F464372

General Info

Members Datasets Scaffolds Average Seq Length
566 277 1132 528

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10021442|Ga0105251_100214422
Length 493
Sequence MTLSLTVRRQSLLAGLLALLLFCAGVYGQAPIGFDSRFVLFAQEMLRHGPTVFPTTYGQPYADYTSLSTVFIWLLSLPFGAVNSLTAWLPSAIAGALIVTLMYRLLAPFSLRWAWSSIALLLLTATFVSEVRAVSQDLMLAAVAFSVFYLGYAHDQQGAGRRWPLVFCLLLLGFGIRGPIGLVVPTGILCSYYLLTGQWRRLLLFGGLAWVAKASGGQAFLDDVIRMQFMGRMDGSEGASSALYYFTSSLGNYALAYPLAILALLGAWLGRAHLRGPALSLVGYCAAAALLVMLGLSIPLAKKARYLLPMLPMVAIIAAYPFHVTQGRLFTWLRGLIQGLWLLTPGLMAALQLWALSRLVQSRWRAEVTAGCAVMALWLVYVTVFEPVERRLYDTRSFTQAVIEQVSQQPAPLVLHRLGQDAKAIKFMVNLDQDLQPQFTETPAQLQAMQRPAWLMMDRHDFQALQGTRLQAMQPQLSGRFDNNDYVLVYLGR

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
82 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
83 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
89 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
171 2511231004 Pseudomonas sp. GM102 Isolate Nodule
172 2511231006 Pseudomonas sp. GM17 Isolate Nodule
173 2511231007 Pseudomonas sp. GM18 Isolate Nodule
174 2511231010 Pseudomonas sp. GM25 Isolate Nodule
175 2511231011 Pseudomonas sp. GM30 Isolate Nodule
176 2511231014 Pseudomonas sp. GM48 Isolate Nodule
177 2511231015 Pseudomonas sp. GM49 Isolate Nodule
178 2511231016 Pseudomonas sp. GM50 Isolate Nodule
179 2511231017 Pseudomonas sp. GM55 Isolate Nodule
180 2511231020 Pseudomonas sp. GM74 Isolate Nodule
181 2511231031 Pseudomonas sp. GM16 Isolate Nodule
182 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
183 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
184 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
185 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
186 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
187 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
188 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
189 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
190 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
191 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
192 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
193 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
194 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
195 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
196 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
197 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
198 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
199 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
200 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
201 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
202 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
203 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
204 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
205 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
206 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
207 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
208 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
209 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
210 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
211 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
212 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
213 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
214 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
215 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
216 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
217 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
218 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
219 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
220 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
221 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
222 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
223 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
224 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
225 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
226 2765235841 Pseudomonas putida AA7 Isolate Unclassified
227 2773857670 Pseudomonas sp. 478 Isolate Unclassified
228 2773857673 Pseudomonas sp. 443 Isolate Unclassified
229 2784132063 Pseudomonas sp. 424 Isolate Unclassified
230 2784132072 Pseudomonas sp. 460 Isolate Unclassified
231 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
232 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
233 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
234 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
235 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
236 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
237 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
238 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
239 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
240 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
241 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
242 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
243 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
244 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
245 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
246 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
247 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
248 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
249 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
250 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
251 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
252 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
253 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
254 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
255 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
256 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
257 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
258 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
259 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
260 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
261 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
262 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
263 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
264 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
265 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
266 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
267 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
268 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
269 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
270 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
271 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
272 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
273 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
274 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
275 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
276 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
277 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.1
Metatranscriptomes 0
Isolates 18.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.83
Nodule 2.12
Rhizoplane 5.65
Rhizosphere 67.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10021442 3300009011 Bacteria 3372
2 MRS2a_Contig_19 2124908027 Bacteria 54562
3 MRS2a_Contig_6878 2124908027 Bacteria 2434
4 JGI25162J39368_1000004 3300002737 Bacteria 441040
5 JGI25162J39368_1000065 3300002737 Bacteria 131083
6 JGI25163J39215_1000179 3300002771 Bacteria 24461
7 JGI25163J39215_1001093 3300002771 Bacteria 5591
8 JGI25164J39214_1000031 3300002772 Bacteria 144582
9 JGI25164J39214_1000038 3300002772 Bacteria 131082
10 JGI25165J46597_1000011 3300003214 Bacteria 441040
11 JGI25165J46597_1000126 3300003214 Bacteria 131083
12 Ga0055539_1000011 3300003752 Bacteria 399747
13 Ga0055533_1000014 3300003756 Bacteria 399747
14 Ga0055532_1000009 3300003758 Bacteria 399537
15 Ga0055525_1000016 3300003759 Bacteria 399724
16 Ga0055535_1008273 3300003761 Bacteria 1895
17 Ga0055536_1000025 3300003781 Bacteria 183172
18 Ga0055536_1000053 3300003781 Bacteria 110030
19 Ga0055530_10000007 3300003791 Bacteria 183172
20 Ga0055540_1000006 3300003792 Bacteria 372018
21 Ga0055540_1000125 3300003792 Bacteria 79312
22 Ga0055531_10000285 3300003794 Bacteria 51130
23 Ga0055531_10001653 3300003794 Bacteria 16091
24 Ga0055541_1000008 3300003841 Bacteria 399724
25 Ga0065714_10000048 3300005288 Bacteria 23148
26 Ga0065714_10003988 3300005288 Bacteria 6429
27 Ga0065714_10066486 3300005288 Bacteria 6765
28 Ga0065714_10082907 3300005288 Bacteria 2280
29 Ga0065704_10017516 3300005289 Bacteria 1935
30 Ga0070670_100000079 3300005331 Bacteria 92916
31 Ga0070670_100041986 3300005331 Bacteria 3931
32 Ga0070661_100000024 3300005344 Bacteria 121810
33 Ga0070669_100046216 3300005353 Bacteria 3175
34 Ga0070662_100014437 3300005457 Bacteria 5279
35 Ga0068853_100013644 3300005539 Bacteria 6639
36 Ga0070664_100000024 3300005564 Bacteria 94521
37 Ga0068851_10000552 3300005834 Bacteria 16293
38 Ga0075364_10027324 3300006051 Bacteria 3644
39 Ga0075432_10006128 3300006058 Bacteria 4089
40 Ga0075362_10042319 3300006177 Bacteria 2013
41 Ga0105251_10014381 3300009011 Bacteria 4377
42 Ga0105251_10017294 3300009011 Bacteria 3869
43 Ga0105244_10000907 3300009036 Bacteria 25017
44 Ga0105244_10005358 3300009036 Bacteria 8539
45 Ga0105244_10026725 3300009036 Bacteria 3120
46 Ga0105250_10000015 3300009092 Bacteria 262683
47 Ga0105250_10000679 3300009092 Bacteria 21367
48 Ga0105250_10014262 3300009092 Bacteria 3268
49 Ga0105250_10019315 3300009092 Bacteria 2755
50 Ga0105243_10000020 3300009148 Bacteria 214279
51 Ga0105243_10018786 3300009148 Bacteria 5237
52 Ga0105237_10000042 3300009545 Bacteria 181280
53 Ga0105246_10000641 3300011119 Bacteria 19535
54 Ga0157345_1000060 3300012498 Bacteria 23153
55 Ga0157373_10000998 3300013100 Bacteria 21885
56 Ga0157373_10001425 3300013100 Bacteria 18233
57 Ga0157373_10004083 3300013100 Bacteria 10998
58 Ga0157373_10005100 3300013100 Bacteria 9873
59 Ga0157373_10018779 3300013100 Bacteria 5031
60 Ga0157371_10000573 3300013102 Bacteria 43632
61 Ga0157371_10000635 3300013102 Bacteria 41753
62 Ga0157370_10032680 3300013104 Bacteria 5079
63 Ga0157370_10089265 3300013104 Bacteria 2896
64 Ga0157370_10090460 3300013104 Bacteria 2874
65 Ga0157369_10005158 3300013105 Bacteria 15288
66 Ga0157369_10019056 3300013105 Bacteria 7683
67 Ga0157369_10028514 3300013105 Bacteria 6179
68 Ga0163162_10000169 3300013306 Bacteria 60285
69 Ga0163162_10091282 3300013306 Bacteria 3128
70 Ga0157372_10004428 3300013307 Bacteria 14984
71 Ga0157375_10001060 3300013308 Bacteria 23747
72 Ga0157375_10004219 3300013308 Bacteria 12467
73 Ga0182008_10001212 3300014497 Bacteria 17765
74 Ga0182008_10001297 3300014497 Bacteria 17062
75 Ga0182008_10006321 3300014497 Bacteria 6635
76 Ga0182008_10033628 3300014497 Bacteria 2572
77 Ga0182006_1000387 3300015261 Bacteria 36363
78 Ga0182006_1004833 3300015261 Bacteria 6546
79 Ga0182006_1008799 3300015261 Bacteria 4564
80 Ga0182007_10000108 3300015262 Bacteria 57807
81 Ga0182007_10003756 3300015262 Bacteria 7084
82 Ga0182005_1000470 3300015265 Bacteria 20931
83 Ga0182005_1009368 3300015265 Bacteria 2848
84 Ga0163161_10001073 3300017792 Bacteria 20694
85 Ga0163161_10001353 3300017792 Bacteria 18230
86 Ga0163161_10011131 3300017792 Bacteria 6233
87 Ga0163161_10013542 3300017792 Bacteria 5678
88 Ga0163161_10100474 3300017792 Bacteria 2152
89 Ga0163161_10149631 3300017792 Bacteria 1773
90 Ga0209760_100032 3300025207 Bacteria 138015
91 Ga0209760_100036 3300025207 Bacteria 130845
92 Ga0209784_100023 3300025224 Bacteria 399841
93 Ga0209566_100019 3300025225 Bacteria 414836
94 Ga0209674_100034 3300025226 Bacteria 414903
95 Ga0209147_100027 3300025229 Bacteria 414610
96 Ga0209563_100037 3300025230 Bacteria 414903
97 Ga0209563_100298 3300025230 Bacteria 20216
98 Ga0207427_100003 3300025231 Bacteria 1035004
99 Ga0207427_100004 3300025231 Bacteria 939600
100 Ga0209437_100002 3300025233 Bacteria 1574801
101 Ga0209437_100025 3300025233 Bacteria 561333
102 Ga0209258_100166 3300025242 Bacteria 148022
103 Ga0209646_1000318 3300025246 Bacteria 37146
104 Ga0209677_100021 3300025253 Bacteria 414954
105 Ga0209233_1000004 3300025261 Bacteria 1574798
106 Ga0209233_1000145 3300025261 Bacteria 188955
107 Ga0209675_1004196 3300025291 Bacteria 6522
108 Ga0209676_1000002 3300025292 Bacteria 1732948
109 Ga0209676_1000003 3300025292 Bacteria 1454178
110 Ga0209676_1009390 3300025292 Bacteria 4223
111 Ga0209050_1000004 3300025298 Bacteria 1600040
112 Ga0209050_1000006 3300025298 Bacteria 1359702
113 Ga0209051_1000001 3300025303 Bacteria 1732974
114 Ga0209051_1000006 3300025303 Bacteria 1015785
115 Ga0209257_1000029 3300025304 Bacteria 695617
116 Ga0207656_10000769 3300025321 Bacteria 10514
117 Ga0207696_1000002 3300025711 Bacteria 1098043
118 Ga0207696_1000017 3300025711 Bacteria 491130
119 Ga0207696_1002160 3300025711 Bacteria 9859
120 Ga0207696_1012285 3300025711 Bacteria 3033
121 Ga0207655_1000074 3300025728 Bacteria 232056
122 Ga0207655_1000098 3300025728 Bacteria 190699
123 Ga0207655_1000410 3300025728 Bacteria 59117
124 Ga0207655_1002796 3300025728 Bacteria 13554
125 Ga0207655_1004728 3300025728 Bacteria 9515
126 Ga0207713_1000284 3300025735 Bacteria 58743
127 Ga0207713_1001602 3300025735 Bacteria 17673
128 Ga0207713_1006155 3300025735 Bacteria 7368
129 Ga0207671_10000474 3300025914 Bacteria 54456
130 Ga0207649_10000010 3300025920 Bacteria 284354
131 Ga0207681_10003542 3300025923 Bacteria 9722
132 Ga0207650_10000690 3300025925 Bacteria 26485
133 Ga0207706_10002181 3300025933 Bacteria 19100
134 Ga0207686_10011018 3300025934 Bacteria 4936
135 Ga0207709_10000004 3300025935 Bacteria 825156
136 Ga0207709_10004919 3300025935 Bacteria 7646
137 Ga0207679_10000022 3300025945 Bacteria 219036
138 Ga0207639_10028424 3300026041 Bacteria 4083
139 Ga0207428_10017939 3300027907 Bacteria 6063
140 Ga0307509_10153943 3300031507 Bacteria 2209
141 Ga0307405_10000080 3300031731 Bacteria 40630
142 Ga0307510_10003671 3300033180 Bacteria 17922
143 Ga0237819_01218 3300038705 Bacteria 7150
144 Ga0450894_002004 3300042131 Bacteria 2805
145 Ga0450893_0001169 3300042532 Bacteria 3957
146 Ga0495617_040974 3300046452 Bacteria 1548
147 Ga0495627_000031 3300046453 Bacteria 226981
148 Ga0495627_001436 3300046453 Bacteria 13990
149 Ga0495627_003204 3300046453 Bacteria 7362
150 Ga0495592_0033025 3300046454 Bacteria 3904
151 Ga0495603_0045443 3300046455 Bacteria 2619
152 Ga0495603_0073564 3300046455 Bacteria 2008
153 Ga0495590_0000177 3300046457 Bacteria 37380
154 Ga0495590_0006098 3300046457 Bacteria 4726
155 Ga0495590_0011110 3300046457 Bacteria 3374
156 Ga0495590_0021801 3300046457 Bacteria 2268
157 Ga0495591_000465 3300046458 Bacteria 32374
158 Ga0495591_001420 3300046458 Bacteria 14941
159 Ga0495591_008150 3300046458 Bacteria 4325
160 Ga0495591_010354 3300046458 Bacteria 3622
161 Ga0495591_011419 3300046458 Bacteria 3365
162 Ga0495591_013829 3300046458 Bacteria 2931
163 Ga0495638_0027594 3300046460 Bacteria 3673
164 Ga0495638_0045916 3300046460 Bacteria 2746
165 Ga0495653_0000652 3300046463 Bacteria 26457
166 Ga0495653_0002131 3300046463 Bacteria 15606
167 Ga0495653_0004505 3300046463 Bacteria 11249
168 Ga0495653_0044480 3300046463 Bacteria 3445
169 Ga0495650_0003897 3300046471 Bacteria 10547
170 Ga0495650_0004343 3300046471 Bacteria 9772
171 Ga0495650_0007351 3300046471 Bacteria 6636
172 Ga0495650_0009484 3300046471 Bacteria 5527
173 Ga0495605_0000007 3300046474 Bacteria 358289
174 Ga0495605_0009605 3300046474 Bacteria 5433
175 Ga0495605_0012878 3300046474 Bacteria 4629
176 Ga0495605_0033159 3300046474 Bacteria 2623
177 Ga0495605_0035556 3300046474 Bacteria 2517
178 Ga0495639_0000053 3300046475 Bacteria 50537
179 Ga0495639_0017907 3300046475 Bacteria 3079
180 Ga0495584_0003352 3300046491 Bacteria 8847
181 Ga0495585_0010781 3300046492 Bacteria 5430
182 Ga0495585_0012153 3300046492 Bacteria 5077
183 Ga0495585_0012829 3300046492 Bacteria 4927
184 Ga0495585_0023387 3300046492 Bacteria 3546
185 Ga0495594_0005932 3300046499 Bacteria 6279
186 Ga0495594_0026324 3300046499 Bacteria 3128
187 Ga0495607_0000041 3300046501 Bacteria 132443
188 Ga0495607_0004345 3300046501 Bacteria 10459
189 Ga0495607_0006048 3300046501 Bacteria 8568
190 Ga0495607_0007191 3300046501 Bacteria 7732
191 Ga0495607_0007368 3300046501 Bacteria 7618
192 Ga0495607_0047798 3300046501 Bacteria 2504
193 Ga0495583_0000007 3300046506 Bacteria 434661
194 Ga0495583_0000865 3300046506 Bacteria 36805
195 Ga0495583_0009853 3300046506 Bacteria 5653
196 Ga0495583_0021031 3300046506 Bacteria 3362
197 Ga0495606_0008267 3300046507 Bacteria 9081
198 Ga0495606_0011945 3300046507 Bacteria 7018
199 Ga0495606_0013688 3300046507 Bacteria 6390
200 Ga0495606_0017591 3300046507 Bacteria 5396
201 Ga0495606_0018634 3300046507 Bacteria 5196
202 Ga0495606_0035935 3300046507 Bacteria 3381
203 Ga0495606_0068317 3300046507 Bacteria 2248
204 Ga0495606_0084441 3300046507 Bacteria 1966
205 Ga0495610_0000455 3300046512 Bacteria 42440
206 Ga0495610_0005087 3300046512 Bacteria 9475
207 Ga0495610_0007848 3300046512 Bacteria 7020
208 Ga0495610_0016320 3300046512 Bacteria 4282
209 Ga0495616_0000535 3300046513 Bacteria 28683
210 Ga0495616_0001570 3300046513 Bacteria 15739
211 Ga0495616_0008441 3300046513 Bacteria 6101
212 Ga0495616_0016806 3300046513 Bacteria 4043
213 Ga0495620_0000014 3300046515 Bacteria 157890
214 Ga0495620_0001722 3300046515 Bacteria 12919
215 Ga0495620_0005771 3300046515 Bacteria 6877
216 Ga0495620_0009689 3300046515 Bacteria 5113
217 Ga0495620_0011670 3300046515 Bacteria 4572
218 Ga0495620_0021661 3300046515 Bacteria 3117
219 Ga0495631_0000175 3300046518 Bacteria 43711
220 Ga0495631_0000526 3300046518 Bacteria 25725
221 Ga0495631_0005882 3300046518 Bacteria 6391
222 Ga0495632_0005275 3300046519 Bacteria 8585
223 Ga0495632_0006774 3300046519 Bacteria 7316
224 Ga0495632_0014815 3300046519 Bacteria 4397
225 Ga0495632_0022997 3300046519 Bacteria 3334
226 Ga0495632_0038757 3300046519 Bacteria 2411
227 Ga0495637_0000606 3300046520 Bacteria 25539
228 Ga0495637_0005923 3300046520 Bacteria 6178
229 Ga0495637_0008614 3300046520 Bacteria 5004
230 Ga0495637_0031082 3300046520 Bacteria 2364
231 Ga0495637_0040047 3300046520 Bacteria 2019
232 Ga0495643_0007055 3300046522 Bacteria 7295
233 Ga0495648_0002500 3300046524 Bacteria 16867
234 Ga0495648_0002645 3300046524 Bacteria 16251
235 Ga0495648_0006335 3300046524 Bacteria 9679
236 Ga0495648_0035018 3300046524 Bacteria 3259
237 Ga0495666_0000908 3300046526 Bacteria 13883
238 Ga0495666_0014730 3300046526 Bacteria 3890
239 Ga0495666_0038491 3300046526 Bacteria 2325
240 Ga0495642_0000006 3300046528 Bacteria 172412
241 Ga0495642_0001263 3300046528 Bacteria 11491
242 Ga0495654_0000113 3300046530 Bacteria 91858
243 Ga0495654_0000600 3300046530 Bacteria 28665
244 Ga0495654_0010655 3300046530 Bacteria 4993
245 Ga0495654_0013825 3300046530 Bacteria 4308
246 Ga0495654_0024549 3300046530 Bacteria 3112
247 Ga0495654_0025610 3300046530 Bacteria 3038
248 Ga0495654_0052890 3300046530 Bacteria 1975
249 Ga0495587_0003803 3300046536 Bacteria 10014
250 Ga0495587_0022533 3300046536 Bacteria 3878
251 Ga0495609_0000004 3300046538 Bacteria 697346
252 Ga0495609_0001070 3300046538 Bacteria 19166
253 Ga0495609_0001936 3300046538 Bacteria 13176
254 Ga0495609_0002104 3300046538 Bacteria 12506
255 Ga0495609_0010540 3300046538 Bacteria 4432
256 Ga0495609_0041417 3300046538 Bacteria 2070
257 Ga0495597_0000800 3300046542 Bacteria 24862
258 Ga0495597_0004858 3300046542 Bacteria 7242
259 Ga0495597_0019818 3300046542 Bacteria 3141
260 Ga0495645_0013497 3300046543 Bacteria 5777
261 Ga0495622_0000414 3300046557 Bacteria 28333
262 Ga0495622_0002204 3300046557 Bacteria 9500
263 Ga0495622_0004607 3300046557 Bacteria 6385
264 Ga0495622_0005482 3300046557 Bacteria 5884
265 Ga0495622_0009125 3300046557 Bacteria 4591
266 Ga0495622_0028463 3300046557 Bacteria 2610
267 Ga0495622_0028748 3300046557 Bacteria 2597
268 Ga0495633_0000051 3300046558 Bacteria 154944
269 Ga0495633_0003219 3300046558 Bacteria 11022
270 Ga0495633_0009087 3300046558 Bacteria 5523
271 Ga0495634_0000815 3300046642 Bacteria 30341
272 Ga0495634_0016683 3300046642 Bacteria 5247
273 Ga0495611_0000019 3300046648 Bacteria 126076
274 Ga0495611_0001208 3300046648 Bacteria 13357
275 Ga0495611_0013578 3300046648 Bacteria 3470
276 Ga0495611_0015109 3300046648 Bacteria 3299
277 Ga0495625_0004063 3300046660 Bacteria 13985
278 Ga0495625_0037273 3300046660 Bacteria 3568
279 Ga0495625_0061295 3300046660 Bacteria 2662
280 Ga0495635_0021217 3300046663 Bacteria 4527
281 Ga0495659_0000119 3300046664 Bacteria 34751
282 Ga0495659_0011088 3300046664 Bacteria 2903
283 Ga0495661_0000051 3300046665 Bacteria 140353
284 Ga0495661_0000106 3300046665 Bacteria 100351
285 Ga0495661_0000269 3300046665 Bacteria 59794
286 Ga0495661_0005371 3300046665 Bacteria 9110
287 Ga0495661_0021312 3300046665 Bacteria 4226
288 Ga0495661_0025310 3300046665 Bacteria 3834
289 Ga0495661_0053080 3300046665 Bacteria 2440
290 Ga0495588_0002024 3300046674 Bacteria 8670
291 Ga0495588_0010121 3300046674 Bacteria 4375
292 Ga0495623_0002773 3300046679 Bacteria 11575
293 Ga0495623_0043682 3300046679 Bacteria 2850
294 Ga0495646_0003495 3300046680 Bacteria 9782
295 Ga0495646_0012535 3300046680 Bacteria 5388
296 Ga0495669_0001087 3300046684 Bacteria 11253
297 Ga0495669_0006622 3300046684 Bacteria 4847
298 Ga0495613_0011601 3300046689 Bacteria 6548
299 Ga0495613_0030414 3300046689 Bacteria 4011
300 Ga0495613_0055646 3300046689 Bacteria 2906
301 Ga0495624_0000237 3300046690 Bacteria 43145
302 Ga0495670_0000455 3300046691 Bacteria 19525
303 Ga0495670_0009962 3300046691 Bacteria 4671
304 Ga0495670_0011994 3300046691 Bacteria 4265
305 Ga0495671_0003398 3300046692 Bacteria 9791
306 Ga0495671_0032538 3300046692 Bacteria 2662
307 Ga0495671_0032766 3300046692 Bacteria 2651
308 Ga0495671_0084764 3300046692 Bacteria 1553
309 Ga0495649_0000748 3300046694 Bacteria 26199
310 Ga0495649_0002964 3300046694 Bacteria 11692
311 Ga0495649_0005325 3300046694 Bacteria 8208
312 Ga0495649_0008177 3300046694 Bacteria 6307
313 Ga0495649_0013818 3300046694 Bacteria 4646
314 Ga0495649_0047309 3300046694 Bacteria 2339
315 Ga0495589_0000352 3300046794 Bacteria 35927
316 Ga0495589_0006145 3300046794 Bacteria 6344
317 Ga0495589_0013758 3300046794 Bacteria 4173
318 Ga0495589_0025278 3300046794 Bacteria 3014
319 Ga0495589_0038113 3300046794 Bacteria 2407
320 Ga0495600_0004310 3300046809 Bacteria 8515
321 Ga0495660_0007793 3300046810 Bacteria 6287
322 Ga0495660_0007922 3300046810 Bacteria 6239
323 Ga0495660_0008057 3300046810 Bacteria 6191
324 Ga0495660_0010141 3300046810 Bacteria 5476
325 Ga0495660_0034391 3300046810 Bacteria 2836
326 Ga0495660_0035725 3300046810 Bacteria 2775
327 Ga0495581_0019171 3300047315 Bacteria 3970
328 Ga0495674_0009374 3300047319 Bacteria 9306
329 Ga0495672_0000787 3300047320 Bacteria 34376
330 Ga0495672_0002413 3300047320 Bacteria 17233
331 Ga0495672_0003332 3300047320 Bacteria 13842
332 Ga0495672_0011707 3300047320 Bacteria 6169
333 Ga0495672_0016106 3300047320 Bacteria 5051
334 Ga0495672_0018130 3300047320 Bacteria 4685
335 Ga0495672_0018826 3300047320 Bacteria 4573
336 Ga0495672_0021016 3300047320 Bacteria 4263
337 Ga0495672_0028393 3300047320 Bacteria 3541
338 Ga0495676_0000368 3300047321 Bacteria 37132
339 Ga0495676_0001439 3300047321 Bacteria 20535
340 Ga0495676_0017594 3300047321 Bacteria 6315
341 Ga0495680_0055415 3300047322 Bacteria 3075
342 Ga0495680_0095154 3300047322 Bacteria 2227
343 Ga0495680_0110240 3300047322 Bacteria 2040
344 Ga0495683_0000004 3300047323 Bacteria 321136
345 Ga0495683_0000318 3300047323 Bacteria 40455
346 Ga0495683_0000356 3300047323 Bacteria 37720
347 Ga0495683_0006570 3300047323 Bacteria 6343
348 Ga0495683_0011260 3300047323 Bacteria 4711
349 Ga0495683_0023149 3300047323 Bacteria 3193
350 Ga0495683_0027136 3300047323 Bacteria 2929
351 Ga0495683_0041126 3300047323 Bacteria 2333
352 Ga0495687_000977 3300047443 Bacteria 28996
353 Ga0495687_007915 3300047443 Bacteria 6176
354 Ga0495679_000137 3300047446 Bacteria 65769
355 Ga0495679_000171 3300047446 Bacteria 58736
356 Ga0495679_004040 3300047446 Bacteria 6890
357 Ga0495679_004206 3300047446 Bacteria 6701
358 Ga0495679_009192 3300047446 Bacteria 3972
359 Ga0495673_0001451 3300047469 Bacteria 18852
360 Ga0495673_0005021 3300047469 Bacteria 8115
361 Ga0495673_0006444 3300047469 Bacteria 6896
362 Ga0495673_0013259 3300047469 Bacteria 4337
363 Ga0495673_0015824 3300047469 Bacteria 3874
364 Ga0495673_0016735 3300047469 Bacteria 3741
365 Ga0495681_0000478 3300047470 Bacteria 30665
366 Ga0495681_0002364 3300047470 Bacteria 13536
367 Ga0495681_0005548 3300047470 Bacteria 8428
368 Ga0495681_0011741 3300047470 Bacteria 5190
369 Ga0495681_0011854 3300047470 Bacteria 5158
370 Ga0495681_0012026 3300047470 Bacteria 5108
371 Ga0495681_0026819 3300047470 Bacteria 2990
372 Ga0495681_0028170 3300047470 Bacteria 2894
373 Ga0495684_0007118 3300047471 Bacteria 8682
374 Ga0495684_0010777 3300047471 Bacteria 7065
375 Ga0495686_0003002 3300047472 Bacteria 14995
376 Ga0495686_0014588 3300047472 Bacteria 5404
377 Ga0495593_0001207 3300047673 Bacteria 15111
378 Ga0495593_0016466 3300047673 Bacteria 4168
379 Ga0495593_0026775 3300047673 Bacteria 3180
380 Ga0495593_0034451 3300047673 Bacteria 2754
381 Ga0495593_0073381 3300047673 Bacteria 1775
382 Ga0495602_0003908 3300048088 Bacteria 15513
383 Ga0495626_0000064 3300048091 Bacteria 142060
384 Ga0495626_0000616 3300048091 Bacteria 34739
385 Ga0495626_0000958 3300048091 Bacteria 25047
386 Ga0495626_0007427 3300048091 Bacteria 6104
387 Ga0495626_0029031 3300048091 Bacteria 2679
388 Ga0496102_0000774 3300048905 Bacteria 31153
389 Ga0496103_0033811 3300048906 Bacteria 3124
390 Ga0496104_0244380 3300048907 Bacteria 1707
391 Ga0496105_0147565 3300048908 Bacteria 1934
392 Ga0496106_0102144 3300048909 Bacteria 2224
393 Ga0496116_0000382 3300048919 Bacteria 65862
394 Ga0496116_0002706 3300048919 Bacteria 18251
395 Ga0496116_0008609 3300048919 Bacteria 8828
396 Ga0496116_0009233 3300048919 Bacteria 8439
397 Ga0496116_0054568 3300048919 Bacteria 2631
398 Ga0496117_0007085 3300048920 Bacteria 11081
399 Ga0496117_0022162 3300048920 Bacteria 5101
400 Ga0496117_0037737 3300048920 Bacteria 3594
401 Ga0496117_0048903 3300048920 Bacteria 3014
402 Ga0496117_0053943 3300048920 Bacteria 2820
403 Ga0496117_0057377 3300048920 Bacteria 2705
404 Ga0496118_0009595 3300048921 Bacteria 9742
405 Ga0496118_0018594 3300048921 Bacteria 6257
406 Ga0496118_0027819 3300048921 Bacteria 4775
407 Ga0496118_0029914 3300048921 Bacteria 4557
408 Ga0496118_0037697 3300048921 Bacteria 3886
409 Ga0496118_0044807 3300048921 Bacteria 3460
410 Ga0496119_0013764 3300048922 Bacteria 6406
411 Ga0496119_0019342 3300048922 Bacteria 5021
412 Ga0496120_0009871 3300048923 Bacteria 6724
413 Ga0496120_0011884 3300048923 Bacteria 5956
414 Ga0496120_0013171 3300048923 Bacteria 5581
415 Ga0496120_0051741 3300048923 Bacteria 2343
416 Ga0496121_0000589 3300048924 Bacteria 68077
417 Ga0496121_0001708 3300048924 Bacteria 35986
418 Ga0496121_0014964 3300048924 Bacteria 8172
419 Ga0496121_0032565 3300048924 Bacteria 4735
420 Ga0496121_0068490 3300048924 Bacteria 2870
421 Ga0496121_0105614 3300048924 Bacteria 2161
422 Ga0496122_0011011 3300048925 Bacteria 9241
423 Ga0496122_0020192 3300048925 Bacteria 6037
424 Ga0496122_0041565 3300048925 Bacteria 3632
425 Ga0496122_0043894 3300048925 Bacteria 3497
426 Ga0496122_0051450 3300048925 Bacteria 3129
427 Ga0496122_0093534 3300048925 Bacteria 2038
428 Ga0496123_0003547 3300048926 Bacteria 17321
429 Ga0496123_0017509 3300048926 Bacteria 5759
430 Ga0496123_0027501 3300048926 Bacteria 4234
431 Ga0496123_0036587 3300048926 Bacteria 3479
432 Ga0496123_0042638 3300048926 Bacteria 3128
433 Ga0496123_0059533 3300048926 Bacteria 2468
434 Ga0496123_0074914 3300048926 Bacteria 2091
435 Ga0496124_0004348 3300048927 Bacteria 16595
436 Ga0496124_0007542 3300048927 Bacteria 11542
437 Ga0496124_0018066 3300048927 Bacteria 6620
438 Ga0496124_0056531 3300048927 Bacteria 3308
439 Ga0496124_0072065 3300048927 Bacteria 2862
440 Ga0496124_0102748 3300048927 Bacteria 2312
441 Ga0496125_0000641 3300048928 Bacteria 58364
442 Ga0496125_0004187 3300048928 Bacteria 16817
443 Ga0496125_0009776 3300048928 Bacteria 9780
444 Ga0496125_0019631 3300048928 Bacteria 6367
445 Ga0496125_0028884 3300048928 Bacteria 4996
446 Ga0496125_0045691 3300048928 Bacteria 3681
447 Ga0496125_0046986 3300048928 Bacteria 3615
448 Ga0496125_0072651 3300048928 Bacteria 2679
449 Ga0496126_0008374 3300048929 Bacteria 11157
450 Ga0496126_0134535 3300048929 Bacteria 2133
451 Ga0495678_000014 3300049459 Bacteria 313755
452 Ga0495678_000578 3300049459 Bacteria 34746
453 Ga0495678_008704 3300049459 Bacteria 5091
454 Ga0495682_0001018 3300049460 Bacteria 16623
455 Ga0495682_0006818 3300049460 Bacteria 4598
456 Ga0495682_0014656 3300049460 Bacteria 2971
457 Ga0495682_0029320 3300049460 Bacteria 2038
458 nmdc:mga03683_8680_c1 3300050489 Bacteria 3582
459 Ga0500572_000710 3300053111 Bacteria 10800
460 2511255179 2511231004 Bacteria 6669789
461 2511265495 2511231006 Bacteria 6794709
462 2511271807 2511231007 Bacteria 6306603
463 2511288053 2511231010 Bacteria 6373152
464 2511298697 2511231011 Bacteria 6149768
465 2511312483 2511231014 Bacteria 6462302
466 2511321307 2511231015 Bacteria 6598026
467 2511329403 2511231016 Bacteria 6704427
468 2511334575 2511231017 Bacteria 6503007
469 2511351794 2511231020 Bacteria 6115223
470 2511411654 2511231031 Bacteria 6558529
471 2555670022 2554235341 Bacteria 6867980
472 2597863936 2597489888 Bacteria 6179543
473 2599352942 2599185160 Bacteria 6844013
474 2599359294 2599185161 Bacteria 6960462
475 2599365185 2599185162 Bacteria 6957254
476 2599371988 2599185163 Bacteria 6995158
477 2599378050 2599185164 Bacteria 6841688
478 2599384573 2599185165 Bacteria 6843250
479 2599390846 2599185166 Bacteria 6959206
480 2599398333 2599185167 Bacteria 6353609
481 2599403031 2599185168 Bacteria 6997636
482 2599450355 2599185179 Bacteria 6611171
483 2599459776 2599185181 Bacteria 6844519
484 2599465878 2599185182 Bacteria 6883168
485 2599488797 2599185186 Bacteria 6831633
486 2599507371 2599185189 Bacteria 5862825
487 2599512837 2599185190 Bacteria 6285678
488 2599522143 2599185191 Bacteria 6297582
489 2599881327 2599185288 Bacteria 6666191
490 2599891514 2599185290 Bacteria 6289611
491 2599946653 2599185303 Bacteria 6512725
492 2600212383 2599185356 Bacteria 6843884
493 2601691877 2600255296 Bacteria 5784754
494 2601772551 2600255313 Bacteria 6842543
495 2601798968 2600255318 Bacteria 6383414
496 2606077864 2603880185 Bacteria 6379190
497 2606129961 2603880199 Bacteria 6377649
498 2621299896 2619619299 Bacteria 6649820
499 2624480910 2623620443 Bacteria 6427864
500 2624492215 2623620446 Bacteria 6500345
501 2643874220 2643221571 Bacteria 6228673
502 2644620206 2643221713 Bacteria 6554480
503 2671095474 2667528171 Bacteria 6900659
504 2677896547 2675903420 Bacteria 6247433
505 2715756963 2713897149 Bacteria 6506249
506 2723248724 2721755607 Bacteria 5841722
507 2738669893 2738541265 Bacteria 6594665
508 2738748286 2738541282 Bacteria 6593925
509 2738806844 2738541294 Bacteria 6925949
510 2738857328 2738541303 Bacteria 6591772
511 2738894204 2738541309 Bacteria 6926455
512 2739197524 2738543004 Bacteria 6381073
513 2739258759 2738543015 Bacteria 6750701
514 2739311830 2738543025 Bacteria 6600348
515 2765584025 2765235841 Bacteria 6137024
516 2774122513 2773857670 Bacteria 6407454
517 2774133712 2773857673 Bacteria 6513460
518 2784264527 2784132063 Bacteria 6262788
519 2784314654 2784132072 Bacteria 6596533
520 2808929139 2808606377 Bacteria 6646337
521 2808951260 2808606381 Bacteria 6646461
522 2808979109 2808606385 Bacteria 6711065
523 2808995008 2808606388 Bacteria 6706662
524 2817491189 2816332298 Bacteria 6852809
525 2819658807 2818991456 Bacteria 6123676
526 2819701049 2818991464 Bacteria 6907494
527 2834034028 2834028612 Bacteria 6354979
528 2842826945 2842826826 Bacteria 5974129
529 2842839284 2842837860 Bacteria 6066181
530 2844670649 2844665904 Bacteria 6817974
531 2852614447 2852612431 Bacteria 6885235
532 2852662055 2852657418 Bacteria 6472974
533 2852667815 2852667396 Bacteria 6885555
534 2860342763 2860339153 Bacteria 6846989
535 2878032842 2878029506 Bacteria 6418441
536 2880233417 2880230671 Bacteria 6140320
537 2904520221 2904518522 Bacteria 6068986
538 2904552452 2904550169 Bacteria 6221258
539 2908449749 2908446538 Bacteria 6829095
540 2917073845 2917070673 Bacteria 6868303
541 2919064863 2919063839 Bacteria 6302690
542 2919460664 2919456309 Bacteria 6586567
543 2919698401 2919697872 Bacteria 6553725
544 2929192615 2929189879 Bacteria 5930554
545 2931393999 2931390751 Bacteria 6273349
546 2935357100 2935353572 Unclassified 6955622
547 2945933470 2945928738 Bacteria 6053221
548 2945963423 2945961074 Bacteria 7342064
549 2946009776 2946006987 Bacteria 6705746
550 2969307623 2969304461 Bacteria 6601805
551 2984289459 2984286254 Bacteria 6702062
552 3007624039 3007619802 Bacteria 6411688
553 3007719866 3007718800 Bacteria 5971527
554 637320390 637000220 Bacteria 7074893
555 8019773209 8019769354 Bacteria 6924660
556 8019779170 8019775933 Bacteria 6858656
557 8054286653 8054285046 Bacteria 6919322
558 8054352282 8054347763 Bacteria 5901107
559 8054506369 8054503363 Bacteria 6101651
560 8054932682 8054929484 Bacteria 5599761
561 8055821118 8055817908 Bacteria 6609162
562 8056134801 8056131705 Bacteria 6107031
563 8056166073 8056161164 Bacteria 6106669
564 8056174277 8056172158 Bacteria 6133900
565 8056573864 8056569372 Bacteria 5997322
566 8057800534 8057798959 Bacteria 6713499
567 Ga0105251_10021442
568 MRS2a_Contig_19
569 MRS2a_Contig_6878
570 JGI25162J39368_1000004
571 JGI25162J39368_1000065
572 JGI25163J39215_1000179
573 JGI25163J39215_1001093
574 JGI25164J39214_1000031
575 JGI25164J39214_1000038
576 JGI25165J46597_1000011
577 JGI25165J46597_1000126
578 Ga0055539_1000011
579 Ga0055533_1000014
580 Ga0055532_1000009
581 Ga0055525_1000016
582 Ga0055535_1008273
583 Ga0055536_1000025
584 Ga0055536_1000053
585 Ga0055530_10000007
586 Ga0055540_1000006
587 Ga0055540_1000125
588 Ga0055531_10000285
589 Ga0055531_10001653
590 Ga0055541_1000008
591 Ga0065714_10000048
592 Ga0065714_10003988
593 Ga0065714_10066486
594 Ga0065714_10082907
595 Ga0065704_10017516
596 Ga0070670_100000079
597 Ga0070670_100041986
598 Ga0070661_100000024
599 Ga0070669_100046216
600 Ga0070662_100014437
601 Ga0068853_100013644
602 Ga0070664_100000024
603 Ga0068851_10000552
604 Ga0075364_10027324
605 Ga0075432_10006128
606 Ga0075362_10042319
607 Ga0105251_10014381
608 Ga0105251_10017294
609 Ga0105244_10000907
610 Ga0105244_10005358
611 Ga0105244_10026725
612 Ga0105250_10000015
613 Ga0105250_10000679
614 Ga0105250_10014262
615 Ga0105250_10019315
616 Ga0105243_10000020
617 Ga0105243_10018786
618 Ga0105237_10000042
619 Ga0105246_10000641
620 Ga0157345_1000060
621 Ga0157373_10000998
622 Ga0157373_10001425
623 Ga0157373_10004083
624 Ga0157373_10005100
625 Ga0157373_10018779
626 Ga0157371_10000573
627 Ga0157371_10000635
628 Ga0157370_10032680
629 Ga0157370_10089265
630 Ga0157370_10090460
631 Ga0157369_10005158
632 Ga0157369_10019056
633 Ga0157369_10028514
634 Ga0163162_10000169
635 Ga0163162_10091282
636 Ga0157372_10004428
637 Ga0157375_10001060
638 Ga0157375_10004219
639 Ga0182008_10001212
640 Ga0182008_10001297
641 Ga0182008_10006321
642 Ga0182008_10033628
643 Ga0182006_1000387
644 Ga0182006_1004833
645 Ga0182006_1008799
646 Ga0182007_10000108
647 Ga0182007_10003756
648 Ga0182005_1000470
649 Ga0182005_1009368
650 Ga0163161_10001073
651 Ga0163161_10001353
652 Ga0163161_10011131
653 Ga0163161_10013542
654 Ga0163161_10100474
655 Ga0163161_10149631
656 Ga0209760_100032
657 Ga0209760_100036
658 Ga0209784_100023
659 Ga0209566_100019
660 Ga0209674_100034
661 Ga0209147_100027
662 Ga0209563_100037
663 Ga0209563_100298
664 Ga0207427_100003
665 Ga0207427_100004
666 Ga0209437_100002
667 Ga0209437_100025
668 Ga0209258_100166
669 Ga0209646_1000318
670 Ga0209677_100021
671 Ga0209233_1000004
672 Ga0209233_1000145
673 Ga0209675_1004196
674 Ga0209676_1000002
675 Ga0209676_1000003
676 Ga0209676_1009390
677 Ga0209050_1000004
678 Ga0209050_1000006
679 Ga0209051_1000001
680 Ga0209051_1000006
681 Ga0209257_1000029
682 Ga0207656_10000769
683 Ga0207696_1000002
684 Ga0207696_1000017
685 Ga0207696_1002160
686 Ga0207696_1012285
687 Ga0207655_1000074
688 Ga0207655_1000098
689 Ga0207655_1000410
690 Ga0207655_1002796
691 Ga0207655_1004728
692 Ga0207713_1000284
693 Ga0207713_1001602
694 Ga0207713_1006155
695 Ga0207671_10000474
696 Ga0207649_10000010
697 Ga0207681_10003542
698 Ga0207650_10000690
699 Ga0207706_10002181
700 Ga0207686_10011018
701 Ga0207709_10000004
702 Ga0207709_10004919
703 Ga0207679_10000022
704 Ga0207639_10028424
705 Ga0207428_10017939
706 Ga0307509_10153943
707 Ga0307405_10000080
708 Ga0307510_10003671
709 Ga0237819_01218
710 Ga0450894_002004
711 Ga0450893_0001169
712 Ga0495617_040974
713 Ga0495627_000031
714 Ga0495627_001436
715 Ga0495627_003204
716 Ga0495592_0033025
717 Ga0495603_0045443
718 Ga0495603_0073564
719 Ga0495590_0000177
720 Ga0495590_0006098
721 Ga0495590_0011110
722 Ga0495590_0021801
723 Ga0495591_000465
724 Ga0495591_001420
725 Ga0495591_008150
726 Ga0495591_010354
727 Ga0495591_011419
728 Ga0495591_013829
729 Ga0495638_0027594
730 Ga0495638_0045916
731 Ga0495653_0000652
732 Ga0495653_0002131
733 Ga0495653_0004505
734 Ga0495653_0044480
735 Ga0495650_0003897
736 Ga0495650_0004343
737 Ga0495650_0007351
738 Ga0495650_0009484
739 Ga0495605_0000007
740 Ga0495605_0009605
741 Ga0495605_0012878
742 Ga0495605_0033159
743 Ga0495605_0035556
744 Ga0495639_0000053
745 Ga0495639_0017907
746 Ga0495584_0003352
747 Ga0495585_0010781
748 Ga0495585_0012153
749 Ga0495585_0012829
750 Ga0495585_0023387
751 Ga0495594_0005932
752 Ga0495594_0026324
753 Ga0495607_0000041
754 Ga0495607_0004345
755 Ga0495607_0006048
756 Ga0495607_0007191
757 Ga0495607_0007368
758 Ga0495607_0047798
759 Ga0495583_0000007
760 Ga0495583_0000865
761 Ga0495583_0009853
762 Ga0495583_0021031
763 Ga0495606_0008267
764 Ga0495606_0011945
765 Ga0495606_0013688
766 Ga0495606_0017591
767 Ga0495606_0018634
768 Ga0495606_0035935
769 Ga0495606_0068317
770 Ga0495606_0084441
771 Ga0495610_0000455
772 Ga0495610_0005087
773 Ga0495610_0007848
774 Ga0495610_0016320
775 Ga0495616_0000535
776 Ga0495616_0001570
777 Ga0495616_0008441
778 Ga0495616_0016806
779 Ga0495620_0000014
780 Ga0495620_0001722
781 Ga0495620_0005771
782 Ga0495620_0009689
783 Ga0495620_0011670
784 Ga0495620_0021661
785 Ga0495631_0000175
786 Ga0495631_0000526
787 Ga0495631_0005882
788 Ga0495632_0005275
789 Ga0495632_0006774
790 Ga0495632_0014815
791 Ga0495632_0022997
792 Ga0495632_0038757
793 Ga0495637_0000606
794 Ga0495637_0005923
795 Ga0495637_0008614
796 Ga0495637_0031082
797 Ga0495637_0040047
798 Ga0495643_0007055
799 Ga0495648_0002500
800 Ga0495648_0002645
801 Ga0495648_0006335
802 Ga0495648_0035018
803 Ga0495666_0000908
804 Ga0495666_0014730
805 Ga0495666_0038491
806 Ga0495642_0000006
807 Ga0495642_0001263
808 Ga0495654_0000113
809 Ga0495654_0000600
810 Ga0495654_0010655
811 Ga0495654_0013825
812 Ga0495654_0024549
813 Ga0495654_0025610
814 Ga0495654_0052890
815 Ga0495587_0003803
816 Ga0495587_0022533
817 Ga0495609_0000004
818 Ga0495609_0001070
819 Ga0495609_0001936
820 Ga0495609_0002104
821 Ga0495609_0010540
822 Ga0495609_0041417
823 Ga0495597_0000800
824 Ga0495597_0004858
825 Ga0495597_0019818
826 Ga0495645_0013497
827 Ga0495622_0000414
828 Ga0495622_0002204
829 Ga0495622_0004607
830 Ga0495622_0005482
831 Ga0495622_0009125
832 Ga0495622_0028463
833 Ga0495622_0028748
834 Ga0495633_0000051
835 Ga0495633_0003219
836 Ga0495633_0009087
837 Ga0495634_0000815
838 Ga0495634_0016683
839 Ga0495611_0000019
840 Ga0495611_0001208
841 Ga0495611_0013578
842 Ga0495611_0015109
843 Ga0495625_0004063
844 Ga0495625_0037273
845 Ga0495625_0061295
846 Ga0495635_0021217
847 Ga0495659_0000119
848 Ga0495659_0011088
849 Ga0495661_0000051
850 Ga0495661_0000106
851 Ga0495661_0000269
852 Ga0495661_0005371
853 Ga0495661_0021312
854 Ga0495661_0025310
855 Ga0495661_0053080
856 Ga0495588_0002024
857 Ga0495588_0010121
858 Ga0495623_0002773
859 Ga0495623_0043682
860 Ga0495646_0003495
861 Ga0495646_0012535
862 Ga0495669_0001087
863 Ga0495669_0006622
864 Ga0495613_0011601
865 Ga0495613_0030414
866 Ga0495613_0055646
867 Ga0495624_0000237
868 Ga0495670_0000455
869 Ga0495670_0009962
870 Ga0495670_0011994
871 Ga0495671_0003398
872 Ga0495671_0032538
873 Ga0495671_0032766
874 Ga0495671_0084764
875 Ga0495649_0000748
876 Ga0495649_0002964
877 Ga0495649_0005325
878 Ga0495649_0008177
879 Ga0495649_0013818
880 Ga0495649_0047309
881 Ga0495589_0000352
882 Ga0495589_0006145
883 Ga0495589_0013758
884 Ga0495589_0025278
885 Ga0495589_0038113
886 Ga0495600_0004310
887 Ga0495660_0007793
888 Ga0495660_0007922
889 Ga0495660_0008057
890 Ga0495660_0010141
891 Ga0495660_0034391
892 Ga0495660_0035725
893 Ga0495581_0019171
894 Ga0495674_0009374
895 Ga0495672_0000787
896 Ga0495672_0002413
897 Ga0495672_0003332
898 Ga0495672_0011707
899 Ga0495672_0016106
900 Ga0495672_0018130
901 Ga0495672_0018826
902 Ga0495672_0021016
903 Ga0495672_0028393
904 Ga0495676_0000368
905 Ga0495676_0001439
906 Ga0495676_0017594
907 Ga0495680_0055415
908 Ga0495680_0095154
909 Ga0495680_0110240
910 Ga0495683_0000004
911 Ga0495683_0000318
912 Ga0495683_0000356
913 Ga0495683_0006570
914 Ga0495683_0011260
915 Ga0495683_0023149
916 Ga0495683_0027136
917 Ga0495683_0041126
918 Ga0495687_000977
919 Ga0495687_007915
920 Ga0495679_000137
921 Ga0495679_000171
922 Ga0495679_004040
923 Ga0495679_004206
924 Ga0495679_009192
925 Ga0495673_0001451
926 Ga0495673_0005021
927 Ga0495673_0006444
928 Ga0495673_0013259
929 Ga0495673_0015824
930 Ga0495673_0016735
931 Ga0495681_0000478
932 Ga0495681_0002364
933 Ga0495681_0005548
934 Ga0495681_0011741
935 Ga0495681_0011854
936 Ga0495681_0012026
937 Ga0495681_0026819
938 Ga0495681_0028170
939 Ga0495684_0007118
940 Ga0495684_0010777
941 Ga0495686_0003002
942 Ga0495686_0014588
943 Ga0495593_0001207
944 Ga0495593_0016466
945 Ga0495593_0026775
946 Ga0495593_0034451
947 Ga0495593_0073381
948 Ga0495602_0003908
949 Ga0495626_0000064
950 Ga0495626_0000616
951 Ga0495626_0000958
952 Ga0495626_0007427
953 Ga0495626_0029031
954 Ga0496102_0000774
955 Ga0496103_0033811
956 Ga0496104_0244380
957 Ga0496105_0147565
958 Ga0496106_0102144
959 Ga0496116_0000382
960 Ga0496116_0002706
961 Ga0496116_0008609
962 Ga0496116_0009233
963 Ga0496116_0054568
964 Ga0496117_0007085
965 Ga0496117_0022162
966 Ga0496117_0037737
967 Ga0496117_0048903
968 Ga0496117_0053943
969 Ga0496117_0057377
970 Ga0496118_0009595
971 Ga0496118_0018594
972 Ga0496118_0027819
973 Ga0496118_0029914
974 Ga0496118_0037697
975 Ga0496118_0044807
976 Ga0496119_0013764
977 Ga0496119_0019342
978 Ga0496120_0009871
979 Ga0496120_0011884
980 Ga0496120_0013171
981 Ga0496120_0051741
982 Ga0496121_0000589
983 Ga0496121_0001708
984 Ga0496121_0014964
985 Ga0496121_0032565
986 Ga0496121_0068490
987 Ga0496121_0105614
988 Ga0496122_0011011
989 Ga0496122_0020192
990 Ga0496122_0041565
991 Ga0496122_0043894
992 Ga0496122_0051450
993 Ga0496122_0093534
994 Ga0496123_0003547
995 Ga0496123_0017509
996 Ga0496123_0027501
997 Ga0496123_0036587
998 Ga0496123_0042638
999 Ga0496123_0059533
1000 Ga0496123_0074914
1001 Ga0496124_0004348
1002 Ga0496124_0007542
1003 Ga0496124_0018066
1004 Ga0496124_0056531
1005 Ga0496124_0072065
1006 Ga0496124_0102748
1007 Ga0496125_0000641
1008 Ga0496125_0004187
1009 Ga0496125_0009776
1010 Ga0496125_0019631
1011 Ga0496125_0028884
1012 Ga0496125_0045691
1013 Ga0496125_0046986
1014 Ga0496125_0072651
1015 Ga0496126_0008374
1016 Ga0496126_0134535
1017 Ga0495678_000014
1018 Ga0495678_000578
1019 Ga0495678_008704
1020 Ga0495682_0001018
1021 Ga0495682_0006818
1022 Ga0495682_0014656
1023 Ga0495682_0029320
1024 nmdc:mga03683_8680_c1
1025 Ga0500572_000710
1026 2511255179
1027 2511265495
1028 2511271807
1029 2511288053
1030 2511298697
1031 2511312483
1032 2511321307
1033 2511329403
1034 2511334575
1035 2511351794
1036 2511411654
1037 2555670022
1038 2597863936
1039 2599352942
1040 2599359294
1041 2599365185
1042 2599371988
1043 2599378050
1044 2599384573
1045 2599390846
1046 2599398333
1047 2599403031
1048 2599450355
1049 2599459776
1050 2599465878
1051 2599488797
1052 2599507371
1053 2599512837
1054 2599522143
1055 2599881327
1056 2599891514
1057 2599946653
1058 2600212383
1059 2601691877
1060 2601772551
1061 2601798968
1062 2606077864
1063 2606129961
1064 2621299896
1065 2624480910
1066 2624492215
1067 2643874220
1068 2644620206
1069 2671095474
1070 2677896547
1071 2715756963
1072 2723248724
1073 2738669893
1074 2738748286
1075 2738806844
1076 2738857328
1077 2738894204
1078 2739197524
1079 2739258759
1080 2739311830
1081 2765584025
1082 2774122513
1083 2774133712
1084 2784264527
1085 2784314654
1086 2808929139
1087 2808951260
1088 2808979109
1089 2808995008
1090 2817491189
1091 2819658807
1092 2819701049
1093 2834034028
1094 2842826945
1095 2842839284
1096 2844670649
1097 2852614447
1098 2852662055
1099 2852667815
1100 2860342763
1101 2878032842
1102 2880233417
1103 2904520221
1104 2904552452
1105 2908449749
1106 2917073845
1107 2919064863
1108 2919460664
1109 2919698401
1110 2929192615
1111 2931393999
1112 2935357100
1113 2945933470
1114 2945963423
1115 2946009776
1116 2969307623
1117 2984289459
1118 3007624039
1119 3007719866
1120 637320390
1121 8019773209
1122 8019779170
1123 8054286653
1124 8054352282
1125 8054506369
1126 8054932682
1127 8055821118
1128 8056134801
1129 8056166073
1130 8056174277
1131 8056573864
1132 8057800534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13231

PMT_2

Dolichyl-phosphate-mannose-protein mannosyltransferase

63

216

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.7057 2 508
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.6973 2 508
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.6891 472 513
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.6826 2 508
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.6746 2 508
ID Description Score Start End Superfamily
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.748 52 173 1.20.1250.20
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5913 52 173 1.20.1250.20
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5861 473 512 3.40.630.30
3juwC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5608 464 509 3.40.630.30
af_Q2FZM1_1_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5532 463 512 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Z0AEQ2-F1-model_v4 Phospholipid carrier-dependent glycosyltransferase 0.9723 2 185 GO:0016020
GO:0016740
AF-A0A101LGC0-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9431 2 511 GO:0005886
GO:0009103
GO:0016763
AF-A0A101LGC0-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.936 2 511 GO:0005886
GO:0009103
GO:0016763
AF-A0A6A7RR71-F1-model_v4 Glycosyltransferase 0.9261 2 512 GO:0000030
GO:0005886
GO:0006493
GO:0009103
GO:0010041
GO:0016763
AF-A0A6A7RR71-F1-model_v4 Glycosyltransferase 0.9209 2 512 GO:0000030
GO:0005886
GO:0006493
GO:0009103
GO:0010041
GO:0016763

Map