ga0068866_10032363 | Ga0068866_100323632 | 420 |
| 302 | 3300005841 | Ga0068863_100211332 | Ga0068863_1002113322 | 420 |
| 303 | 3300005937 | Ga0081455_10025848 | Ga0081455_100258486 | 420 |
| 304 | 3300005937 | Ga0081455_10030549 | Ga0081455_100305492 | 420 |
| 305 | 3300005983 | Ga0081540_1007681 | Ga0081540_10076812 | 420 |
| 306 | 3300005983 | Ga0081540_1044275 | Ga0081540_10442752 | 420 |
| 307 | 3300006844 | Ga0075428_100009967 | Ga0075428_1000099679 | 420 |
| 308 | 3300006844 | Ga0075428_100119558 | Ga0075428_1001195582 | 420 |
| 309 | 3300006847 | Ga0075431_100028185 | Ga0075431_1000281854 | 420 |
| 310 | 3300006871 | Ga0075434_100075943 | Ga0075434_1000759432 | 420 |
| 311 | 3300006871 | Ga0075434_100105404 | Ga0075434_1001054042 | 420 |
| 312 | 3300006880 | Ga0075429_100044536 | Ga0075429_1000445362 | 420 |
| 313 | 3300009093 | Ga0105240_10044941 | Ga0105240_100449413 | 420 |
| 314 | 3300009094 | Ga0111539_10137530 | Ga0111539_101375302 | 420 |
| 315 | 3300009094 | Ga0111539_10252315 | Ga0111539_102523151 | 420 |
| 316 | 3300009098 | Ga0105245_10011422 | Ga0105245_100114228 | 420 |
| 317 | 3300009147 | Ga0114129_10017690 | Ga0114129_100176904 | 420 |
| 318 | 3300009545 | Ga0105237_10148042 | Ga0105237_101480422 | 420 |
| 319 | 3300010375 | Ga0105239_10003833 | Ga0105239_100038339 | 420 |
| 320 | 3300014325 | Ga0163163_10283404 | Ga0163163_102834042 | 420 |
| 321 | 3300014969 | Ga0157376_10070801 | Ga0157376_100708013 | 420 |
| 322 | 3300025914 | Ga0207671_10078083 | Ga0207671_100780832 | 420 |
| 323 | 3300025937 | Ga0207669_10006981 | Ga0207669_100069815 | 420 |
| 324 | 3300026089 | Ga0207648_10015089 | Ga0207648_100150893 | 420 |
| 325 | 3300037471 | Ga0395905_0001469 | Ga0395905_0001469_16448_17755 | 420 |
| 326 | 3300037471 | Ga0395905_0291737 | Ga0395905_0291737_181_1488 | 420 |
| 327 | 3300042125 | Ga0450923_003199 | Ga0450923_003199_557_1942 | 420 |
| 328 | 3300042876 | Ga0451577_0012747 | Ga0451577_0012747_1116_2480 | 420 |
| 329 | 3300045051 | Ga0451576_0051303 | Ga0451576_0051303_2559_3926 | 420 |
| 330 | 3300046499 | Ga0495594_0051796 | Ga0495594_0051796_551_1954 | 420 |
| 331 | 3300048907 | Ga0496104_0246631 | Ga0496104_0246631_176_1579 | 420 |
| 332 | 3300049574 | Ga0501038_0140629 | Ga0501038_0140629_457_1899 | 420 |
| 333 | 3300049588 | Ga0501072_0130510 | Ga0501072_0130510_158_1573 | 420 |
| 334 | 3300049592 | Ga0501076_0027275 | Ga0501076_0027275_1153_2568 | 420 |
| 335 | 3300049593 | Ga0501077_0065403 | Ga0501077_0065403_522_1937 | 420 |
| 336 | 3300049822 | Ga0501035_0153904 | Ga0501035_0153904_610_1965 | 420 |
| 337 | 3300050507 | nmdc:mga05p37_87053_c1 | nmdc:mga05p37_87053_c1_1223_2635 | 420 |
| 338 | 3300050510 | nmdc:mga06r32_59853_c1 | nmdc:mga06r32_59853_c1_53_1468 | 420 |
| 339 | 3300050511 | nmdc:mga08y16_137997_c1 | nmdc:mga08y16_137997_c1_363_1697 | 420 |
| 340 | 3300050512 | nmdc:mga0n895_122336_c1 | nmdc:mga0n895_122336_c1_813_2216 | 420 |
| 341 | 3300050512 | nmdc:mga0n895_67720_c1 | nmdc:mga0n895_67720_c1_225_1559 | 420 |
| 342 | iso_pu_bacteria | 2643221547 | 2643757186 | 420 |
| 343 | 3300005458 | Ga0070681_10123975 | Ga0070681_101239752 | 421 |
| 344 | 3300005530 | Ga0070679_100068183 | Ga0070679_1000681833 | 421 |
| 345 | 3300005563 | Ga0068855_100207310 | Ga0068855_1002073101 | 421 |
| 346 | 3300005842 | Ga0068858_100302201 | Ga0068858_1003022012 | 421 |
| 347 | 3300006852 | Ga0075433_10164104 | Ga0075433_101641041 | 421 |
| 348 | 3300006852 | Ga0075433_10257571 | Ga0075433_102575712 | 421 |
| 349 | 3300006880 | Ga0075429_100085567 | Ga0075429_1000855672 | 421 |
| 350 | 3300009093 | Ga0105240_10004254 | Ga0105240_100042546 | 421 |
| 351 | 3300009174 | Ga0105241_10141160 | Ga0105241_101411602 | 421 |
| 352 | 3300010375 | Ga0105239_10064265 | Ga0105239_100642655 | 421 |
| 353 | 3300013105 | Ga0157369_10222162 | Ga0157369_102221622 | 421 |
| 354 | 3300013307 | Ga0157372_10132573 | Ga0157372_101325732 | 421 |
| 355 | 3300025912 | Ga0207707_10045503 | Ga0207707_100455032 | 421 |
| 356 | 3300025917 | Ga0207660_10174626 | Ga0207660_101746261 | 421 |
| 357 | 3300026075 | Ga0207708_10062825 | Ga0207708_100628251 | 421 |
| 358 | 3300026118 | Ga0207675_100008014 | Ga0207675_1000080145 | 421 |
| 359 | 3300031852 | Ga0307410_10030587 | Ga0307410_100305872 | 421 |
| 360 | 3300032005 | Ga0307411_10025449 | Ga0307411_100254493 | 421 |
| 361 | 3300037471 | Ga0395905_0002922 | Ga0395905_0002922_14058_15368 | 421 |
| 362 | 3300037471 | Ga0395905_0026517 | Ga0395905_0026517_3337_4737 | 421 |
| 363 | 3300037471 | Ga0395905_0029454 | Ga0395905_0029454_3538_4938 | 421 |
| 364 | 3300045976 | Ga0466967_0270362 | Ga0466967_0270362_74_1390 | 421 |
| 365 | 3300046477 | Ga0495664_0027369 | Ga0495664_0027369_105_1448 | 421 |
| 366 | 3300049587 | Ga0501071_0014003 | Ga0501071_0014003_3785_5086 | 421 |
| 367 | 3300049588 | Ga0501072_0013363 | Ga0501072_0013363_4561_5862 | 421 |
| 368 | 3300049592 | Ga0501076_0078159 | Ga0501076_0078159_1316_2617 | 421 |
| 369 | 3300049592 | Ga0501076_0085279 | Ga0501076_0085279_110_1453 | 421 |
| 370 | 3300049743 | Ga0501081_0071743 | Ga0501081_0071743_144_1445 | 421 |
| 371 | 3300049824 | Ga0501045_0004716 | Ga0501045_0004716_5551_6852 | 421 |
| 372 | 3300050515 | nmdc:mga0a205_35212_c2 | nmdc:mga0a205_35212_c2_628_1932 | 421 |
| 373 | 3300050515 | nmdc:mga0a205_73367_c2 | nmdc:mga0a205_73367_c2_31_1371 | 421 |
| 374 | 3300054114 | Ga0501084_0019109 | Ga0501084_0019109_371_1672 | 421 |
| 375 | 3300005338 | Ga0068868_100131240 | Ga0068868_1001312401 | 422 |
| 376 | 3300005367 | Ga0070667_100032041 | Ga0070667_1000320414 | 422 |
| 377 | 3300005546 | Ga0070696_100000158 | Ga0070696_1000001583 | 422 |
| 378 | 3300005617 | Ga0068859_100115181 | Ga0068859_1001151812 | 422 |
| 379 | 3300005841 | Ga0068863_100077745 | Ga0068863_1000777451 | 422 |
| 380 | 3300005843 | Ga0068860_100007566 | Ga0068860_10000756611 | 422 |
| 381 | 3300006931 | Ga0097620_100115180 | Ga0097620_1001151801 | 422 |
| 382 | 3300009098 | Ga0105245_10047675 | Ga0105245_100476754 | 422 |
| 383 | 3300009177 | Ga0105248_10021187 | Ga0105248_100211873 | 422 |
| 384 | 3300014968 | Ga0157379_10035045 | Ga0157379_100350452 | 422 |
| 385 | 3300025913 | Ga0207695_10019230 | Ga0207695_100192305 | 422 |
| 386 | 3300025927 | Ga0207687_10056683 | Ga0207687_100566832 | 422 |
| 387 | 3300026088 | Ga0207641_10131123 | Ga0207641_101311232 | 422 |
| 388 | 3300028381 | Ga0268264_10008130 | Ga0268264_100081302 | 422 |
| 389 | 3300031711 | Ga0265314_10003899 | Ga0265314_100038996 | 422 |
| 390 | 3300044842 | Ga0466957_0047820 | Ga0466957_0047820_17_1381 | 422 |
| 391 | 3300059423 | Ga0590074_000647 | Ga0590074_000647_1651_3078 | 422 |
| 392 | 3300059426 | Ga0590077_000251 | Ga0590077_000251_1874_3301 | 422 |
| 393 | 3300005334 | Ga0068869_100073784 | Ga0068869_1000737843 | 423 |
| 394 | 3300005436 | Ga0070713_100066366 | Ga0070713_1000663662 | 423 |
| 395 | 3300005445 | Ga0070708_100002984 | Ga0070708_10000298412 | 423 |
| 396 | 3300005467 | Ga0070706_100000188 | Ga0070706_10000018863 | 423 |
| 397 | 3300005518 | Ga0070699_100034241 | Ga0070699_1000342413 | 423 |
| 398 | 3300005536 | Ga0070697_100000146 | Ga0070697_10000014638 | 423 |
| 399 | 3300005549 | Ga0070704_100017967 | Ga0070704_1000179672 | 423 |
| 400 | 3300005719 | Ga0068861_100113590 | Ga0068861_1001135902 | 423 |
| 401 | 3300006175 | Ga0070712_100000450 | Ga0070712_10000045013 | 423 |
| 402 | 3300006178 | Ga0075367_10109536 | Ga0075367_101095361 | 423 |
| 403 | 3300006195 | Ga0075366_10007763 | Ga0075366_100077634 | 423 |
| 404 | 3300006353 | Ga0075370_10025508 | Ga0075370_100255082 | 423 |
| 405 | 3300006852 | Ga0075433_10011530 | Ga0075433_100115304 | 423 |
| 406 | 3300025910 | Ga0207684_10001145 | Ga0207684_100011454 | 423 |
| 407 | 3300025915 | Ga0207693_10000740 | Ga0207693_1000074019 | 423 |
| 408 | 3300025916 | Ga0207663_10001920 | Ga0207663_100019202 | 423 |
| 409 | 3300026118 | Ga0207675_100036082 | Ga0207675_1000360824 | 423 |
| 410 | 3300031344 | Ga0265316_10093482 | Ga0265316_100934822 | 423 |
| 411 | 3300031711 | Ga0265314_10037637 | Ga0265314_100376374 | 423 |
| 412 | 3300038443 | Ga0395901_0099465 | Ga0395901_0099465_746_2224 | 423 |
| 413 | 3300044712 | Ga0453684_0139684 | Ga0453684_0139684_715_2091 | 423 |
| 414 | 3300046472 | Ga0495580_0046872 | Ga0495580_0046872_667_2034 | 423 |
| 415 | 3300049570 | Ga0501033_0066662 | Ga0501033_0066662_206_1582 | 423 |
| 416 | 3300049574 | Ga0501038_0194572 | Ga0501038_0194572_240_1616 | 423 |
| 417 | 3300049579 | Ga0501043_0113724 | Ga0501043_0113724_459_1835 | 423 |
| 418 | 3300049581 | Ga0501047_0012968 | Ga0501047_0012968_904_2280 | 423 |
| 419 | 3300049589 | Ga0501073_0011518 | Ga0501073_0011518_177_1553 | 423 |
| 420 | 3300049822 | Ga0501035_0005699 | Ga0501035_0005699_9694_11070 | 423 |
| 421 | 3300049823 | Ga0501044_0005369 | Ga0501044_0005369_10674_12050 | 423 |
| 422 | 3300050491 | nmdc:mga00v17_59311_c1 | nmdc:mga00v17_59311_c1_364_1740 | 423 |
| 423 | 3300050495 | nmdc:mga04h51_34753_c1 | nmdc:mga04h51_34753_c1_214_1590 | 423 |
| 424 | 3300050515 | nmdc:mga0a205_14407_c1 | nmdc:mga0a205_14407_c1_549_1868 | 423 |
| 425 | 3300005548 | Ga0070665_100218372 | Ga0070665_1002183723 | 424 |
| 426 | 3300005842 | Ga0068858_100080193 | Ga0068858_1000801932 | 424 |
| 427 | 3300006844 | Ga0075428_100153638 | Ga0075428_1001536381 | 424 |
| 428 | 3300026035 | Ga0207703_10029945 | Ga0207703_100299454 | 424 |
| 429 | 3300005336 | Ga0070680_100008929 | Ga0070680_1000089292 | 425 |
| 430 | 3300005367 | Ga0070667_100179386 | Ga0070667_1001793862 | 425 |
| 431 | 3300005439 | Ga0070711_100212013 | Ga0070711_1002120131 | 425 |
| 432 | 3300005536 | Ga0070697_100009629 | Ga0070697_1000096292 | 425 |
| 433 | 3300005539 | Ga0068853_100098757 | Ga0068853_1000987571 | 425 |
| 434 | 3300005548 | Ga0070665_100034346 | Ga0070665_1000343464 | 425 |
| 435 | 3300005614 | Ga0068856_100085184 | Ga0068856_1000851843 | 425 |
| 436 | 3300005616 | Ga0068852_100004445 | Ga0068852_1000044458 | 425 |
| 437 | 3300005618 | Ga0068864_100124152 | Ga0068864_1001241522 | 425 |
| 438 | 3300005841 | Ga0068863_100050770 | Ga0068863_1000507702 | 425 |
| 439 | 3300005842 | Ga0068858_100002229 | Ga0068858_10000222916 | 425 |
| 440 | 3300006358 | Ga0068871_100099564 | Ga0068871_1000995641 | 425 |
| 441 | 3300006358 | Ga0068871_100228512 | Ga0068871_1002285121 | 425 |
| 442 | 3300009098 | Ga0105245_10081326 | Ga0105245_100813263 | 425 |
| 443 | 3300009098 | Ga0105245_10141748 | Ga0105245_101417482 | 425 |
| 444 | 3300009174 | Ga0105241_10039492 | Ga0105241_100394923 | 425 |
| 445 | 3300009177 | Ga0105248_10015951 | Ga0105248_100159511 | 425 |
| 446 | 3300009551 | Ga0105238_10042838 | Ga0105238_100428384 | 425 |
| 447 | 3300013104 | Ga0157370_10001248 | Ga0157370_100012483 | 425 |
| 448 | 3300013297 | Ga0157378_10033360 | Ga0157378_100333601 | 425 |
| 449 | 3300013306 | Ga0163162_10016179 | Ga0163162_100161799 | 425 |
| 450 | 3300013308 | Ga0157375_10001896 | Ga0157375_100018967 | 425 |
| 451 | 3300014325 | Ga0163163_10054577 | Ga0163163_100545772 | 425 |
| 452 | 3300025903 | Ga0207680_10047111 | Ga0207680_100471112 | 425 |
| 453 | 3300025911 | Ga0207654_10018384 | Ga0207654_100183842 | 425 |
| 454 | 3300025913 | Ga0207695_10011850 | Ga0207695_100118503 | 425 |
| 455 | 3300025919 | Ga0207657_10007399 | Ga0207657_100073993 | 425 |
| 456 | 3300025921 | Ga0207652_10016114 | Ga0207652_100161145 | 425 |
| 457 | 3300025924 | Ga0207694_10045311 | Ga0207694_100453112 | 425 |
| 458 | 3300025924 | Ga0207694_10096491 | Ga0207694_100964912 | 425 |
| 459 | 3300025927 | Ga0207687_10176455 | Ga0207687_101764552 | 425 |
| 460 | 3300025931 | Ga0207644_10026555 | Ga0207644_100265553 | 425 |
| 461 | 3300025934 | Ga0207686_10029822 | Ga0207686_100298222 | 425 |
| 462 | 3300025949 | Ga0207667_10000814 | Ga0207667_1000081412 | 425 |
| 463 | 3300025986 | Ga0207658_10238448 | Ga0207658_102384482 | 425 |
| 464 | 3300026023 | Ga0207677_10052830 | Ga0207677_100528302 | 425 |
| 465 | 3300026078 | Ga0207702_10047500 | Ga0207702_100475003 | 425 |
| 466 | 3300026088 | Ga0207641_10042241 | Ga0207641_100422414 | 425 |
| 467 | 3300026142 | Ga0207698_10008821 | Ga0207698_100088216 | 425 |
| 468 | 3300028379 | Ga0268266_10019916 | Ga0268266_100199164 | 425 |
| 469 | 3300031548 | Ga0307408_100032799 | Ga0307408_1000327993 | 425 |
| 470 | 3300031731 | Ga0307405_10024888 | Ga0307405_100248884 | 425 |
| 471 | 3300031852 | Ga0307410_10036042 | Ga0307410_100360422 | 425 |
| 472 | 3300031995 | Ga0307409_100098095 | Ga0307409_1000980952 | 425 |
| 473 | 3300032002 | Ga0307416_100068852 | Ga0307416_1000688522 | 425 |
| 474 | 3300032126 | Ga0307415_100012860 | Ga0307415_1000128602 | 425 |
| 475 | 3300046689 | Ga0495613_0161819 | Ga0495613_0161819_17_1339 | 425 |
| 476 | 3300049581 | Ga0501047_0016610 | Ga0501047_0016610_5083_6426 | 425 |
| 477 | 3300049581 | Ga0501047_0150093 | Ga0501047_0150093_666_1994 | 425 |
| 478 | 3300049822 | Ga0501035_0081860 | Ga0501035_0081860_1181_2524 | 425 |
| 479 | 3300049823 | Ga0501044_0000391 | Ga0501044_0000391_9464_10807 | 425 |
| 480 | 3300049823 | Ga0501044_0001179 | Ga0501044_0001179_11320_12648 | 425 |
| 481 | 3300005458 | Ga0070681_10019728 | Ga0070681_100197282 | 426 |
| 482 | 3300009093 | Ga0105240_10147513 | Ga0105240_101475132 | 426 |
| 483 | 3300013105 | Ga0157369_10054644 | Ga0157369_100546444 | 426 |
| 484 | 3300013307 | Ga0157372_10000636 | Ga0157372_100006369 | 426 |
| 485 | 3300037471 | Ga0395905_0013165 | Ga0395905_0013165_4990_6372 | 426 |
| 486 | 3300049592 | Ga0501076_0067571 | Ga0501076_0067571_85_1461 | 426 |
| 487 | 3300049741 | Ga0501079_0119727 | Ga0501079_0119727_400_1776 | 426 |
| 488 | 3300049824 | Ga0501045_0069252 | Ga0501045_0069252_319_1695 | 426 |
| 489 | 3300061734 | Ga0530510_0021950 | Ga0530510_0021950_1785_3161 | 426 |
| 490 | 3300006914 | Ga0075436_100018868 | Ga0075436_1000188682 | 427 |
| 491 | 3300006914 | Ga0075436_100055704 | Ga0075436_1000557042 | 427 |
| 492 | 3300031090 | Ga0265760_10020308 | Ga0265760_100203082 | 427 |
| 493 | 3300044693 | Ga0466961_0081450 | Ga0466961_0081450_567_1967 | 427 |
| 494 | 3300044706 | Ga0466964_0082304 | Ga0466964_0082304_19_1347 | 427 |
| 495 | 3300049576 | Ga0501040_0021280 | Ga0501040_0021280_2085_3431 | 427 |
| 496 | 3300049591 | Ga0501075_0026433 | Ga0501075_0026433_1345_2691 | 427 |
| 497 | 3300049592 | Ga0501076_0098618 | Ga0501076_0098618_73_1419 | 427 |
| 498 | 3300005435 | Ga0070714_100097213 | Ga0070714_1000972132 | 428 |
| 499 | 3300005436 | Ga0070713_100076145 | Ga0070713_1000761452 | 428 |
| 500 | 3300005614 | Ga0068856_100221633 | Ga0068856_1002216331 | 428 |
| 501 | 3300013307 | Ga0157372_10023277 | Ga0157372_100232772 | 428 |
| 502 | 3300025929 | Ga0207664_10060266 | Ga0207664_100602663 | 428 |
| 503 | 3300047472 | Ga0495686_0009251 | Ga0495686_0009251_2969_4315 | 428 |
| 504 | 3300005331 | Ga0070670_100016672 | Ga0070670_1000166724 | 429 |
| 505 | 3300005336 | Ga0070680_100000986 | Ga0070680_1000009866 | 429 |
| 506 | 3300005338 | Ga0068868_100017908 | Ga0068868_1000179082 | 429 |
| 507 | 3300005354 | Ga0070675_100021287 | Ga0070675_1000212875 | 429 |
| 508 | 3300005355 | Ga0070671_100079825 | Ga0070671_1000798252 | 429 |
| 509 | 3300005458 | Ga0070681_10004893 | Ga0070681_1000489317 | 429 |
| 510 | 3300005458 | Ga0070681_10054910 | Ga0070681_100549102 | 429 |
| 511 | 3300005530 | Ga0070679_100007054 | Ga0070679_1000070543 | 429 |
| 512 | 3300005539 | Ga0068853_100194835 | Ga0068853_1001948352 | 429 |
| 513 | 3300005548 | Ga0070665_100039697 | Ga0070665_1000396972 | 429 |
| 514 | 3300005617 | Ga0068859_100062331 | Ga0068859_1000623312 | 429 |
| 515 | 3300005618 | Ga0068864_100004735 | Ga0068864_1000047353 | 429 |
| 516 | 3300005841 | Ga0068863_100041886 | Ga0068863_1000418863 | 429 |
| 517 | 3300006871 | Ga0075434_100096590 | Ga0075434_1000965902 | 429 |
| 518 | 3300006931 | Ga0097620_100062331 | Ga0097620_1000623312 | 429 |
| 519 | 3300009098 | Ga0105245_10112731 | Ga0105245_101127311 | 429 |
| 520 | 3300009177 | Ga0105248_10010899 | Ga0105248_100108993 | 429 |
| 521 | 3300009177 | Ga0105248_10053778 | Ga0105248_100537783 | 429 |
| 522 | 3300009553 | Ga0105249_10018855 | Ga0105249_100188555 | 429 |
| 523 | 3300013100 | Ga0157373_10154120 | Ga0157373_101541201 | 429 |
| 524 | 3300014325 | Ga0163163_10290497 | Ga0163163_102904971 | 429 |
| 525 | 3300021388 | Ga0213875_10000764 | Ga0213875_1000076412 | 429 |
| 526 | 3300025912 | Ga0207707_10005331 | Ga0207707_100053317 | 429 |
| 527 | 3300025917 | Ga0207660_10003975 | Ga0207660_1000397514 | 429 |
| 528 | 3300025921 | Ga0207652_10053417 | Ga0207652_100534175 | 429 |
| 529 | 3300025939 | Ga0207665_10020845 | Ga0207665_100208452 | 429 |
| 530 | 3300025940 | Ga0207691_10050361 | Ga0207691_100503613 | 429 |
| 531 | 3300025941 | Ga0207711_10185194 | Ga0207711_101851942 | 429 |
| 532 | 3300026023 | Ga0207677_10012606 | Ga0207677_100126064 | 429 |
| 533 | 3300035725 | Ga0373947_0000515 | Ga0373947_0000515_16340_17755 | 429 |
| 534 | 3300037068 | Ga0373925_0000805 | Ga0373925_0000805_11199_12614 | 429 |
| 535 | 3300037853 | Ga0436364_0165597 | Ga0436364_0165597_12690_14012 | 429 |
| 536 | 3300037853 | Ga0436364_0419311 | Ga0436364_0419311_1742_3103 | 429 |
| 537 | 3300038443 | Ga0395901_0153709 | Ga0395901_0153709_956_2338 | 429 |
| 538 | 3300039450 | Ga0436363_1248950 | Ga0436363_1248950_4836_6239 | 429 |
| 539 | 3300044694 | Ga0466963_0004370 | Ga0466963_0004370_1580_2971 | 429 |
| 540 | 3300047319 | Ga0495674_0103697 | Ga0495674_0103697_112_1665 | 429 |
| 541 | 3300048912 | Ga0496109_0003251 | Ga0496109_0003251_11782_13173 | 429 |
| 542 | 3300048915 | Ga0496112_0067014 | Ga0496112_0067014_123_1514 | 429 |
| 543 | 3300050512 | nmdc:mga0n895_19591_c1 | nmdc:mga0n895_19591_c1_1129_2574 | 429 |
| 544 | 3300013104 | Ga0157370_10119837 | Ga0157370_101198372 | 430 |
| 545 | 3300014325 | Ga0163163_10103201 | Ga0163163_101032012 | 430 |
| 546 | 3300025929 | Ga0207664_10203013 | Ga0207664_102030132 | 430 |
| 547 | 3300035725 | Ga0373947_0058334 | Ga0373947_0058334_393_1856 | 430 |
| 548 | 3300045836 | Ga0466958_0135745 | Ga0466958_0135745_209_1522 | 430 |
| 549 | 3300046535 | Ga0495586_0053910 | Ga0495586_0053910_624_1982 | 430 |
| 550 | 3300046663 | Ga0495635_0030952 | Ga0495635_0030952_1840_3225 | 430 |
| 551 | 3300047318 | Ga0495636_0020276 | Ga0495636_0020276_718_2103 | 430 |
| 552 | 3300047444 | Ga0495675_0033858 | Ga0495675_0033858_483_1841 | 430 |
| 553 | 3300048915 | Ga0496112_0184138 | Ga0496112_0184138_231_1616 | 430 |
| 554 | 3300046679 | Ga0495623_0042029 | Ga0495623_0042029_1047_2450 | 431 |
| 555 | 3300005329 | Ga0070683_100121931 | Ga0070683_1001219311 | 432 |
| 556 | 3300005336 | Ga0070680_100042235 | Ga0070680_1000422351 | 432 |
| 557 | 3300005458 | Ga0070681_10051668 | Ga0070681_100516682 | 432 |
| 558 | 3300013104 | Ga0157370_10002972 | Ga0157370_1000297216 | 432 |
| 559 | 3300021361 | Ga0213872_10001135 | Ga0213872_1000113514 | 432 |
| 560 | 3300039438 | Ga0436360_0731860 | Ga0436360_0731860_826_2208 | 432 |
| 561 | 3300039447 | Ga0436361_0596240 | Ga0436361_0596240_14211_15641 | 432 |
| 562 | 3300003323 | rootH1_10155563 | rootH1_101555631 | 433 |
| 563 | 3300025233 | Ga0209437_101450 | Ga0209437_1014503 | 433 |
| 564 | 3300037418 | Ga0395900_0084751 | Ga0395900_0084751_1755_3149 | 433 |
| 565 | 3300039437 | Ga0436365_1128249 | Ga0436365_1128249_279_1649 | 433 |
| 566 | 3300048929 | Ga0496126_0000012 | Ga0496126_0000012_248638_249999 | 433 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7php-assembly1.cif.gz_A | structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em | 0.9421 | 2 | 429 |
| 7php-assembly1.cif.gz_A | structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em | 0.9295 | 2 | 429 |
| 7dqk-assembly1.cif.gz_A | a nicotine mate transporter, nicotiana tabacum mate2 (ntmate2) | 0.9139 | 2 | 422 |
| 5xjj-assembly1.cif.gz_A | crystal structure of a mate family protein | 0.9116 | 3 | 422 |
| 3wbn-assembly1.cif.gz_A | crystal structure of mate in complex with mal6 | 0.8986 | 2 | 423 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54DM2_248_409_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9883 | 229 | 386 | 1.20.1250.20 |
| af_Q9USK3_331_487_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9817 | 230 | 383 | 1.20.1250.20 |
| af_Q3V050_274_435_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9787 | 229 | 385 | 1.20.1250.20 |
| af_A0A1D8PCB5_370_524_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9784 | 230 | 383 | 1.20.1250.20 |
| af_Q59R29_400_561_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9772 | 229 | 384 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G8BDA3-F1-model_v4 | Multidrug-efflux transporter | 0.9881 | 2 | 424 |
GO:0005886
GO:0006811 GO:0015297 GO:0042910 |
| AF-A0A2P6WED1-F1-model_v4 | Multidrug-efflux transporter | 0.9804 | 2 | 422 |
GO:0005886
GO:0006811 GO:0015297 GO:0042910 |
| AF-A0A1F3XUQ9-F1-model_v4 | Multidrug-efflux transporter | 0.9773 | 1 | 422 |
GO:0005886
GO:0006811 GO:0015297 GO:0042910 |
| AF-A0A6L3EK82-F1-model_v4 | MATE family efflux transporter | 0.9766 | 125 | 426 |
GO:0005886
GO:0015297 GO:0042910 |
| AF-A0A2V8JA00-F1-model_v4 | MATE family efflux transporter | 0.9759 | 1 | 422 |
GO:0005886
GO:0015297 GO:0042910 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar