F464366

General Info

Members Datasets Scaffolds Average Seq Length
566 257 1132 168

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100013456|Ga0070712_1000134563
Length 187
Sequence MVATPMNGAHSKGKPMKIKLALISAAAIIIASPALAADAPTDPQIAHIAYTADTLDIEAGKQALAQSKNKAVRGFAEEMVRDHTAVNDKALALVKKLKVTPQDNPTSQSLTKAADAERAKLGKLSGAAFDREYINNEVAYHKTVNGALEKTLIPSAKNGELKSLLQTGLTLFREHQAHAEKIAKDIK

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
222 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
223 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
224 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
225 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
226 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
227 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
228 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
231 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
232 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
233 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
242 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
243 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
252 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
256 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
257 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.18
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0.18
Rhizoplane 6.36
Rhizosphere 88.52
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100013456 3300006175 Bacteria 5230
2 JGI24736J21556_1047320 3300001904 Bacteria 661
3 JGI24740J21852_10020647 3300001979 Bacteria 2294
4 JGI24739J22299_10006949 3300001989 Bacteria 4265
5 JGI24739J22299_10017759 3300001989 Bacteria 2564
6 JGI24737J22298_10002685 3300001990 Bacteria 6287
7 JGI24737J22298_10033478 3300001990 Bacteria 1596
8 JGI24735J21928_10002477 3300002067 Bacteria 6411
9 JGI24735J21928_10006579 3300002067 Bacteria 3819
10 JGI24735J21928_10008709 3300002067 Bacteria 3275
11 JGI24735J21928_10015211 3300002067 Bacteria 2403
12 JGI24735J21928_10023524 3300002067 Bacteria 1868
13 JGI24738J21930_10001533 3300002075 Bacteria 6376
14 Ga0058863_11904748 3300004799 Bacteria 598
15 Ga0065712_10072765 3300005290 Bacteria 4625
16 Ga0070658_10000305 3300005327 Bacteria 42490
17 Ga0070658_10000476 3300005327 Bacteria 34771
18 Ga0070658_10024500 3300005327 Bacteria 4840
19 Ga0070658_10031591 3300005327 Bacteria 4253
20 Ga0070658_10067880 3300005327 Bacteria 2914
21 Ga0070658_10116444 3300005327 Bacteria 2218
22 Ga0070658_10221387 3300005327 Bacteria 1601
23 Ga0070658_10301403 3300005327 Unclassified 1366
24 Ga0070676_10089524 3300005328 Bacteria 1883
25 Ga0070676_10237349 3300005328 Bacteria 1211
26 Ga0070683_100000872 3300005329 Bacteria 22349
27 Ga0070683_100040309 3300005329 Bacteria 4293
28 Ga0070683_100518086 3300005329 Bacteria 1139
29 Ga0070690_100097299 3300005330 Bacteria 1946
30 Ga0070670_100000350 3300005331 Bacteria 38698
31 Ga0070670_100087725 3300005331 Bacteria 2674
32 Ga0070670_100123354 3300005331 Bacteria 2235
33 Ga0070670_100340164 3300005331 Bacteria 1317
34 Ga0070666_10011150 3300005335 Bacteria 5632
35 Ga0070666_10048528 3300005335 Bacteria 2853
36 Ga0070680_100081564 3300005336 Bacteria 2669
37 Ga0070682_100109956 3300005337 Bacteria 1835
38 Ga0068868_100492960 3300005338 Bacteria 1072
39 Ga0070660_100000129 3300005339 Bacteria 47402
40 Ga0070660_100003460 3300005339 Bacteria 10868
41 Ga0070660_100009913 3300005339 Bacteria 6720
42 Ga0070660_100077617 3300005339 Bacteria 2603
43 Ga0070660_100084716 3300005339 Bacteria 2492
44 Ga0070660_100087006 3300005339 Bacteria 2459
45 Ga0070660_100096848 3300005339 Bacteria 2334
46 Ga0070660_100174454 3300005339 Bacteria 1738
47 Ga0070660_100207830 3300005339 Bacteria 1589
48 Ga0070660_100304765 3300005339 Bacteria 1306
49 Ga0070661_100000033 3300005344 Bacteria 111757
50 Ga0070661_100035089 3300005344 Bacteria 3641
51 Ga0070661_100051186 3300005344 Bacteria 3022
52 Ga0070661_100051793 3300005344 Bacteria 3005
53 Ga0070661_100054285 3300005344 Bacteria 2935
54 Ga0070661_100056574 3300005344 Bacteria 2874
55 Ga0070661_100136011 3300005344 Bacteria 1849
56 Ga0070661_100221933 3300005344 Bacteria 1450
57 Ga0070661_100271567 3300005344 Bacteria 1313
58 Ga0070668_100264941 3300005347 Bacteria 1430
59 Ga0070669_100026397 3300005353 Bacteria 4179
60 Ga0070675_100001857 3300005354 Bacteria 15581
61 Ga0070671_100000752 3300005355 Bacteria 23230
62 Ga0070671_100001032 3300005355 Bacteria 20490
63 Ga0070671_100024364 3300005355 Bacteria 4953
64 Ga0070671_100120617 3300005355 Bacteria 2206
65 Ga0070671_100190451 3300005355 Bacteria 1738
66 Ga0070671_100615124 3300005355 Bacteria 939
67 Ga0070671_100986587 3300005355 Bacteria 738
68 Ga0070674_100025751 3300005356 Bacteria 3833
69 Ga0070673_100003253 3300005364 Bacteria 10079
70 Ga0070659_100000142 3300005366 Bacteria 55216
71 Ga0070659_100001753 3300005366 Bacteria 15585
72 Ga0070659_100121267 3300005366 Bacteria 2118
73 Ga0070659_100144438 3300005366 Bacteria 1938
74 Ga0070659_100256318 3300005366 Bacteria 1451
75 Ga0070659_100271547 3300005366 Bacteria 1409
76 Ga0070667_100023097 3300005367 Bacteria 5158
77 Ga0070667_100098706 3300005367 Bacteria 2520
78 Ga0070667_100143669 3300005367 Bacteria 2091
79 Ga0070667_100193163 3300005367 Bacteria 1804
80 Ga0070667_100653127 3300005367 Bacteria 971
81 Ga0070667_100953831 3300005367 Bacteria 799
82 Ga0070714_100019205 3300005435 Bacteria 5563
83 Ga0070714_100228922 3300005435 Bacteria 1712
84 Ga0070714_100676567 3300005435 Bacteria 995
85 Ga0070713_100705283 3300005436 Unclassified 963
86 Ga0070663_100019809 3300005455 Bacteria 4442
87 Ga0070663_100105551 3300005455 Bacteria 2109
88 Ga0070663_100559247 3300005455 Bacteria 957
89 Ga0070663_100663927 3300005455 Bacteria 883
90 Ga0070678_100043758 3300005456 Bacteria 3192
91 Ga0070678_100237869 3300005456 Bacteria 1521
92 Ga0070662_100000021 3300005457 Bacteria 93909
93 Ga0070662_100114971 3300005457 Bacteria 2055
94 Ga0070681_10481619 3300005458 Bacteria 1154
95 Ga0070685_10153336 3300005466 Bacteria 1462
96 Ga0070707_100009152 3300005468 Bacteria 9187
97 Ga0070699_100062816 3300005518 Bacteria 3220
98 Ga0070679_100036794 3300005530 Bacteria 4858
99 Ga0070679_100176525 3300005530 Bacteria 2109
100 Ga0070679_100319652 3300005530 Bacteria 1501
101 Ga0070684_100002373 3300005535 Bacteria 13880
102 Ga0070684_100070128 3300005535 Bacteria 3083
103 Ga0068853_100000377 3300005539 Bacteria 30591
104 Ga0068853_100036861 3300005539 Bacteria 4159
105 Ga0068853_100056982 3300005539 Bacteria 3371
106 Ga0068853_100855173 3300005539 Bacteria 872
107 Ga0070672_100005889 3300005543 Bacteria 8177
108 Ga0070672_100054711 3300005543 Bacteria 3125
109 Ga0070672_100431899 3300005543 Bacteria 1132
110 Ga0070672_100879189 3300005543 Bacteria 791
111 Ga0070693_100000142 3300005547 Bacteria 32335
112 Ga0070665_100009401 3300005548 Bacteria 9894
113 Ga0070665_100023887 3300005548 Bacteria 6158
114 Ga0070665_101081970 3300005548 Bacteria 813
115 Ga0068855_100000745 3300005563 Bacteria 40001
116 Ga0068855_100112043 3300005563 Bacteria 3131
117 Ga0068855_100263054 3300005563 Bacteria 1921
118 Ga0070664_100000153 3300005564 Bacteria 47344
119 Ga0070664_100004435 3300005564 Bacteria 11273
120 Ga0070664_100019065 3300005564 Bacteria 5642
121 Ga0070664_100038561 3300005564 Bacteria 4023
122 Ga0070664_100183615 3300005564 Bacteria 1860
123 Ga0068857_100005235 3300005577 Bacteria 11044
124 Ga0068857_100740547 3300005577 Bacteria 936
125 Ga0068854_100028009 3300005578 Bacteria 3888
126 Ga0068856_100000177 3300005614 Bacteria 66207
127 Ga0068856_100119395 3300005614 Bacteria 2638
128 Ga0068856_100365949 3300005614 Bacteria 1461
129 Ga0068856_100854714 3300005614 Bacteria 929
130 Ga0068856_101488834 3300005614 Bacteria 691
131 Ga0068852_100001121 3300005616 Bacteria 17696
132 Ga0068852_100406162 3300005616 Bacteria 1341
133 Ga0068852_100586761 3300005616 Bacteria 1118
134 Ga0068852_100910845 3300005616 Bacteria 896
135 Ga0068864_100014651 3300005618 Bacteria 6512
136 Ga0068864_100192337 3300005618 Bacteria 1871
137 Ga0068864_100354923 3300005618 Bacteria 1384
138 Ga0068851_10026336 3300005834 Bacteria 2857
139 Ga0068851_10125541 3300005834 Bacteria 1383
140 Ga0068863_100024321 3300005841 Bacteria 5777
141 Ga0068858_100903441 3300005842 Bacteria 864
142 Ga0068860_100420823 3300005843 Bacteria 1324
143 Ga0070717_10157619 3300006028 Bacteria 1968
144 Ga0070716_100306952 3300006173 Bacteria 1106
145 Ga0070712_100031359 3300006175 Bacteria 3580
146 Ga0075367_10045126 3300006178 Bacteria 2586
147 Ga0097621_100055498 3300006237 Bacteria 3235
148 Ga0097621_100263283 3300006237 Unclassified 1513
149 Ga0097621_100272251 3300006237 Bacteria 1488
150 Ga0068871_100240855 3300006358 Bacteria 1573
151 Ga0068865_100240231 3300006881 Bacteria 1425
152 Ga0105240_10523803 3300009093 Unclassified 1315
153 Ga0105243_10239903 3300009148 Bacteria 1612
154 Ga0105241_10032613 3300009174 Bacteria 3906
155 Ga0105241_10071152 3300009174 Bacteria 2700
156 Ga0105241_10310639 3300009174 Bacteria 1356
157 Ga0105242_10457951 3300009176 Bacteria 1204
158 Ga0105248_10000801 3300009177 Bacteria 35327
159 Ga0105248_10008720 3300009177 Bacteria 11138
160 Ga0105248_10199542 3300009177 Bacteria 2254
161 Ga0105248_10314629 3300009177 Bacteria 1763
162 Ga0105237_10003290 3300009545 Bacteria 19298
163 Ga0105238_10201880 3300009551 Bacteria 1964
164 Ga0105239_10053193 3300010375 Bacteria 4442
165 Ga0157373_10008235 3300013100 Bacteria 7750
166 Ga0157373_10021117 3300013100 Bacteria 4726
167 Ga0157373_10070953 3300013100 Unclassified 2461
168 Ga0157373_10146768 3300013100 Unclassified 1659
169 Ga0157371_10007603 3300013102 Bacteria 8742
170 Ga0157371_10142947 3300013102 Bacteria 1704
171 Ga0157371_10144385 3300013102 Bacteria 1696
172 Ga0157371_10175563 3300013102 Unclassified 1532
173 Ga0157371_11013521 3300013102 Bacteria 634
174 Ga0157370_10128802 3300013104 Bacteria 2361
175 Ga0157370_10134859 3300013104 Bacteria 2302
176 Ga0157369_10053891 3300013105 Bacteria 4344
177 Ga0157369_10420214 3300013105 Bacteria 1386
178 Ga0157369_12060277 3300013105 Bacteria 579
179 Ga0157374_10047489 3300013296 Bacteria 3981
180 Ga0157374_10054142 3300013296 Bacteria 3742
181 Ga0157374_10117492 3300013296 Bacteria 2563
182 Ga0157374_10186137 3300013296 Bacteria 2030
183 Ga0157374_10270422 3300013296 Unclassified 1676
184 Ga0157378_10057733 3300013297 Bacteria 3460
185 Ga0157378_11238364 3300013297 Bacteria 786
186 Ga0157372_10078730 3300013307 Bacteria 3725
187 Ga0157372_10849366 3300013307 Unclassified 1060
188 Ga0157372_10950669 3300013307 Bacteria 996
189 Ga0157375_10055112 3300013308 Bacteria 3919
190 Ga0157375_10145546 3300013308 Bacteria 2500
191 Ga0157375_10290610 3300013308 Bacteria 1798
192 Ga0163163_10001448 3300014325 Bacteria 20044
193 Ga0163163_10273323 3300014325 Bacteria 1741
194 Ga0157379_10385298 3300014968 Bacteria 1287
195 Ga0157379_11433861 3300014968 Bacteria 670
196 Ga0209758_1018905 3300025297 Bacteria 3352
197 Ga0207697_10018534 3300025315 Bacteria 2854
198 Ga0207697_10255716 3300025315 Bacteria 775
199 Ga0207656_10015848 3300025321 Bacteria 2924
200 Ga0207680_10002390 3300025903 Bacteria 8743
201 Ga0207647_10002639 3300025904 Bacteria 13548
202 Ga0207647_10010938 3300025904 Bacteria 6383
203 Ga0207647_10020613 3300025904 Bacteria 4417
204 Ga0207647_10036227 3300025904 Bacteria 3136
205 Ga0207647_10068551 3300025904 Bacteria 2147
206 Ga0207647_10248186 3300025904 Bacteria 1021
207 Ga0207699_10031390 3300025906 Bacteria 2982
208 Ga0207645_10348780 3300025907 Bacteria 990
209 Ga0207705_10000002 3300025909 Bacteria 2046852
210 Ga0207705_10000174 3300025909 Bacteria 68260
211 Ga0207705_10003880 3300025909 Bacteria 11373
212 Ga0207705_10016929 3300025909 Bacteria 5221
213 Ga0207705_10019954 3300025909 Bacteria 4794
214 Ga0207705_10041160 3300025909 Bacteria 3314
215 Ga0207705_10064360 3300025909 Bacteria 2650
216 Ga0207705_10064825 3300025909 Bacteria 2640
217 Ga0207705_10068963 3300025909 Bacteria 2561
218 Ga0207705_10217988 3300025909 Bacteria 1448
219 Ga0207705_10312423 3300025909 Bacteria 1206
220 Ga0207654_10039951 3300025911 Bacteria 2642
221 Ga0207695_10437656 3300025913 Unclassified 1191
222 Ga0207671_10001839 3300025914 Bacteria 23683
223 Ga0207671_10302875 3300025914 Bacteria 1263
224 Ga0207693_10024564 3300025915 Bacteria 4780
225 Ga0207693_10198610 3300025915 Bacteria 1577
226 Ga0207660_10165445 3300025917 Bacteria 1709
227 Ga0207657_10000173 3300025919 Bacteria 66220
228 Ga0207657_10002067 3300025919 Bacteria 21721
229 Ga0207657_10007817 3300025919 Bacteria 10914
230 Ga0207657_10008516 3300025919 Bacteria 10400
231 Ga0207657_10010348 3300025919 Bacteria 9310
232 Ga0207657_10018509 3300025919 Bacteria 6645
233 Ga0207657_10066657 3300025919 Bacteria 3064
234 Ga0207657_10200354 3300025919 Bacteria 1606
235 Ga0207657_10409039 3300025919 Bacteria 1067
236 Ga0207649_10000014 3300025920 Bacteria 255001
237 Ga0207649_10007890 3300025920 Bacteria 5792
238 Ga0207649_10049962 3300025920 Bacteria 2585
239 Ga0207649_10131862 3300025920 Bacteria 1699
240 Ga0207649_10189822 3300025920 Bacteria 1444
241 Ga0207649_10358380 3300025920 Bacteria 1081
242 Ga0207649_10389791 3300025920 Bacteria 1040
243 Ga0207649_10625608 3300025920 Bacteria 830
244 Ga0207652_10118563 3300025921 Bacteria 2352
245 Ga0207652_10156671 3300025921 Bacteria 2041
246 Ga0207652_10256419 3300025921 Unclassified 1577
247 Ga0207646_10011339 3300025922 Bacteria 8649
248 Ga0207681_10020618 3300025923 Bacteria 4180
249 Ga0207694_10232710 3300025924 Bacteria 1505
250 Ga0207650_10017569 3300025925 Bacteria 5009
251 Ga0207650_10092973 3300025925 Bacteria 2308
252 Ga0207650_10119604 3300025925 Bacteria 2049
253 Ga0207650_10202647 3300025925 Bacteria 1590
254 Ga0207659_10002256 3300025926 Bacteria 11474
255 Ga0207700_10026977 3300025928 Bacteria 4014
256 Ga0207664_10070042 3300025929 Bacteria 2821
257 Ga0207664_10274704 3300025929 Bacteria 1477
258 Ga0207644_10001487 3300025931 Bacteria 15074
259 Ga0207644_10007270 3300025931 Bacteria 7207
260 Ga0207644_10008961 3300025931 Bacteria 6555
261 Ga0207690_10000150 3300025932 Bacteria 55157
262 Ga0207690_10003020 3300025932 Bacteria 10127
263 Ga0207690_10013257 3300025932 Bacteria 4949
264 Ga0207690_10191870 3300025932 Bacteria 1545
265 Ga0207690_10260777 3300025932 Bacteria 1343
266 Ga0207706_10000358 3300025933 Bacteria 49357
267 Ga0207706_10119601 3300025933 Bacteria 2316
268 Ga0207706_10127755 3300025933 Bacteria 2235
269 Ga0207706_10417253 3300025933 Bacteria 1163
270 Ga0207669_10190961 3300025937 Bacteria 1477
271 Ga0207704_10499226 3300025938 Bacteria 980
272 Ga0207665_10035081 3300025939 Bacteria 3328
273 Ga0207691_10012970 3300025940 Bacteria 7981
274 Ga0207691_10038172 3300025940 Bacteria 4443
275 Ga0207691_10392988 3300025940 Bacteria 1183
276 Ga0207691_10783029 3300025940 Bacteria 802
277 Ga0207711_10001142 3300025941 Bacteria 25262
278 Ga0207711_10029142 3300025941 Bacteria 4653
279 Ga0207711_10087169 3300025941 Bacteria 2738
280 Ga0207661_10024592 3300025944 Bacteria 4565
281 Ga0207661_10091822 3300025944 Bacteria 2530
282 Ga0207679_10000874 3300025945 Bacteria 19215
283 Ga0207679_10029566 3300025945 Bacteria 3816
284 Ga0207679_11098577 3300025945 Bacteria 730
285 Ga0207679_11263259 3300025945 Bacteria 678
286 Ga0207667_10005712 3300025949 Bacteria 15175
287 Ga0207667_10031202 3300025949 Bacteria 5754
288 Ga0207667_10178919 3300025949 Unclassified 2178
289 Ga0207667_10348353 3300025949 Bacteria 1511
290 Ga0207651_10002735 3300025960 Bacteria 8469
291 Ga0207651_10104791 3300025960 Bacteria 2108
292 Ga0207651_10432700 3300025960 Bacteria 1125
293 Ga0207668_10594404 3300025972 Bacteria 963
294 Ga0207640_10101296 3300025981 Bacteria 2020
295 Ga0207640_10223867 3300025981 Unclassified 1442
296 Ga0207658_10002256 3300025986 Bacteria 14273
297 Ga0207658_10054700 3300025986 Bacteria 2954
298 Ga0207658_10220831 3300025986 Bacteria 1594
299 Ga0207658_11529522 3300025986 Bacteria 610
300 Ga0207677_10832883 3300026023 Bacteria 828
301 Ga0207677_10897048 3300026023 Bacteria 799
302 Ga0207703_10024347 3300026035 Bacteria 4764
303 Ga0207639_10000740 3300026041 Bacteria 22283
304 Ga0207639_10071394 3300026041 Bacteria 2715
305 Ga0207639_10158080 3300026041 Bacteria 1907
306 Ga0207639_10516688 3300026041 Bacteria 1093
307 Ga0207678_10003603 3300026067 Bacteria 13923
308 Ga0207678_10018512 3300026067 Bacteria 6117
309 Ga0207678_10055365 3300026067 Bacteria 3417
310 Ga0207702_10030786 3300026078 Bacteria 4470
311 Ga0207702_10079936 3300026078 Bacteria 2835
312 Ga0207702_10108506 3300026078 Bacteria 2463
313 Ga0207702_10113234 3300026078 Bacteria 2416
314 Ga0207702_10430540 3300026078 Bacteria 1277
315 Ga0207702_10669334 3300026078 Bacteria 1022
316 Ga0207702_10694166 3300026078 Bacteria 1003
317 Ga0207641_10104020 3300026088 Bacteria 2506
318 Ga0207676_10009769 3300026095 Bacteria 6824
319 Ga0207676_10109505 3300026095 Bacteria 2308
320 Ga0207676_10164412 3300026095 Bacteria 1926
321 Ga0207676_10183230 3300026095 Bacteria 1835
322 Ga0207674_10010980 3300026116 Bacteria 10192
323 Ga0207674_10473754 3300026116 Bacteria 1210
324 Ga0207683_10005904 3300026121 Bacteria 10497
325 Ga0207683_10274699 3300026121 Bacteria 1540
326 Ga0207698_10003402 3300026142 Bacteria 9578
327 Ga0207698_10018682 3300026142 Bacteria 4730
328 Ga0207698_10243725 3300026142 Bacteria 1640
329 Ga0209970_1014311 3300027614 Bacteria 1317
330 Ga0268266_10003658 3300028379 Bacteria 15192
331 Ga0268266_10021435 3300028379 Bacteria 5504
332 Ga0268266_11156554 3300028379 Bacteria 748
333 Ga0307408_100059171 3300031548 Bacteria 2788
334 Ga0307408_100078970 3300031548 Bacteria 2454
335 Ga0307408_100467448 3300031548 Bacteria 1097
336 Ga0307408_100478016 3300031548 Bacteria 1086
337 Ga0307405_10127149 3300031731 Bacteria 1754
338 Ga0307405_10380543 3300031731 Bacteria 1098
339 Ga0307405_10382154 3300031731 Bacteria 1096
340 Ga0307405_10457707 3300031731 Bacteria 1013
341 Ga0307405_11167366 3300031731 Bacteria 664
342 Ga0307413_10057955 3300031824 Bacteria 2371
343 Ga0307413_10187695 3300031824 Bacteria 1481
344 Ga0307413_10211901 3300031824 Bacteria 1408
345 Ga0307413_10361823 3300031824 Bacteria 1123
346 Ga0307410_10042027 3300031852 Bacteria 3018
347 Ga0307410_10154090 3300031852 Bacteria 1714
348 Ga0307410_10437206 3300031852 Bacteria 1064
349 Ga0307410_10918039 3300031852 Bacteria 751
350 Ga0307406_10041253 3300031901 Bacteria 2875
351 Ga0307406_10087770 3300031901 Bacteria 2085
352 Ga0307406_10143396 3300031901 Bacteria 1694
353 Ga0307406_10326572 3300031901 Bacteria 1189
354 Ga0307407_10062803 3300031903 Bacteria 2177
355 Ga0307407_10073996 3300031903 Bacteria 2037
356 Ga0307412_10060228 3300031911 Bacteria 2547
357 Ga0307412_10126178 3300031911 Bacteria 1851
358 Ga0307409_100035562 3300031995 Bacteria 3651
359 Ga0307409_100086213 3300031995 Bacteria 2555
360 Ga0307409_100555788 3300031995 Bacteria 1127
361 Ga0307409_101048035 3300031995 Unclassified 835
362 Ga0307409_101072117 3300031995 Bacteria 826
363 Ga0307416_100029624 3300032002 Bacteria 4092
364 Ga0307416_100032385 3300032002 Bacteria 3949
365 Ga0307416_100905227 3300032002 Bacteria 982
366 Ga0307414_10047435 3300032004 Bacteria 2956
367 Ga0307414_10127612 3300032004 Bacteria 1968
368 Ga0307414_10330594 3300032004 Bacteria 1301
369 Ga0307411_10067413 3300032005 Bacteria 2408
370 Ga0307411_10179674 3300032005 Bacteria 1605
371 Ga0307411_10222452 3300032005 Bacteria 1465
372 Ga0307411_10541559 3300032005 Bacteria 991
373 Ga0307411_10544532 3300032005 Bacteria 989
374 Ga0307411_11929697 3300032005 Unclassified 550
375 Ga0307415_100020167 3300032126 Bacteria 4064
376 Ga0307415_100240099 3300032126 Bacteria 1465
377 Ga0373958_0170383 3300034819 Bacteria 555
378 Ga0373939_0003274 3300035114 Bacteria 3798
379 Ga0373960_0078975 3300035121 Bacteria 1032
380 Ga0373943_0122284 3300035170 Bacteria 1384
381 Ga0373942_0061641 3300035207 Bacteria 1076
382 Ga0373962_0019711 3300035242 Bacteria 1766
383 Ga0373931_0014352 3300035691 Bacteria 3869
384 Ga0373935_0116560 3300035692 Bacteria 1779
385 Ga0373935_0734077 3300035692 Bacteria 727
386 Ga0373947_0233791 3300035725 Bacteria 1211
387 Ga0373937_1011305 3300036401 Bacteria 780
388 Ga0373925_0181099 3300037068 Bacteria 1668
389 Ga0395899_0018840 3300037312 Bacteria 5245
390 Ga0395899_0053425 3300037312 Bacteria 2991
391 Ga0395899_0168017 3300037312 Bacteria 1546
392 Ga0395899_0222932 3300037312 Bacteria 1305
393 Ga0395899_0398175 3300037312 Bacteria 911
394 Ga0395900_0017999 3300037418 Bacteria 7213
395 Ga0395900_0020457 3300037418 Bacteria 6756
396 Ga0395900_0025452 3300037418 Bacteria 6058
397 Ga0395900_0038603 3300037418 Bacteria 4923
398 Ga0395900_0064453 3300037418 Bacteria 3765
399 Ga0395900_0067676 3300037418 Bacteria 3669
400 Ga0395900_0300934 3300037418 Bacteria 1590
401 Ga0395900_0567323 3300037418 Bacteria 1078
402 Ga0395898_0024175 3300037466 Bacteria 6130
403 Ga0395898_0074053 3300037466 Bacteria 3290
404 Ga0395898_0075111 3300037466 Bacteria 3265
405 Ga0395898_0105132 3300037466 Bacteria 2707
406 Ga0395898_0243306 3300037466 Bacteria 1716
407 Ga0395898_0468061 3300037466 Bacteria 1199
408 Ga0395898_0769638 3300037466 Bacteria 904
409 Ga0395905_0003117 3300037471 Bacteria 17879
410 Ga0395905_0004925 3300037471 Bacteria 13746
411 Ga0395905_0008998 3300037471 Bacteria 9798
412 Ga0395905_0029485 3300037471 Bacteria 5170
413 Ga0395905_0043263 3300037471 Bacteria 4225
414 Ga0395905_0045745 3300037471 Bacteria 4105
415 Ga0395905_0047156 3300037471 Bacteria 4040
416 Ga0395905_0067818 3300037471 Bacteria 3341
417 Ga0395905_0070802 3300037471 Bacteria 3269
418 Ga0395905_0072545 3300037471 Bacteria 3228
419 Ga0395905_0095731 3300037471 Bacteria 2787
420 Ga0395905_0147669 3300037471 Bacteria 2212
421 Ga0395905_0284234 3300037471 Bacteria 1541
422 Ga0395905_0934716 3300037471 Bacteria 770
423 Ga0395901_0030203 3300038443 Bacteria 5583
424 Ga0395901_0078924 3300038443 Bacteria 3437
425 Ga0395901_0106245 3300038443 Bacteria 2947
426 Ga0395901_0120382 3300038443 Bacteria 2759
427 Ga0395901_0232388 3300038443 Bacteria 1925
428 Ga0395901_0292007 3300038443 Bacteria 1691
429 Ga0395901_0549727 3300038443 Bacteria 1170
430 Ga0439432_057848 3300042006 Bacteria 1199
431 Ga0466969_0055014 3300044656 Bacteria 1948
432 Ga0466969_0147527 3300044656 Bacteria 1085
433 Ga0466966_0013298 3300044684 Bacteria 5450
434 Ga0466966_0039146 3300044684 Bacteria 3053
435 Ga0466961_0037259 3300044693 Bacteria 3120
436 Ga0466961_0154539 3300044693 Bacteria 1431
437 Ga0466963_0007339 3300044694 Bacteria 6567
438 Ga0466963_0021347 3300044694 Bacteria 4083
439 Ga0466963_0023247 3300044694 Bacteria 3933
440 Ga0466971_0009261 3300044719 Bacteria 4303
441 Ga0466970_0052815 3300044765 Bacteria 2170
442 Ga0466957_0011499 3300044842 Bacteria 5109
443 Ga0466957_0105230 3300044842 Bacteria 1783
444 Ga0466957_0227234 3300044842 Bacteria 1234
445 Ga0466959_0220178 3300045049 Bacteria 1317
446 Ga0466959_0581120 3300045049 Bacteria 754
447 Ga0466958_0029267 3300045836 Bacteria 3268
448 Ga0466958_0463609 3300045836 Bacteria 821
449 Ga0466967_0006556 3300045976 Bacteria 8258
450 Ga0466967_0047733 3300045976 Bacteria 3734
451 Ga0466967_0829543 3300045976 Bacteria 918
452 Ga0495638_0000323 3300046460 Bacteria 60784
453 Ga0495605_0070604 3300046474 Bacteria 1651
454 Ga0495607_0165784 3300046501 Bacteria 1119
455 Ga0495583_0018505 3300046506 Bacteria 3666
456 Ga0495616_0045154 3300046513 Bacteria 2232
457 Ga0495631_0001710 3300046518 Bacteria 13023
458 Ga0495632_0019466 3300046519 Bacteria 3696
459 Ga0495648_0115502 3300046524 Bacteria 1452
460 Ga0495654_0068965 3300046530 Bacteria 1680
461 Ga0495667_0164174 3300046559 Bacteria 1428
462 Ga0495668_0011197 3300046616 Bacteria 5383
463 Ga0495611_0011707 3300046648 Bacteria 3721
464 Ga0495625_0000088 3300046660 Bacteria 150352
465 Ga0495625_0001060 3300046660 Bacteria 35944
466 Ga0495657_0509406 3300046675 Bacteria 701
467 Ga0495658_0116679 3300046683 Bacteria 1610
468 Ga0495669_0000602 3300046684 Bacteria 15746
469 Ga0495671_0458942 3300046692 Bacteria 609
470 Ga0495600_0026365 3300046809 Unclassified 3751
471 Ga0495660_0008626 3300046810 Bacteria 5964
472 Ga0495636_0016913 3300047318 Bacteria 2916
473 Ga0495672_0029026 3300047320 Bacteria 3490
474 Ga0495677_0042888 3300047445 Bacteria 1658
475 Ga0496100_0485963 3300048903 Bacteria 950
476 Ga0496102_0000066 3300048905 Bacteria 159020
477 Ga0496102_0151588 3300048905 Bacteria 2179
478 Ga0496103_0000102 3300048906 Bacteria 93559
479 Ga0496104_0157058 3300048907 Bacteria 2182
480 Ga0496104_0175016 3300048907 Bacteria 2057
481 Ga0496104_0475101 3300048907 Bacteria 1161
482 Ga0496105_0000233 3300048908 Bacteria 37716
483 Ga0496105_0177924 3300048908 Bacteria 1742
484 Ga0496106_0010389 3300048909 Bacteria 6878
485 Ga0496106_0308944 3300048909 Bacteria 1269
486 Ga0496107_0140294 3300048910 Bacteria 1786
487 Ga0496108_0015040 3300048911 Bacteria 6317
488 Ga0496108_0031050 3300048911 Bacteria 4430
489 Ga0496108_0243808 3300048911 Bacteria 1563
490 Ga0496109_0025686 3300048912 Bacteria 5250
491 Ga0496109_0028877 3300048912 Bacteria 4965
492 Ga0496109_0203274 3300048912 Unclassified 1862
493 Ga0496109_0457775 3300048912 Bacteria 1205
494 Ga0496110_0001413 3300048913 Bacteria 17353
495 Ga0496110_0062891 3300048913 Bacteria 3279
496 Ga0496111_0003214 3300048914 Bacteria 10086
497 Ga0496111_0011130 3300048914 Bacteria 6055
498 Ga0496111_0085177 3300048914 Bacteria 2311
499 Ga0496111_0431320 3300048914 Bacteria 973
500 Ga0496111_0579745 3300048914 Bacteria 822
501 Ga0496112_0029685 3300048915 Bacteria 5289
502 Ga0496112_0042189 3300048915 Bacteria 4463
503 Ga0496112_0189749 3300048915 Bacteria 2017
504 Ga0496112_0535217 3300048915 Bacteria 1106
505 Ga0496112_0934901 3300048915 Bacteria 788
506 Ga0496113_0019247 3300048916 Bacteria 4772
507 Ga0496113_0038220 3300048916 Bacteria 3528
508 Ga0496114_0006489 3300048917 Bacteria 9218
509 Ga0496114_0393715 3300048917 Bacteria 1227
510 Ga0496115_0000054 3300048918 Bacteria 106423
511 Ga0496116_0003534 3300048919 Bacteria 15386
512 Ga0496117_0000225 3300048920 Bacteria 106485
513 Ga0496118_0000197 3300048921 Bacteria 106272
514 Ga0496119_0003058 3300048922 Bacteria 17693
515 Ga0496120_0007353 3300048923 Bacteria 8215
516 Ga0496121_0000279 3300048924 Bacteria 106475
517 Ga0496124_0000240 3300048927 Bacteria 106486
518 Ga0496126_0000295 3300048929 Bacteria 106266
519 Ga0495682_0118205 3300049460 Bacteria 949
520 Ga0501298_019322 3300049521 Bacteria 1262
521 Ga0501046_0720159 3300049580 Unclassified 702
522 Ga0501047_0205227 3300049581 Bacteria 1830
523 Ga0501067_0078215 3300049583 Bacteria 1833
524 Ga0501067_0382196 3300049583 Bacteria 785
525 Ga0501067_0417777 3300049583 Bacteria 748
526 Ga0501070_0211224 3300049586 Bacteria 1593
527 Ga0501071_0167976 3300049587 Bacteria 1642
528 Ga0501071_0355023 3300049587 Bacteria 1116
529 Ga0501073_0877268 3300049589 Unclassified 618
530 Ga0501201_004286 3300049651 Bacteria 1320
531 Ga0501217_206688 3300049661 Bacteria 614
532 Ga0501223_008290 3300049663 Bacteria 2119
533 Ga0501235_026871 3300049669 Bacteria 1291
534 Ga0501250_003898 3300049680 Bacteria 1459
535 Ga0501253_153578 3300049683 Bacteria 582
536 Ga0501259_036852 3300049688 Bacteria 947
537 Ga0501225_0014799 3300049705 Bacteria 2175
538 Ga0501080_0156793 3300049742 Bacteria 2103
539 Ga0501262_010077 3300049759 Bacteria 1178
540 Ga0501268_002090 3300049765 Bacteria 2587
541 Ga0501272_003344 3300049769 Bacteria 1628
542 Ga0501282_006443 3300049778 Bacteria 1254
543 Ga0501283_008159 3300049779 Bacteria 1504
544 nmdc:mga06z11_63513_c1 3300050494 Bacteria 1932
545 Ga0495612_0282048 3300053078 Bacteria 743
546 Ga0500610_0031850 3300053079 Bacteria 2682
547 Ga0495619_0385844 3300053085 Unclassified 968
548 Ga0500578_0072559 3300053086 Bacteria 2193
549 Ga0500643_037439 3300053087 Bacteria 1445
550 Ga0500650_0109929 3300053098 Bacteria 1287
551 Ga0500557_001619 3300053105 Bacteria 3774
552 Ga0500562_110009 3300053108 Bacteria 751
553 Ga0500594_0004299 3300053118 Bacteria 3140
554 Ga0500642_0090858 3300053130 Bacteria 1411
555 Ga0500658_0145643 3300053134 Bacteria 1065
556 Ga0500559_0025606 3300053136 Bacteria 2510
557 Ga0500568_0000424 3300053139 Bacteria 31935
558 Ga0500577_0284942 3300053142 Bacteria 720
559 Ga0500616_0003895 3300053153 Bacteria 10977
560 Ga0500633_0099019 3300053160 Bacteria 1072
561 Ga0500611_167373 3300053727 Bacteria 611
562 Ga0500645_048935 3300053730 Bacteria 1237
563 Ga0466962_0011070 3300061719 Bacteria 4343
564 2585230385 2582581299 Bacteria 6518058
565 2644191926 2643221634 Bacteria 6705461
566 2913296531 2913295892 Bacteria 6333755
567 Ga0070712_100013456
568 JGI24736J21556_1047320
569 JGI24740J21852_10020647
570 JGI24739J22299_10006949
571 JGI24739J22299_10017759
572 JGI24737J22298_10002685
573 JGI24737J22298_10033478
574 JGI24735J21928_10002477
575 JGI24735J21928_10006579
576 JGI24735J21928_10008709
577 JGI24735J21928_10015211
578 JGI24735J21928_10023524
579 JGI24738J21930_10001533
580 Ga0058863_11904748
581 Ga0065712_10072765
582 Ga0070658_10000305
583 Ga0070658_10000476
584 Ga0070658_10024500
585 Ga0070658_10031591
586 Ga0070658_10067880
587 Ga0070658_10116444
588 Ga0070658_10221387
589 Ga0070658_10301403
590 Ga0070676_10089524
591 Ga0070676_10237349
592 Ga0070683_100000872
593 Ga0070683_100040309
594 Ga0070683_100518086
595 Ga0070690_100097299
596 Ga0070670_100000350
597 Ga0070670_100087725
598 Ga0070670_100123354
599 Ga0070670_100340164
600 Ga0070666_10011150
601 Ga0070666_10048528
602 Ga0070680_100081564
603 Ga0070682_100109956
604 Ga0068868_100492960
605 Ga0070660_100000129
606 Ga0070660_100003460
607 Ga0070660_100009913
608 Ga0070660_100077617
609 Ga0070660_100084716
610 Ga0070660_100087006
611 Ga0070660_100096848
612 Ga0070660_100174454
613 Ga0070660_100207830
614 Ga0070660_100304765
615 Ga0070661_100000033
616 Ga0070661_100035089
617 Ga0070661_100051186
618 Ga0070661_100051793
619 Ga0070661_100054285
620 Ga0070661_100056574
621 Ga0070661_100136011
622 Ga0070661_100221933
623 Ga0070661_100271567
624 Ga0070668_100264941
625 Ga0070669_100026397
626 Ga0070675_100001857
627 Ga0070671_100000752
628 Ga0070671_100001032
629 Ga0070671_100024364
630 Ga0070671_100120617
631 Ga0070671_100190451
632 Ga0070671_100615124
633 Ga0070671_100986587
634 Ga0070674_100025751
635 Ga0070673_100003253
636 Ga0070659_100000142
637 Ga0070659_100001753
638 Ga0070659_100121267
639 Ga0070659_100144438
640 Ga0070659_100256318
641 Ga0070659_100271547
642 Ga0070667_100023097
643 Ga0070667_100098706
644 Ga0070667_100143669
645 Ga0070667_100193163
646 Ga0070667_100653127
647 Ga0070667_100953831
648 Ga0070714_100019205
649 Ga0070714_100228922
650 Ga0070714_100676567
651 Ga0070713_100705283
652 Ga0070663_100019809
653 Ga0070663_100105551
654 Ga0070663_100559247
655 Ga0070663_100663927
656 Ga0070678_100043758
657 Ga0070678_100237869
658 Ga0070662_100000021
659 Ga0070662_100114971
660 Ga0070681_10481619
661 Ga0070685_10153336
662 Ga0070707_100009152
663 Ga0070699_100062816
664 Ga0070679_100036794
665 Ga0070679_100176525
666 Ga0070679_100319652
667 Ga0070684_100002373
668 Ga0070684_100070128
669 Ga0068853_100000377
670 Ga0068853_100036861
671 Ga0068853_100056982
672 Ga0068853_100855173
673 Ga0070672_100005889
674 Ga0070672_100054711
675 Ga0070672_100431899
676 Ga0070672_100879189
677 Ga0070693_100000142
678 Ga0070665_100009401
679 Ga0070665_100023887
680 Ga0070665_101081970
681 Ga0068855_100000745
682 Ga0068855_100112043
683 Ga0068855_100263054
684 Ga0070664_100000153
685 Ga0070664_100004435
686 Ga0070664_100019065
687 Ga0070664_100038561
688 Ga0070664_100183615
689 Ga0068857_100005235
690 Ga0068857_100740547
691 Ga0068854_100028009
692 Ga0068856_100000177
693 Ga0068856_100119395
694 Ga0068856_100365949
695 Ga0068856_100854714
696 Ga0068856_101488834
697 Ga0068852_100001121
698 Ga0068852_100406162
699 Ga0068852_100586761
700 Ga0068852_100910845
701 Ga0068864_100014651
702 Ga0068864_100192337
703 Ga0068864_100354923
704 Ga0068851_10026336
705 Ga0068851_10125541
706 Ga0068863_100024321
707 Ga0068858_100903441
708 Ga0068860_100420823
709 Ga0070717_10157619
710 Ga0070716_100306952
711 Ga0070712_100031359
712 Ga0075367_10045126
713 Ga0097621_100055498
714 Ga0097621_100263283
715 Ga0097621_100272251
716 Ga0068871_100240855
717 Ga0068865_100240231
718 Ga0105240_10523803
719 Ga0105243_10239903
720 Ga0105241_10032613
721 Ga0105241_10071152
722 Ga0105241_10310639
723 Ga0105242_10457951
724 Ga0105248_10000801
725 Ga0105248_10008720
726 Ga0105248_10199542
727 Ga0105248_10314629
728 Ga0105237_10003290
729 Ga0105238_10201880
730 Ga0105239_10053193
731 Ga0157373_10008235
732 Ga0157373_10021117
733 Ga0157373_10070953
734 Ga0157373_10146768
735 Ga0157371_10007603
736 Ga0157371_10142947
737 Ga0157371_10144385
738 Ga0157371_10175563
739 Ga0157371_11013521
740 Ga0157370_10128802
741 Ga0157370_10134859
742 Ga0157369_10053891
743 Ga0157369_10420214
744 Ga0157369_12060277
745 Ga0157374_10047489
746 Ga0157374_10054142
747 Ga0157374_10117492
748 Ga0157374_10186137
749 Ga0157374_10270422
750 Ga0157378_10057733
751 Ga0157378_11238364
752 Ga0157372_10078730
753 Ga0157372_10849366
754 Ga0157372_10950669
755 Ga0157375_10055112
756 Ga0157375_10145546
757 Ga0157375_10290610
758 Ga0163163_10001448
759 Ga0163163_10273323
760 Ga0157379_10385298
761 Ga0157379_11433861
762 Ga0209758_1018905
763 Ga0207697_10018534
764 Ga0207697_10255716
765 Ga0207656_10015848
766 Ga0207680_10002390
767 Ga0207647_10002639
768 Ga0207647_10010938
769 Ga0207647_10020613
770 Ga0207647_10036227
771 Ga0207647_10068551
772 Ga0207647_10248186
773 Ga0207699_10031390
774 Ga0207645_10348780
775 Ga0207705_10000002
776 Ga0207705_10000174
777 Ga0207705_10003880
778 Ga0207705_10016929
779 Ga0207705_10019954
780 Ga0207705_10041160
781 Ga0207705_10064360
782 Ga0207705_10064825
783 Ga0207705_10068963
784 Ga0207705_10217988
785 Ga0207705_10312423
786 Ga0207654_10039951
787 Ga0207695_10437656
788 Ga0207671_10001839
789 Ga0207671_10302875
790 Ga0207693_10024564
791 Ga0207693_10198610
792 Ga0207660_10165445
793 Ga0207657_10000173
794 Ga0207657_10002067
795 Ga0207657_10007817
796 Ga0207657_10008516
797 Ga0207657_10010348
798 Ga0207657_10018509
799 Ga0207657_10066657
800 Ga0207657_10200354
801 Ga0207657_10409039
802 Ga0207649_10000014
803 Ga0207649_10007890
804 Ga0207649_10049962
805 Ga0207649_10131862
806 Ga0207649_10189822
807 Ga0207649_10358380
808 Ga0207649_10389791
809 Ga0207649_10625608
810 Ga0207652_10118563
811 Ga0207652_10156671
812 Ga0207652_10256419
813 Ga0207646_10011339
814 Ga0207681_10020618
815 Ga0207694_10232710
816 Ga0207650_10017569
817 Ga0207650_10092973
818 Ga0207650_10119604
819 Ga0207650_10202647
820 Ga0207659_10002256
821 Ga0207700_10026977
822 Ga0207664_10070042
823 Ga0207664_10274704
824 Ga0207644_10001487
825 Ga0207644_10007270
826 Ga0207644_10008961
827 Ga0207690_10000150
828 Ga0207690_10003020
829 Ga0207690_10013257
830 Ga0207690_10191870
831 Ga0207690_10260777
832 Ga0207706_10000358
833 Ga0207706_10119601
834 Ga0207706_10127755
835 Ga0207706_10417253
836 Ga0207669_10190961
837 Ga0207704_10499226
838 Ga0207665_10035081
839 Ga0207691_10012970
840 Ga0207691_10038172
841 Ga0207691_10392988
842 Ga0207691_10783029
843 Ga0207711_10001142
844 Ga0207711_10029142
845 Ga0207711_10087169
846 Ga0207661_10024592
847 Ga0207661_10091822
848 Ga0207679_10000874
849 Ga0207679_10029566
850 Ga0207679_11098577
851 Ga0207679_11263259
852 Ga0207667_10005712
853 Ga0207667_10031202
854 Ga0207667_10178919
855 Ga0207667_10348353
856 Ga0207651_10002735
857 Ga0207651_10104791
858 Ga0207651_10432700
859 Ga0207668_10594404
860 Ga0207640_10101296
861 Ga0207640_10223867
862 Ga0207658_10002256
863 Ga0207658_10054700
864 Ga0207658_10220831
865 Ga0207658_11529522
866 Ga0207677_10832883
867 Ga0207677_10897048
868 Ga0207703_10024347
869 Ga0207639_10000740
870 Ga0207639_10071394
871 Ga0207639_10158080
872 Ga0207639_10516688
873 Ga0207678_10003603
874 Ga0207678_10018512
875 Ga0207678_10055365
876 Ga0207702_10030786
877 Ga0207702_10079936
878 Ga0207702_10108506
879 Ga0207702_10113234
880 Ga0207702_10430540
881 Ga0207702_10669334
882 Ga0207702_10694166
883 Ga0207641_10104020
884 Ga0207676_10009769
885 Ga0207676_10109505
886 Ga0207676_10164412
887 Ga0207676_10183230
888 Ga0207674_10010980
889 Ga0207674_10473754
890 Ga0207683_10005904
891 Ga0207683_10274699
892 Ga0207698_10003402
893 Ga0207698_10018682
894 Ga0207698_10243725
895 Ga0209970_1014311
896 Ga0268266_10003658
897 Ga0268266_10021435
898 Ga0268266_11156554
899 Ga0307408_100059171
900 Ga0307408_100078970
901 Ga0307408_100467448
902 Ga0307408_100478016
903 Ga0307405_10127149
904 Ga0307405_10380543
905 Ga0307405_10382154
906 Ga0307405_10457707
907 Ga0307405_11167366
908 Ga0307413_10057955
909 Ga0307413_10187695
910 Ga0307413_10211901
911 Ga0307413_10361823
912 Ga0307410_10042027
913 Ga0307410_10154090
914 Ga0307410_10437206
915 Ga0307410_10918039
916 Ga0307406_10041253
917 Ga0307406_10087770
918 Ga0307406_10143396
919 Ga0307406_10326572
920 Ga0307407_10062803
921 Ga0307407_10073996
922 Ga0307412_10060228
923 Ga0307412_10126178
924 Ga0307409_100035562
925 Ga0307409_100086213
926 Ga0307409_100555788
927 Ga0307409_101048035
928 Ga0307409_101072117
929 Ga0307416_100029624
930 Ga0307416_100032385
931 Ga0307416_100905227
932 Ga0307414_10047435
933 Ga0307414_10127612
934 Ga0307414_10330594
935 Ga0307411_10067413
936 Ga0307411_10179674
937 Ga0307411_10222452
938 Ga0307411_10541559
939 Ga0307411_10544532
940 Ga0307411_11929697
941 Ga0307415_100020167
942 Ga0307415_100240099
943 Ga0373958_0170383
944 Ga0373939_0003274
945 Ga0373960_0078975
946 Ga0373943_0122284
947 Ga0373942_0061641
948 Ga0373962_0019711
949 Ga0373931_0014352
950 Ga0373935_0116560
951 Ga0373935_0734077
952 Ga0373947_0233791
953 Ga0373937_1011305
954 Ga0373925_0181099
955 Ga0395899_0018840
956 Ga0395899_0053425
957 Ga0395899_0168017
958 Ga0395899_0222932
959 Ga0395899_0398175
960 Ga0395900_0017999
961 Ga0395900_0020457
962 Ga0395900_0025452
963 Ga0395900_0038603
964 Ga0395900_0064453
965 Ga0395900_0067676
966 Ga0395900_0300934
967 Ga0395900_0567323
968 Ga0395898_0024175
969 Ga0395898_0074053
970 Ga0395898_0075111
971 Ga0395898_0105132
972 Ga0395898_0243306
973 Ga0395898_0468061
974 Ga0395898_0769638
975 Ga0395905_0003117
976 Ga0395905_0004925
977 Ga0395905_0008998
978 Ga0395905_0029485
979 Ga0395905_0043263
980 Ga0395905_0045745
981 Ga0395905_0047156
982 Ga0395905_0067818
983 Ga0395905_0070802
984 Ga0395905_0072545
985 Ga0395905_0095731
986 Ga0395905_0147669
987 Ga0395905_0284234
988 Ga0395905_0934716
989 Ga0395901_0030203
990 Ga0395901_0078924
991 Ga0395901_0106245
992 Ga0395901_0120382
993 Ga0395901_0232388
994 Ga0395901_0292007
995 Ga0395901_0549727
996 Ga0439432_057848
997 Ga0466969_0055014
998 Ga0466969_0147527
999 Ga0466966_0013298
1000 Ga0466966_0039146
1001 Ga0466961_0037259
1002 Ga0466961_0154539
1003 Ga0466963_0007339
1004 Ga0466963_0021347
1005 Ga0466963_0023247
1006 Ga0466971_0009261
1007 Ga0466970_0052815
1008 Ga0466957_0011499
1009 Ga0466957_0105230
1010 Ga0466957_0227234
1011 Ga0466959_0220178
1012 Ga0466959_0581120
1013 Ga0466958_0029267
1014 Ga0466958_0463609
1015 Ga0466967_0006556
1016 Ga0466967_0047733
1017 Ga0466967_0829543
1018 Ga0495638_0000323
1019 Ga0495605_0070604
1020 Ga0495607_0165784
1021 Ga0495583_0018505
1022 Ga0495616_0045154
1023 Ga0495631_0001710
1024 Ga0495632_0019466
1025 Ga0495648_0115502
1026 Ga0495654_0068965
1027 Ga0495667_0164174
1028 Ga0495668_0011197
1029 Ga0495611_0011707
1030 Ga0495625_0000088
1031 Ga0495625_0001060
1032 Ga0495657_0509406
1033 Ga0495658_0116679
1034 Ga0495669_0000602
1035 Ga0495671_0458942
1036 Ga0495600_0026365
1037 Ga0495660_0008626
1038 Ga0495636_0016913
1039 Ga0495672_0029026
1040 Ga0495677_0042888
1041 Ga0496100_0485963
1042 Ga0496102_0000066
1043 Ga0496102_0151588
1044 Ga0496103_0000102
1045 Ga0496104_0157058
1046 Ga0496104_0175016
1047 Ga0496104_0475101
1048 Ga0496105_0000233
1049 Ga0496105_0177924
1050 Ga0496106_0010389
1051 Ga0496106_0308944
1052 Ga0496107_0140294
1053 Ga0496108_0015040
1054 Ga0496108_0031050
1055 Ga0496108_0243808
1056 Ga0496109_0025686
1057 Ga0496109_0028877
1058 Ga0496109_0203274
1059 Ga0496109_0457775
1060 Ga0496110_0001413
1061 Ga0496110_0062891
1062 Ga0496111_0003214
1063 Ga0496111_0011130
1064 Ga0496111_0085177
1065 Ga0496111_0431320
1066 Ga0496111_0579745
1067 Ga0496112_0029685
1068 Ga0496112_0042189
1069 Ga0496112_0189749
1070 Ga0496112_0535217
1071 Ga0496112_0934901
1072 Ga0496113_0019247
1073 Ga0496113_0038220
1074 Ga0496114_0006489
1075 Ga0496114_0393715
1076 Ga0496115_0000054
1077 Ga0496116_0003534
1078 Ga0496117_0000225
1079 Ga0496118_0000197
1080 Ga0496119_0003058
1081 Ga0496120_0007353
1082 Ga0496121_0000279
1083 Ga0496124_0000240
1084 Ga0496126_0000295
1085 Ga0495682_0118205
1086 Ga0501298_019322
1087 Ga0501046_0720159
1088 Ga0501047_0205227
1089 Ga0501067_0078215
1090 Ga0501067_0382196
1091 Ga0501067_0417777
1092 Ga0501070_0211224
1093 Ga0501071_0167976
1094 Ga0501071_0355023
1095 Ga0501073_0877268
1096 Ga0501201_004286
1097 Ga0501217_206688
1098 Ga0501223_008290
1099 Ga0501235_026871
1100 Ga0501250_003898
1101 Ga0501253_153578
1102 Ga0501259_036852
1103 Ga0501225_0014799
1104 Ga0501080_0156793
1105 Ga0501262_010077
1106 Ga0501268_002090
1107 Ga0501272_003344
1108 Ga0501282_006443
1109 Ga0501283_008159
1110 nmdc:mga06z11_63513_c1
1111 Ga0495612_0282048
1112 Ga0500610_0031850
1113 Ga0495619_0385844
1114 Ga0500578_0072559
1115 Ga0500643_037439
1116 Ga0500650_0109929
1117 Ga0500557_001619
1118 Ga0500562_110009
1119 Ga0500594_0004299
1120 Ga0500642_0090858
1121 Ga0500658_0145643
1122 Ga0500559_0025606
1123 Ga0500568_0000424
1124 Ga0500577_0284942
1125 Ga0500616_0003895
1126 Ga0500633_0099019
1127 Ga0500611_167373
1128 Ga0500645_048935
1129 Ga0466962_0011070
1130 2585230385
1131 2644191926
1132 2913296531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13628

DUF4142

Domain of unknown function (DUF4142)

40

182

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fse-assembly1.cif.gz_A crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8882 22 164
4etr-assembly1.cif.gz_A x-ray structure of pa2169 from pseudomonas aeruginosa 0.8732 22 166
3bt5-assembly1.cif.gz_A crystal structure of duf305 fragment from deinococcus radiodurans 0.8407 21 164
5ffe-assembly2.cif.gz_B copm in the ag-bound form (by soaking) 0.8371 18 164
4etr-assembly1.cif.gz_A x-ray structure of pa2169 from pseudomonas aeruginosa 0.8342 22 166
ID Description Score Start End Superfamily
af_Q9CA10_47_189_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9638 108 165 1.20.140.40
3k6cH00 Special;Helix non-globular;Helix Hairpins; 0.885 113 161 6.10.140.1960
4etrA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8732 22 166 1.20.1260.10
3bt5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8407 21 164 1.20.1260.10
af_Q54XF9_6_149_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8367 24 163 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A529MCR8-F1-model_v4 DUF4142 domain-containing protein 0.9983 28 166
AF-A0A5N1IS72-F1-model_v4 DUF4142 domain-containing protein 0.998 18 165
AF-A0A0F7KLB8-F1-model_v4 Membrane protein 0.9947 19 166
AF-A0A2C9A4E8-F1-model_v4 deleted 0.9935 25 165
AF-A0A5R2MYW9-F1-model_v4 DUF4142 domain-containing protein 0.9933 38 144

Map