F464374

General Info

Members Datasets Scaffolds Average Seq Length
566 286 552 152

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10150753|Ga0105244_101507532
Length 182
Sequence VIQVFDSGPHPLWVRPGVFFVIHRTFEELPVALDPSFIGRTYPPTEPYEVGREKIREFAVAVGDANPAYTDPEAAKALGHRDVIAPPTFPFVLTFRAAAQVVQDPELGLDYSRVVHGDQKFAYTRPVRAGDRLSVAVTIDNIKSLAGNDVLTVRGEVSGASGEHVVTSVMTLVARAADEAGE

Samples

Sample ID Description Type Environment
1 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
2 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
3 2643221714 Streptomyces sp. Root264 Isolate Unclassified
4 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
5 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
6 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
7 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
10 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
11 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
12 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
13 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
113 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
116 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
117 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
118 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
119 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
120 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
121 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
122 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
123 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
124 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
274 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
277 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
278 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
279 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
280 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
281 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
286 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0.71
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.12
Nodule 0
Rhizoplane 3.36
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1027718 3300000546 Bacteria 606
2 JGI24739J22299_10011660 3300001989 Bacteria 3241
3 JGI24735J21928_10004550 3300002067 Bacteria 4659
4 JGI24735J21928_10022149 3300002067 Bacteria 1937
5 rootL2_10007292 3300003322 Bacteria 1596
6 rootH1_10014055 3300003323 Bacteria 7153
7 rootH1_10154390 3300003323 Bacteria 1070
8 Ga0006562J51391_1020916 3300003578 Bacteria 1480
9 Ga0006562J51391_1020917 3300003578 Bacteria 1830
10 Ga0055540_1011466 3300003792 Bacteria 2854
11 Ga0058863_11947591 3300004799 Bacteria 1346
12 Ga0058861_12038154 3300004800 Bacteria 982
13 Ga0070658_10775366 3300005327 Bacteria 833
14 Ga0070683_101105301 3300005329 Bacteria 761
15 Ga0068868_100554006 3300005338 Bacteria 1014
16 Ga0070687_100301983 3300005343 Bacteria 1016
17 Ga0070661_101335765 3300005344 Bacteria 602
18 Ga0070667_101180962 3300005367 Bacteria 716
19 Ga0070714_101403813 3300005435 Bacteria 682
20 Ga0070663_100227360 3300005455 Bacteria 1467
21 Ga0070678_101501135 3300005456 Bacteria 631
22 Ga0070681_10599560 3300005458 Bacteria 1016
23 Ga0070681_11215173 3300005458 Bacteria 676
24 Ga0070685_11048223 3300005466 Bacteria 614
25 Ga0070698_101569739 3300005471 Bacteria 610
26 Ga0070679_100221328 3300005530 Bacteria 1854
27 Ga0070679_101211989 3300005530 Bacteria 700
28 Ga0070684_100249104 3300005535 Bacteria 1624
29 Ga0068853_100079996 3300005539 Bacteria 2859
30 Ga0070672_100144409 3300005543 Bacteria 1965
31 Ga0070665_100638590 3300005548 Bacteria 1078
32 Ga0068856_100250444 3300005614 Bacteria 1786
33 Ga0068859_100181128 3300005617 Bacteria 2190
34 Ga0068858_101089812 3300005842 Bacteria 784
35 Ga0081455_10049072 3300005937 Bacteria 3641
36 Ga0070717_11092093 3300006028 Bacteria 727
37 Ga0075365_10088257 3300006038 Bacteria 2109
38 Ga0075365_10134791 3300006038 Bacteria 1711
39 Ga0075363_100074544 3300006048 Bacteria 1847
40 Ga0075367_10008260 3300006178 Bacteria 5386
41 Ga0075369_10276500 3300006186 Bacteria 782
42 Ga0075370_10205417 3300006353 Bacteria 1162
43 Ga0075370_10445662 3300006353 Bacteria 779
44 Ga0075370_10920518 3300006353 Bacteria 535
45 Ga0075434_102156629 3300006871 Bacteria 561
46 Ga0097620_100181131 3300006931 Bacteria 2190
47 Ga0105251_10010014 3300009011 Bacteria 5542
48 Ga0105244_10150753 3300009036 Bacteria 1114
49 Ga0105250_10051640 3300009092 Bacteria 1649
50 Ga0105250_10257411 3300009092 Bacteria 747
51 Ga0105240_10053636 3300009093 Bacteria 5060
52 Ga0105245_10007819 3300009098 Bacteria 9365
53 Ga0105245_10070926 3300009098 Bacteria 3163
54 Ga0105245_11314485 3300009098 Bacteria 772
55 Ga0105243_10038845 3300009148 Bacteria 3709
56 Ga0105241_10545068 3300009174 Bacteria 1041
57 Ga0105238_10523446 3300009551 Bacteria 1188
58 Ga0105238_10738460 3300009551 Bacteria 998
59 Ga0105238_11756514 3300009551 Bacteria 652
60 Ga0105239_10230226 3300010375 Bacteria 2079
61 Ga0105246_10022892 3300011119 Bacteria 4037
62 Ga0105246_10584441 3300011119 Bacteria 962
63 Ga0105246_11216591 3300011119 Bacteria 694
64 Ga0105246_12356033 3300011119 Bacteria 521
65 Ga0157369_10079691 3300013105 Bacteria 3507
66 Ga0157375_10004899 3300013308 Bacteria 11635
67 Ga0163163_10373114 3300014325 Bacteria 1484
68 Ga0182008_10004686 3300014497 Bacteria 7940
69 Ga0182006_1028681 3300015261 Bacteria 2262
70 Ga0182007_10006733 3300015262 Bacteria 4906
71 Ga0209758_1053550 3300025297 Bacteria 1385
72 Ga0207426_1006340 3300025302 Bacteria 5168
73 Ga0207426_1009606 3300025302 Bacteria 3812
74 Ga0209051_1001489 3300025303 Bacteria 19606
75 Ga0207696_1041246 3300025711 Bacteria 1349
76 Ga0207713_1025636 3300025735 Bacteria 2717
77 Ga0207647_10029484 3300025904 Bacteria 3551
78 Ga0207652_11158970 3300025921 Bacteria 674
79 Ga0207694_10297407 3300025924 Bacteria 1328
80 Ga0207650_10370416 3300025925 Bacteria 1181
81 Ga0207650_10791829 3300025925 Bacteria 803
82 Ga0207687_10069039 3300025927 Bacteria 2519
83 Ga0207687_10328171 3300025927 Bacteria 1240
84 Ga0207686_10114252 3300025934 Bacteria 1827
85 Ga0207661_10384874 3300025944 Bacteria 1270
86 Ga0207661_10834909 3300025944 Bacteria 848
87 Ga0207639_10022607 3300026041 Bacteria 4531
88 Ga0207678_10525050 3300026067 Bacteria 1033
89 Ga0207648_10347840 3300026089 Bacteria 1336
90 Ga0207676_10792968 3300026095 Bacteria 924
91 Ga0207683_10934444 3300026121 Bacteria 805
92 Ga0207698_10109732 3300026142 Bacteria 2309
93 Ga0207698_10603594 3300026142 Bacteria 1082
94 Ga0209371_1022176 3300027312 Bacteria 1523
95 Ga0307517_10002248 3300028786 Bacteria 31157
96 Ga0307515_10001897 3300028794 Bacteria 46523
97 Ga0307515_10101954 3300028794 Bacteria 3458
98 Ga0307515_10446540 3300028794 Bacteria 909
99 Ga0307515_10761317 3300028794 Bacteria 588
100 Ga0268256_1024959 3300030500 Bacteria 1526
101 Ga0307511_10006642 3300030521 Bacteria 11663
102 Ga0307511_10137380 3300030521 Bacteria 1450
103 Ga0307512_10011226 3300030522 Bacteria 8499
104 Ga0307512_10018422 3300030522 Bacteria 6382
105 Ga0307512_10310982 3300030522 Bacteria 725
106 Ga0307513_10095693 3300031456 Bacteria 3009
107 Ga0307513_10144890 3300031456 Bacteria 2295
108 Ga0307509_10102733 3300031507 Bacteria 2889
109 Ga0307509_10145311 3300031507 Bacteria 2299
110 Ga0307408_101036230 3300031548 Bacteria 758
111 Ga0307508_10031345 3300031616 Bacteria 4804
112 Ga0307508_10220119 3300031616 Bacteria 1498
113 Ga0307508_10224302 3300031616 Bacteria 1479
114 Ga0307508_10550629 3300031616 Bacteria 751
115 Ga0307514_10287683 3300031649 Bacteria 933
116 Ga0307514_10317622 3300031649 Bacteria 857
117 Ga0307516_10012550 3300031730 Bacteria 9120
118 Ga0307518_10040229 3300031838 Bacteria 3401
119 Ga0307518_10185534 3300031838 Bacteria 1400
120 Ga0307410_10073600 3300031852 Bacteria 2376
121 Ga0307410_11279396 3300031852 Bacteria 641
122 Ga0307406_10527732 3300031901 Bacteria 962
123 Ga0307407_10047708 3300031903 Bacteria 2433
124 Ga0307409_100054088 3300031995 Bacteria 3089
125 Ga0307416_100757339 3300032002 Bacteria 1064
126 Ga0307415_100005650 3300032126 Bacteria 6661
127 Ga0307507_10009069 3300033179 Bacteria 13406
128 Ga0307507_10317487 3300033179 Bacteria 941
129 Ga0307507_10350215 3300033179 Bacteria 869
130 Ga0307510_10018408 3300033180 Bacteria 8220
131 Ga0307510_10112163 3300033180 Bacteria 2465
132 Ga0307510_10346108 3300033180 Bacteria 937
133 Ga0373946_0151848 3300035171 Bacteria 1081
134 Ga0395900_0130824 3300037418 Bacteria 2572
135 Ga0395898_0026366 3300037466 Bacteria 5849
136 Ga0395901_0090689 3300038443 Bacteria 3199
137 Ga0451800_1639784 3300041459 Bacteria 567
138 Ga0451841_0330448 3300041498 Bacteria 1557
139 Ga0451849_0112419 3300041505 Bacteria 1020
140 Ga0451851_0489528 3300041507 Bacteria 1507
141 Ga0451853_1418287 3300041512 Bacteria 2430
142 Ga0451853_1609868 3300041512 Bacteria 857
143 Ga0451853_2171161 3300041512 Bacteria 621
144 Ga0451853_2445157 3300041512 Bacteria 3704
145 Ga0439449_0006827 3300042007 Bacteria 4352
146 Ga0439457_065447 3300042014 Bacteria 825
147 Ga0450894_000469 3300042131 Bacteria 6884
148 Ga0450895_001743 3300042132 Bacteria 1550
149 Ga0450896_000106 3300042133 Bacteria 6026
150 Ga0450898_000563 3300042134 Bacteria 4394
151 Ga0450899_001353 3300042135 Bacteria 2753
152 Ga0450900_014387 3300042136 Bacteria 1055
153 Ga0450903_001178 3300042138 Bacteria 4934
154 Ga0450903_008536 3300042138 Bacteria 1675
155 Ga0450906_005126 3300042145 Bacteria 2714
156 Ga0439458_0002293 3300042157 Bacteria 4696
157 Ga0439458_0043027 3300042157 Bacteria 1100
158 Ga0450908_011632 3300042184 Bacteria 1609
159 Ga0466969_0001522 3300044656 Bacteria 12485
160 Ga0466969_0043040 3300044656 Bacteria 2251
161 Ga0466972_0010134 3300044658 Bacteria 4734
162 Ga0466972_0024615 3300044658 Bacteria 2987
163 Ga0466972_0057751 3300044658 Bacteria 1863
164 Ga0466972_0196731 3300044658 Bacteria 944
165 Ga0466965_0016619 3300044683 Bacteria 3505
166 Ga0466965_0065937 3300044683 Bacteria 1815
167 Ga0466966_0002430 3300044684 Bacteria 12171
168 Ga0466966_0003728 3300044684 Bacteria 10046
169 Ga0466966_0010844 3300044684 Bacteria 6055
170 Ga0466966_0078559 3300044684 Bacteria 2057
171 Ga0466961_0003156 3300044693 Bacteria 10263
172 Ga0466961_0011629 3300044693 Bacteria 5625
173 Ga0466961_0022130 3300044693 Bacteria 4090
174 Ga0466961_0049747 3300044693 Bacteria 2678
175 Ga0466961_0191914 3300044693 Bacteria 1266
176 Ga0466963_0000957 3300044694 Bacteria 14814
177 Ga0466963_0006510 3300044694 Bacteria 6915
178 Ga0466963_0021923 3300044694 Bacteria 4038
179 Ga0466963_0038865 3300044694 Bacteria 3114
180 Ga0466963_0429291 3300044694 Bacteria 932
181 Ga0466964_0015454 3300044706 Bacteria 2905
182 Ga0466964_0347073 3300044706 Bacteria 761
183 Ga0466964_0615364 3300044706 Bacteria 597
184 Ga0466971_0015607 3300044719 Bacteria 3345
185 Ga0466971_0162560 3300044719 Bacteria 1045
186 Ga0466970_0008565 3300044765 Bacteria 5149
187 Ga0466970_0085712 3300044765 Bacteria 1706
188 Ga0466970_0246953 3300044765 Bacteria 999
189 Ga0466957_0016285 3300044842 Bacteria 4348
190 Ga0466957_0240896 3300044842 Bacteria 1200
191 Ga0466957_0481545 3300044842 Bacteria 858
192 Ga0466960_0156298 3300044901 Bacteria 1221
193 Ga0466959_0021835 3300045049 Bacteria 4725
194 Ga0466959_0106300 3300045049 Bacteria 2006
195 Ga0466959_0381969 3300045049 Bacteria 958
196 Ga0466958_0021709 3300045836 Bacteria 3754
197 Ga0466958_0104809 3300045836 Bacteria 1761
198 Ga0466967_0046949 3300045976 Bacteria 3763
199 Ga0466967_0941244 3300045976 Bacteria 859
200 Ga0495617_030494 3300046452 Bacteria 1812
201 Ga0495627_025594 3300046453 Bacteria 1912
202 Ga0495592_0029582 3300046454 Bacteria 4147
203 Ga0495592_0038013 3300046454 Bacteria 3622
204 Ga0495592_0040174 3300046454 Bacteria 3511
205 Ga0495592_0100220 3300046454 Bacteria 2065
206 Ga0495603_0026701 3300046455 Bacteria 3487
207 Ga0495603_0146297 3300046455 Bacteria 1373
208 Ga0495603_0162172 3300046455 Bacteria 1296
209 Ga0495603_0300097 3300046455 Bacteria 923
210 Ga0495590_0029568 3300046457 Bacteria 1920
211 Ga0495629_0005008 3300046459 Bacteria 9933
212 Ga0495629_0043979 3300046459 Bacteria 3135
213 Ga0495629_0098282 3300046459 Bacteria 2042
214 Ga0495629_0154578 3300046459 Bacteria 1594
215 Ga0495638_0207122 3300046460 Bacteria 1103
216 Ga0495651_0001402 3300046462 Bacteria 18685
217 Ga0495651_0011850 3300046462 Bacteria 6704
218 Ga0495651_0072771 3300046462 Bacteria 2610
219 Ga0495651_0152601 3300046462 Bacteria 1663
220 Ga0495653_0013162 3300046463 Bacteria 6745
221 Ga0495653_0311163 3300046463 Bacteria 1024
222 Ga0495653_0380888 3300046463 Bacteria 901
223 Ga0495580_0036732 3300046472 Bacteria 3517
224 Ga0495582_0060722 3300046473 Bacteria 2086
225 Ga0495582_0167790 3300046473 Bacteria 1249
226 Ga0495605_0055468 3300046474 Bacteria 1914
227 Ga0495605_0100549 3300046474 Bacteria 1330
228 Ga0495605_0208343 3300046474 Bacteria 849
229 Ga0495639_0022765 3300046475 Bacteria 2750
230 Ga0495639_0204674 3300046475 Bacteria 967
231 Ga0495662_0000039 3300046476 Bacteria 43770
232 Ga0495662_0025273 3300046476 Bacteria 2867
233 Ga0495662_0033297 3300046476 Bacteria 2489
234 Ga0495662_0218371 3300046476 Bacteria 939
235 Ga0495664_0001560 3300046477 Bacteria 12137
236 Ga0495664_0005989 3300046477 Bacteria 6702
237 Ga0495664_0410246 3300046477 Bacteria 813
238 Ga0495664_0641831 3300046477 Bacteria 629
239 Ga0495585_0006093 3300046492 Bacteria 7534
240 Ga0495585_0146295 3300046492 Bacteria 1234
241 Ga0495594_0049497 3300046499 Bacteria 2309
242 Ga0495594_0174376 3300046499 Bacteria 1223
243 Ga0495594_0244581 3300046499 Bacteria 1022
244 Ga0495594_0269746 3300046499 Bacteria 969
245 Ga0495594_0290687 3300046499 Bacteria 931
246 Ga0495594_0392155 3300046499 Bacteria 790
247 Ga0495594_0824883 3300046499 Bacteria 522
248 Ga0495607_0024376 3300046501 Bacteria 3772
249 Ga0495583_0025119 3300046506 Bacteria 2981
250 Ga0495583_0189727 3300046506 Bacteria 838
251 Ga0495606_0000879 3300046507 Bacteria 44942
252 Ga0495606_0042550 3300046507 Bacteria 3036
253 Ga0495606_0510999 3300046507 Bacteria 605
254 Ga0495608_0004844 3300046511 Bacteria 9620
255 Ga0495608_0135746 3300046511 Bacteria 1572
256 Ga0495608_0384995 3300046511 Bacteria 859
257 Ga0495616_0018387 3300046513 Bacteria 3837
258 Ga0495618_0200049 3300046514 Bacteria 1265
259 Ga0495620_0001872 3300046515 Bacteria 12383
260 Ga0495620_0174093 3300046515 Bacteria 833
261 Ga0495620_0350674 3300046515 Bacteria 560
262 Ga0495620_0360099 3300046515 Bacteria 551
263 Ga0495628_0001124 3300046516 Bacteria 24422
264 Ga0495628_0017262 3300046516 Bacteria 6010
265 Ga0495628_0021408 3300046516 Bacteria 5319
266 Ga0495628_0133203 3300046516 Bacteria 1900
267 Ga0495630_0455912 3300046517 Bacteria 980
268 Ga0495643_0006297 3300046522 Bacteria 7850
269 Ga0495643_0246011 3300046522 Bacteria 837
270 Ga0495648_0057012 3300046524 Bacteria 2346
271 Ga0495666_0006831 3300046526 Bacteria 5729
272 Ga0495666_0011232 3300046526 Bacteria 4467
273 Ga0495666_0145425 3300046526 Bacteria 1103
274 Ga0495666_0230884 3300046526 Bacteria 846
275 Ga0495652_0009670 3300046529 Bacteria 8753
276 Ga0495652_0023121 3300046529 Bacteria 5511
277 Ga0495652_0064037 3300046529 Bacteria 3094
278 Ga0495652_0389085 3300046529 Bacteria 990
279 Ga0495654_0051553 3300046530 Bacteria 2007
280 Ga0495665_0017077 3300046531 Bacteria 3904
281 Ga0495640_0025755 3300046533 Bacteria 4260
282 Ga0495640_0057922 3300046533 Bacteria 2643
283 Ga0495640_0095764 3300046533 Bacteria 1953
284 Ga0495586_0021896 3300046535 Bacteria 3411
285 Ga0495586_0064667 3300046535 Bacteria 1993
286 Ga0495586_0080684 3300046535 Bacteria 1787
287 Ga0495587_0036903 3300046536 Bacteria 2937
288 Ga0495609_0020901 3300046538 Bacteria 3020
289 Ga0495597_0108213 3300046542 Bacteria 1167
290 Ga0495645_0004582 3300046543 Bacteria 9435
291 Ga0495645_0021671 3300046543 Bacteria 4645
292 Ga0495645_0380248 3300046543 Bacteria 903
293 Ga0495645_0630419 3300046543 Bacteria 657
294 Ga0495622_0058996 3300046557 Bacteria 1777
295 Ga0495622_0090396 3300046557 Bacteria 1407
296 Ga0495622_0106326 3300046557 Bacteria 1285
297 Ga0495633_0040675 3300046558 Bacteria 2213
298 Ga0495667_0004962 3300046559 Bacteria 8999
299 Ga0495667_0027757 3300046559 Bacteria 3812
300 Ga0495656_0007263 3300046615 Bacteria 3910
301 Ga0495668_0000880 3300046616 Bacteria 33848
302 Ga0495668_0083190 3300046616 Bacteria 1755
303 Ga0495634_0080193 3300046642 Bacteria 2136
304 Ga0495634_0137011 3300046642 Bacteria 1556
305 Ga0495634_0174497 3300046642 Bacteria 1349
306 Ga0495625_0003848 3300046660 Bacteria 14504
307 Ga0495625_0010562 3300046660 Bacteria 7626
308 Ga0495625_0081511 3300046660 Bacteria 2252
309 Ga0495625_0156742 3300046660 Bacteria 1527
310 Ga0495625_0354366 3300046660 Bacteria 927
311 Ga0495625_0850930 3300046660 Bacteria 526
312 Ga0495635_0008663 3300046663 Bacteria 7103
313 Ga0495635_0074129 3300046663 Bacteria 2331
314 Ga0495661_0021151 3300046665 Bacteria 4244
315 Ga0495588_0007513 3300046674 Bacteria 4963
316 Ga0495588_0094612 3300046674 Bacteria 1566
317 Ga0495588_0221098 3300046674 Bacteria 999
318 Ga0495588_0351901 3300046674 Bacteria 774
319 Ga0495657_0009083 3300046675 Bacteria 7555
320 Ga0495657_0021068 3300046675 Bacteria 4681
321 Ga0495657_0038438 3300046675 Bacteria 3293
322 Ga0495599_0113257 3300046678 Bacteria 1688
323 Ga0495599_0206969 3300046678 Bacteria 1204
324 Ga0495599_0749652 3300046678 Bacteria 560
325 Ga0495623_0022571 3300046679 Bacteria 4064
326 Ga0495623_0124655 3300046679 Bacteria 1547
327 Ga0495623_0290225 3300046679 Bacteria 907
328 Ga0495646_0000605 3300046680 Bacteria 19528
329 Ga0495646_0134272 3300046680 Bacteria 1390
330 Ga0495613_0004137 3300046689 Bacteria 10861
331 Ga0495613_0006485 3300046689 Bacteria 8743
332 Ga0495613_0007081 3300046689 Bacteria 8349
333 Ga0495613_0037030 3300046689 Bacteria 3617
334 Ga0495613_0077848 3300046689 Bacteria 2412
335 Ga0495613_0160860 3300046689 Bacteria 1597
336 Ga0495613_0229689 3300046689 Bacteria 1300
337 Ga0495613_0541185 3300046689 Bacteria 780
338 Ga0495624_0122380 3300046690 Bacteria 1597
339 Ga0495624_0151132 3300046690 Bacteria 1420
340 Ga0495624_0406205 3300046690 Bacteria 817
341 Ga0495670_0103230 3300046691 Bacteria 1470
342 Ga0495671_0167261 3300046692 Bacteria 1069
343 Ga0495649_0114629 3300046694 Bacteria 1427
344 Ga0495589_0023713 3300046794 Bacteria 3124
345 Ga0495589_0064548 3300046794 Bacteria 1795
346 Ga0495589_0100173 3300046794 Bacteria 1402
347 Ga0495589_0119339 3300046794 Bacteria 1270
348 Ga0495600_0015114 3300046809 Bacteria 4875
349 Ga0495600_0027958 3300046809 Bacteria 3647
350 Ga0495600_0073066 3300046809 Bacteria 2239
351 Ga0495600_0239975 3300046809 Bacteria 1155
352 Ga0495660_0041166 3300046810 Bacteria 2559
353 Ga0495660_0067627 3300046810 Bacteria 1902
354 Ga0495581_0008471 3300047315 Bacteria 5963
355 Ga0495581_0076201 3300047315 Bacteria 1940
356 Ga0495581_0098149 3300047315 Bacteria 1701
357 Ga0495581_0150459 3300047315 Bacteria 1359
358 Ga0495581_0155770 3300047315 Bacteria 1335
359 Ga0495581_0240402 3300047315 Bacteria 1059
360 Ga0495604_0001340 3300047317 Bacteria 20143
361 Ga0495604_0013361 3300047317 Bacteria 6538
362 Ga0495604_0036315 3300047317 Bacteria 3884
363 Ga0495604_0044597 3300047317 Bacteria 3463
364 Ga0495604_0362115 3300047317 Bacteria 961
365 Ga0495636_0072780 3300047318 Bacteria 1469
366 Ga0495636_0164295 3300047318 Bacteria 1001
367 Ga0495636_0192147 3300047318 Bacteria 929
368 Ga0495636_0214223 3300047318 Bacteria 882
369 Ga0495636_0258699 3300047318 Bacteria 806
370 Ga0495674_0005859 3300047319 Bacteria 11787
371 Ga0495674_0415562 3300047319 Bacteria 1084
372 Ga0495672_0080858 3300047320 Bacteria 1811
373 Ga0495676_0003054 3300047321 Bacteria 15139
374 Ga0495676_0043154 3300047321 Bacteria 3694
375 Ga0495676_0054130 3300047321 Bacteria 3191
376 Ga0495676_0191871 3300047321 Bacteria 1424
377 Ga0495676_0497658 3300047321 Bacteria 800
378 Ga0495680_0043327 3300047322 Bacteria 3565
379 Ga0495683_0256675 3300047323 Bacteria 765
380 Ga0495687_002749 3300047443 Bacteria 13636
381 Ga0495687_027772 3300047443 Bacteria 2643
382 Ga0495687_067923 3300047443 Bacteria 1440
383 Ga0495675_0005789 3300047444 Bacteria 7554
384 Ga0495675_0025280 3300047444 Bacteria 3786
385 Ga0495675_0030332 3300047444 Bacteria 3450
386 Ga0495675_0034826 3300047444 Bacteria 3215
387 Ga0495675_0141588 3300047444 Bacteria 1490
388 Ga0495675_0164823 3300047444 Bacteria 1363
389 Ga0495675_0429947 3300047444 Bacteria 766
390 Ga0495675_0528159 3300047444 Bacteria 675
391 Ga0495685_018341 3300047447 Bacteria 2401
392 Ga0495685_042964 3300047447 Bacteria 1542
393 Ga0495685_095087 3300047447 Bacteria 985
394 Ga0495685_160023 3300047447 Bacteria 729
395 Ga0495681_0001709 3300047470 Bacteria 16261
396 Ga0495681_0084660 3300047470 Bacteria 1409
397 Ga0495681_0175939 3300047470 Bacteria 882
398 Ga0495684_0017701 3300047471 Bacteria 5487
399 Ga0495686_0001711 3300047472 Bacteria 22657
400 Ga0495686_0034412 3300047472 Bacteria 3263
401 Ga0495686_0254138 3300047472 Bacteria 986
402 Ga0495593_0042925 3300047673 Bacteria 2426
403 Ga0495593_0117687 3300047673 Bacteria 1353
404 Ga0495602_0025604 3300048088 Bacteria 5706
405 Ga0495602_0140524 3300048088 Bacteria 1911
406 Ga0495602_0467570 3300048088 Bacteria 887
407 Ga0495614_0000938 3300048089 Bacteria 12410
408 Ga0495614_0006161 3300048089 Bacteria 5390
409 Ga0495614_0214989 3300048089 Bacteria 872
410 Ga0495614_0249855 3300048089 Bacteria 811
411 Ga0495626_0000116 3300048091 Bacteria 104938
412 Ga0495626_0084312 3300048091 Bacteria 1406
413 Ga0496100_0305455 3300048903 Bacteria 1192
414 Ga0496101_0217765 3300048904 Bacteria 1481
415 Ga0496104_0326898 3300048907 Bacteria 1446
416 Ga0496104_0364416 3300048907 Bacteria 1358
417 Ga0496105_0395825 3300048908 Bacteria 1097
418 Ga0496105_0401674 3300048908 Bacteria 1088
419 Ga0496107_0205021 3300048910 Bacteria 1466
420 Ga0496107_0527454 3300048910 Bacteria 875
421 Ga0496108_0047129 3300048911 Bacteria 3603
422 Ga0496108_0864834 3300048911 Bacteria 777
423 Ga0496109_0043572 3300048912 Bacteria 4068
424 Ga0496109_0076090 3300048912 Bacteria 3087
425 Ga0496110_1002641 3300048913 Bacteria 742
426 Ga0496111_0038863 3300048914 Bacteria 3410
427 Ga0496112_0321197 3300048915 Bacteria 1492
428 Ga0496113_0483364 3300048916 Bacteria 995
429 Ga0496113_1173061 3300048916 Bacteria 600
430 Ga0496114_0009685 3300048917 Bacteria 7654
431 Ga0496126_0296746 3300048929 Bacteria 1335
432 Ga0495678_084334 3300049459 Bacteria 1133
433 Ga0495682_0047951 3300049460 Bacteria 1558
434 Ga0501031_0065920 3300049568 Bacteria 2359
435 Ga0501031_0202488 3300049568 Bacteria 1295
436 Ga0501032_0081247 3300049569 Bacteria 2157
437 Ga0501032_0106060 3300049569 Bacteria 1861
438 Ga0501032_0183684 3300049569 Bacteria 1368
439 Ga0501032_0254580 3300049569 Bacteria 1139
440 Ga0501033_0071280 3300049570 Bacteria 2553
441 Ga0501033_0149407 3300049570 Bacteria 1686
442 Ga0501033_0183875 3300049570 Bacteria 1497
443 Ga0501033_0278697 3300049570 Bacteria 1180
444 Ga0501033_0331707 3300049570 Bacteria 1067
445 Ga0501033_0624489 3300049570 Bacteria 737
446 Ga0501034_0006593 3300049571 Bacteria 12455
447 Ga0501034_0136853 3300049571 Bacteria 2430
448 Ga0501034_0209390 3300049571 Bacteria 1905
449 Ga0501034_0464910 3300049571 Bacteria 1181
450 Ga0501034_0769220 3300049571 Bacteria 857
451 Ga0501034_0975093 3300049571 Bacteria 732
452 Ga0501036_0020178 3300049572 Bacteria 5596
453 Ga0501036_0037447 3300049572 Bacteria 4103
454 Ga0501036_0134302 3300049572 Bacteria 2088
455 Ga0501036_0183634 3300049572 Bacteria 1760
456 Ga0501037_0021280 3300049573 Bacteria 4793
457 Ga0501037_0034831 3300049573 Bacteria 3714
458 Ga0501037_0039709 3300049573 Bacteria 3464
459 Ga0501037_0179839 3300049573 Bacteria 1501
460 Ga0501037_0425577 3300049573 Bacteria 908
461 Ga0501037_0570441 3300049573 Bacteria 762
462 Ga0501037_0907690 3300049573 Bacteria 577
463 Ga0501038_0043950 3300049574 Bacteria 3883
464 Ga0501038_0060289 3300049574 Bacteria 3247
465 Ga0501038_0076521 3300049574 Bacteria 2826
466 Ga0501038_0119264 3300049574 Bacteria 2178
467 Ga0501038_0316145 3300049574 Bacteria 1222
468 Ga0501038_0501072 3300049574 Bacteria 928
469 Ga0501039_0046430 3300049575 Bacteria 3355
470 Ga0501039_0181754 3300049575 Bacteria 1654
471 Ga0501039_0233377 3300049575 Bacteria 1446
472 Ga0501039_0492659 3300049575 Bacteria 962
473 Ga0501040_0028474 3300049576 Bacteria 3767
474 Ga0501041_0161817 3300049577 Bacteria 1399
475 Ga0501042_0048614 3300049578 Bacteria 3024
476 Ga0501042_0051940 3300049578 Bacteria 2924
477 Ga0501043_0079722 3300049579 Bacteria 2572
478 Ga0501043_0097710 3300049579 Bacteria 2308
479 Ga0501043_0255990 3300049579 Bacteria 1347
480 Ga0501043_0293138 3300049579 Bacteria 1245
481 Ga0501046_0039312 3300049580 Bacteria 3789
482 Ga0501046_0453227 3300049580 Bacteria 922
483 Ga0501046_0583286 3300049580 Bacteria 794
484 Ga0501047_0013451 3300049581 Bacteria 7758
485 Ga0501047_0073219 3300049581 Bacteria 3298
486 Ga0501047_0318857 3300049581 Bacteria 1394
487 Ga0501047_0725585 3300049581 Bacteria 810
488 Ga0501048_0012919 3300049582 Bacteria 6202
489 Ga0501048_0033632 3300049582 Bacteria 3703
490 Ga0501048_0339089 3300049582 Bacteria 1071
491 Ga0501067_0770112 3300049583 Bacteria 542
492 Ga0501070_0050464 3300049586 Bacteria 3454
493 Ga0501070_0082368 3300049586 Bacteria 2663
494 Ga0501070_0211943 3300049586 Bacteria 1590
495 Ga0501070_0527280 3300049586 Bacteria 947
496 Ga0501070_0618823 3300049586 Bacteria 862
497 Ga0501070_0675694 3300049586 Bacteria 818
498 Ga0501071_0061242 3300049587 Bacteria 2725
499 Ga0501071_0525603 3300049587 Bacteria 908
500 Ga0501072_0204487 3300049588 Bacteria 1574
501 Ga0501073_0056713 3300049589 Bacteria 2740
502 Ga0501074_0001056 3300049590 Bacteria 17988
503 Ga0501074_0195596 3300049590 Bacteria 1441
504 Ga0501075_0080098 3300049591 Bacteria 2472
505 Ga0501076_0083700 3300049592 Bacteria 2562
506 Ga0501077_0181602 3300049593 Bacteria 1337
507 Ga0501079_0422367 3300049741 Bacteria 1046
508 Ga0501080_0584927 3300049742 Bacteria 992
509 Ga0501081_0083408 3300049743 Bacteria 2240
510 Ga0501083_0327946 3300049744 Bacteria 995
511 Ga0501035_0037723 3300049822 Bacteria 4374
512 Ga0501035_0082515 3300049822 Bacteria 2836
513 Ga0501035_0105935 3300049822 Bacteria 2465
514 Ga0501035_0171319 3300049822 Bacteria 1875
515 Ga0501035_0171324 3300049822 Bacteria 1875
516 Ga0501035_0293258 3300049822 Bacteria 1372
517 Ga0501035_0489440 3300049822 Bacteria 1014
518 Ga0501035_0577096 3300049822 Bacteria 919
519 Ga0501044_0016943 3300049823 Bacteria 7818
520 Ga0501044_0029838 3300049823 Bacteria 5749
521 Ga0501044_0052436 3300049823 Bacteria 4203
522 Ga0501044_0330417 3300049823 Bacteria 1447
523 Ga0501044_0759081 3300049823 Bacteria 851
524 Ga0501045_0049392 3300049824 Bacteria 3067
525 Ga0501045_0132674 3300049824 Bacteria 1852
526 Ga0501045_0163556 3300049824 Bacteria 1657
527 Ga0501045_0719199 3300049824 Bacteria 736
528 nmdc:mga03n38_108653_c1 3300050490 Bacteria 1348
529 nmdc:mga03n38_183796_c1 3300050490 Bacteria 1073
530 nmdc:mga0yw44_74996_c1 3300050492 Bacteria 2108
531 nmdc:mga06z11_4831_c1 3300050494 Bacteria 5336
532 nmdc:mga07m45_210088_c1 3300050496 Bacteria 1132
533 Ga0495601_0004280 3300053077 Bacteria 8243
534 Ga0500610_0161031 3300053079 Bacteria 1116
535 Ga0500635_0118403 3300053080 Bacteria 990
536 Ga0495619_0030021 3300053085 Bacteria 3517
537 Ga0500578_0224682 3300053086 Bacteria 1140
538 Ga0500640_026758 3300053095 Bacteria 2513
539 Ga0500641_0031844 3300053096 Bacteria 2082
540 Ga0500560_000044 3300053107 Bacteria 12726
541 Ga0500572_004725 3300053111 Bacteria 3088
542 Ga0500614_029287 3300053123 Bacteria 1336
543 Ga0500573_0305951 3300053140 Bacteria 792
544 Ga0500624_004805 3300053157 Bacteria 1786
545 Ga0500633_0263370 3300053160 Bacteria 639
546 Ga0501084_0083945 3300054114 Bacteria 2674
547 Ga0501082_0492409 3300060353 Bacteria 1071
548 Ga0501082_1271817 3300060353 Bacteria 643
549 Ga0466962_0004114 3300061719 Bacteria 6966
550 Ga0466962_0009245 3300061719 Bacteria 4721
551 Ga0466962_0042214 3300061719 Bacteria 2183
552 Ga0466962_0171262 3300061719 Bacteria 1057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0043979 Ga0495629_0043979_282_776 134
2 3300046689 Ga0495613_0541185 Ga0495613_0541185_239_733 134
3 3300047315 Ga0495581_0240402 Ga0495581_0240402_157_651 134
4 iso_pu_bacteria 2966598605 2966601472 146
5 iso_pu_bacteria 2995463766 2995468556 146
6 3300002067 JGI24735J21928_10004550 JGI24735J21928_100045509 147
7 3300005327 Ga0070658_10775366 Ga0070658_107753661 147
8 3300005329 Ga0070683_101105301 Ga0070683_1011053012 147
9 3300005338 Ga0068868_100554006 Ga0068868_1005540064 147
10 3300005343 Ga0070687_100301983 Ga0070687_1003019833 147
11 3300005367 Ga0070667_101180962 Ga0070667_1011809621 147
12 3300005455 Ga0070663_100227360 Ga0070663_1002273602 147
13 3300005458 Ga0070681_10599560 Ga0070681_105995602 147
14 3300005530 Ga0070679_101211989 Ga0070679_1012119892 147
15 3300005535 Ga0070684_100249104 Ga0070684_1002491045 147
16 3300005617 Ga0068859_100181128 Ga0068859_1001811285 147
17 3300005842 Ga0068858_101089812 Ga0068858_1010898122 147
18 3300006028 Ga0070717_11092093 Ga0070717_110920932 147
19 3300006871 Ga0075434_102156629 Ga0075434_1021566292 147
20 3300006931 Ga0097620_100181131 Ga0097620_1001811315 147
21 3300009098 Ga0105245_10007819 Ga0105245_1000781912 147
22 3300009551 Ga0105238_10523446 Ga0105238_105234462 147
23 3300013308 Ga0157375_10004899 Ga0157375_100048993 147
24 3300014325 Ga0163163_10373114 Ga0163163_103731141 147
25 3300025921 Ga0207652_11158970 Ga0207652_111589702 147
26 3300025924 Ga0207694_10297407 Ga0207694_102974073 147
27 3300025925 Ga0207650_10791829 Ga0207650_107918291 147
28 3300025927 Ga0207687_10069039 Ga0207687_100690397 147
29 3300025934 Ga0207686_10114252 Ga0207686_101142527 147
30 3300025944 Ga0207661_10834909 Ga0207661_108349092 147
31 3300026067 Ga0207678_10525050 Ga0207678_105250504 147
32 3300026089 Ga0207648_10347840 Ga0207648_103478403 147
33 3300026095 Ga0207676_10792968 Ga0207676_107929682 147
34 3300026121 Ga0207683_10934444 Ga0207683_109344442 147
35 3300026142 Ga0207698_10109732 Ga0207698_101097323 147
36 3300026142 Ga0207698_10603594 Ga0207698_106035942 147
37 3300041512 Ga0451853_2171161 Ga0451853_2171161_69_515 147
38 3300048903 Ga0496100_0305455 Ga0496100_0305455_496_942 147
39 3300048904 Ga0496101_0217765 Ga0496101_0217765_536_982 147
40 3300048907 Ga0496104_0326898 Ga0496104_0326898_700_1146 147
41 3300048908 Ga0496105_0395825 Ga0496105_0395825_225_671 147
42 3300048910 Ga0496107_0205021 Ga0496107_0205021_65_511 147
43 3300048912 Ga0496109_0043572 Ga0496109_0043572_468_914 147
44 3300048913 Ga0496110_1002641 Ga0496110_1002641_85_531 147
45 3300048914 Ga0496111_0038863 Ga0496111_0038863_1371_1817 147
46 3300048915 Ga0496112_0321197 Ga0496112_0321197_281_727 147
47 3300048916 Ga0496113_1173061 Ga0496113_1173061_55_501 147
48 3300048917 Ga0496114_0009685 Ga0496114_0009685_2154_2600 147
49 3300049568 Ga0501031_0202488 Ga0501031_0202488_781_1227 147
50 3300049572 Ga0501036_0134302 Ga0501036_0134302_1328_1774 147
51 3300049573 Ga0501037_0179839 Ga0501037_0179839_942_1388 147
52 3300049574 Ga0501038_0119264 Ga0501038_0119264_702_1148 147
53 3300049576 Ga0501040_0028474 Ga0501040_0028474_26_472 147
54 3300049577 Ga0501041_0161817 Ga0501041_0161817_711_1157 147
55 3300049578 Ga0501042_0048614 Ga0501042_0048614_1129_1575 147
56 3300049579 Ga0501043_0293138 Ga0501043_0293138_256_702 147
57 3300049580 Ga0501046_0453227 Ga0501046_0453227_343_789 147
58 3300049582 Ga0501048_0033632 Ga0501048_0033632_2700_3146 147
59 3300049587 Ga0501071_0061242 Ga0501071_0061242_1767_2213 147
60 3300049588 Ga0501072_0204487 Ga0501072_0204487_609_1055 147
61 3300049590 Ga0501074_0195596 Ga0501074_0195596_226_672 147
62 3300049591 Ga0501075_0080098 Ga0501075_0080098_310_756 147
63 3300049592 Ga0501076_0083700 Ga0501076_0083700_1230_1676 147
64 3300049593 Ga0501077_0181602 Ga0501077_0181602_687_1133 147
65 3300049741 Ga0501079_0422367 Ga0501079_0422367_343_789 147
66 3300049743 Ga0501081_0083408 Ga0501081_0083408_650_1096 147
67 3300049744 Ga0501083_0327946 Ga0501083_0327946_257_703 147
68 3300049824 Ga0501045_0049392 Ga0501045_0049392_1323_1769 147
69 3300054114 Ga0501084_0083945 Ga0501084_0083945_1538_1984 147
70 3300060353 Ga0501082_0492409 Ga0501082_0492409_372_818 147
71 iso_pu_bacteria 2643221631 2644175947 147
72 iso_pu_bacteria 2767802112 2768644134 147
73 3300010375 Ga0105239_10230226 Ga0105239_102302264 148
74 3300030521 Ga0307511_10137380 Ga0307511_101373802 148
75 3300031901 Ga0307406_10527732 Ga0307406_105277322 148
76 3300035171 Ga0373946_0151848 Ga0373946_0151848_536_985 148
77 3300046507 Ga0495606_0000879 Ga0495606_0000879_40953_41402 148
78 3300046616 Ga0495668_0000880 Ga0495668_0000880_1956_2405 148
79 3300046660 Ga0495625_0003848 Ga0495625_0003848_12009_12458 148
80 3300048091 Ga0495626_0000116 Ga0495626_0000116_3535_3984 148
81 3300049586 Ga0501070_0675694 Ga0501070_0675694_10_459 148
82 3300049822 Ga0501035_0577096 Ga0501035_0577096_321_770 148
83 iso_pu_bacteria 2935390628 2935394916 148
84 3300005466 Ga0070685_11048223 Ga0070685_110482231 149
85 3300005471 Ga0070698_101569739 Ga0070698_1015697391 149
86 3300009551 Ga0105238_11756514 Ga0105238_117565141 149
87 3300031507 Ga0307509_10145311 Ga0307509_101453115 149
88 3300037418 Ga0395900_0130824 Ga0395900_0130824_1399_1848 149
89 3300037466 Ga0395898_0026366 Ga0395898_0026366_408_857 149
90 3300038443 Ga0395901_0090689 Ga0395901_0090689_1440_1889 149
91 3300041512 Ga0451853_1609868 Ga0451853_1609868_204_653 149
92 3300044656 Ga0466969_0001522 Ga0466969_0001522_8775_9227 149
93 3300044684 Ga0466966_0002430 Ga0466966_0002430_3754_4206 149
94 3300044684 Ga0466966_0078559 Ga0466966_0078559_919_1404 149
95 3300044693 Ga0466961_0022130 Ga0466961_0022130_1971_2456 149
96 3300044693 Ga0466961_0049747 Ga0466961_0049747_1123_1575 149
97 3300044693 Ga0466961_0191914 Ga0466961_0191914_397_849 149
98 3300044694 Ga0466963_0429291 Ga0466963_0429291_266_751 149
99 3300044706 Ga0466964_0615364 Ga0466964_0615364_70_522 149
100 3300044719 Ga0466971_0015607 Ga0466971_0015607_749_1234 149
101 3300045049 Ga0466959_0106300 Ga0466959_0106300_465_950 149
102 3300046454 Ga0495592_0100220 Ga0495592_0100220_893_1369 149
103 3300046462 Ga0495651_0011850 Ga0495651_0011850_1244_1720 149
104 3300046463 Ga0495653_0013162 Ga0495653_0013162_2823_3299 149
105 3300046472 Ga0495580_0036732 Ga0495580_0036732_498_974 149
106 3300046476 Ga0495662_0033297 Ga0495662_0033297_633_1109 149
107 3300046477 Ga0495664_0005989 Ga0495664_0005989_1249_1725 149
108 3300046499 Ga0495594_0824883 Ga0495594_0824883_40_492 149
109 3300046511 Ga0495608_0004844 Ga0495608_0004844_3446_3922 149
110 3300046514 Ga0495618_0200049 Ga0495618_0200049_554_1030 149
111 3300046516 Ga0495628_0001124 Ga0495628_0001124_22926_23402 149
112 3300046526 Ga0495666_0006831 Ga0495666_0006831_1014_1490 149
113 3300046529 Ga0495652_0009670 Ga0495652_0009670_1802_2278 149
114 3300046529 Ga0495652_0389085 Ga0495652_0389085_314_802 149
115 3300046531 Ga0495665_0017077 Ga0495665_0017077_647_1123 149
116 3300046535 Ga0495586_0064667 Ga0495586_0064667_1065_1541 149
117 3300046536 Ga0495587_0036903 Ga0495587_0036903_697_1173 149
118 3300046543 Ga0495645_0004582 Ga0495645_0004582_6215_6691 149
119 3300046543 Ga0495645_0380248 Ga0495645_0380248_82_570 149
120 3300046559 Ga0495667_0004962 Ga0495667_0004962_5211_5687 149
121 3300046642 Ga0495634_0137011 Ga0495634_0137011_448_924 149
122 3300046663 Ga0495635_0008663 Ga0495635_0008663_1802_2278 149
123 3300046675 Ga0495657_0021068 Ga0495657_0021068_3320_3796 149
124 3300046678 Ga0495599_0113257 Ga0495599_0113257_320_796 149
125 3300046679 Ga0495623_0022571 Ga0495623_0022571_1802_2278 149
126 3300046689 Ga0495613_0006485 Ga0495613_0006485_3185_3661 149
127 3300046809 Ga0495600_0073066 Ga0495600_0073066_893_1369 149
128 3300047315 Ga0495581_0008471 Ga0495581_0008471_5041_5517 149
129 3300047317 Ga0495604_0001340 Ga0495604_0001340_2113_2589 149
130 3300047319 Ga0495674_0005859 Ga0495674_0005859_5625_6101 149
131 3300047444 Ga0495675_0025280 Ga0495675_0025280_1509_1985 149
132 3300047444 Ga0495675_0030332 Ga0495675_0030332_2642_3130 149
133 3300047471 Ga0495684_0017701 Ga0495684_0017701_3446_3922 149
134 3300047472 Ga0495686_0001711 Ga0495686_0001711_3167_3616 149
135 3300047673 Ga0495593_0042925 Ga0495593_0042925_681_1157 149
136 3300048088 Ga0495602_0025604 Ga0495602_0025604_2680_3156 149
137 3300053077 Ga0495601_0004280 Ga0495601_0004280_2779_3255 149
138 3300053085 Ga0495619_0030021 Ga0495619_0030021_612_1088 149
139 3300061719 Ga0466962_0009245 Ga0466962_0009245_1705_2190 149
140 3300001989 JGI24739J22299_10011660 JGI24739J22299_100116604 150
141 3300002067 JGI24735J21928_10022149 JGI24735J21928_100221493 150
142 3300003322 rootL2_10007292 rootL2_100072923 150
143 3300003323 rootH1_10014055 rootH1_1001405510 150
144 3300003323 rootH1_10154390 rootH1_101543901 150
145 3300003578 Ga0006562J51391_1020916 Ga0006562J51391_10209165 150
146 3300003578 Ga0006562J51391_1020917 Ga0006562J51391_10209173 150
147 3300005344 Ga0070661_101335765 Ga0070661_1013357651 150
148 3300005458 Ga0070681_11215173 Ga0070681_112151731 150
149 3300005548 Ga0070665_100638590 Ga0070665_1006385902 150
150 3300005614 Ga0068856_100250444 Ga0068856_1002504443 150
151 3300005937 Ga0081455_10049072 Ga0081455_100490724 150
152 3300006048 Ga0075363_100074544 Ga0075363_1000745442 150
153 3300006178 Ga0075367_10008260 Ga0075367_100082604 150
154 3300006353 Ga0075370_10205417 Ga0075370_102054174 150
155 3300006353 Ga0075370_10920518 Ga0075370_109205181 150
156 3300009011 Ga0105251_10010014 Ga0105251_100100146 150
157 3300009092 Ga0105250_10051640 Ga0105250_100516401 150
158 3300009098 Ga0105245_10070926 Ga0105245_100709264 150
159 3300009174 Ga0105241_10545068 Ga0105241_105450682 150
160 3300011119 Ga0105246_10022892 Ga0105246_100228922 150
161 3300011119 Ga0105246_12356033 Ga0105246_123560331 150
162 3300013105 Ga0157369_10079691 Ga0157369_100796914 150
163 3300014497 Ga0182008_10004686 Ga0182008_100046864 150
164 3300015261 Ga0182006_1028681 Ga0182006_10286815 150
165 3300015262 Ga0182007_10006733 Ga0182007_100067333 150
166 3300025297 Ga0209758_1053550 Ga0209758_10535502 150
167 3300025302 Ga0207426_1006340 Ga0207426_10063402 150
168 3300025302 Ga0207426_1009606 Ga0207426_10096064 150
169 3300025711 Ga0207696_1041246 Ga0207696_10412463 150
170 3300025735 Ga0207713_1025636 Ga0207713_10256361 150
171 3300025904 Ga0207647_10029484 Ga0207647_100294843 150
172 3300025925 Ga0207650_10370416 Ga0207650_103704162 150
173 3300025927 Ga0207687_10328171 Ga0207687_103281712 150
174 3300027312 Ga0209371_1022176 Ga0209371_10221764 150
175 3300028786 Ga0307517_10002248 Ga0307517_1000224826 150
176 3300028794 Ga0307515_10001897 Ga0307515_1000189732 150
177 3300028794 Ga0307515_10101954 Ga0307515_101019544 150
178 3300028794 Ga0307515_10761317 Ga0307515_107613171 150
179 3300030500 Ga0268256_1024959 Ga0268256_10249594 150
180 3300030521 Ga0307511_10006642 Ga0307511_100066422 150
181 3300030522 Ga0307512_10011226 Ga0307512_100112267 150
182 3300030522 Ga0307512_10018422 Ga0307512_100184222 150
183 3300030522 Ga0307512_10310982 Ga0307512_103109821 150
184 3300031456 Ga0307513_10095693 Ga0307513_100956935 150
185 3300031507 Ga0307509_10102733 Ga0307509_101027332 150
186 3300031548 Ga0307408_101036230 Ga0307408_1010362302 150
187 3300031616 Ga0307508_10031345 Ga0307508_100313455 150
188 3300031616 Ga0307508_10220119 Ga0307508_102201192 150
189 3300031616 Ga0307508_10550629 Ga0307508_105506292 150
190 3300031649 Ga0307514_10287683 Ga0307514_102876832 150
191 3300031649 Ga0307514_10317622 Ga0307514_103176222 150
192 3300031730 Ga0307516_10012550 Ga0307516_1001255010 150
193 3300031838 Ga0307518_10040229 Ga0307518_100402292 150
194 3300031838 Ga0307518_10185534 Ga0307518_101855342 150
195 3300033179 Ga0307507_10009069 Ga0307507_100090698 150
196 3300033179 Ga0307507_10317487 Ga0307507_103174872 150
197 3300033179 Ga0307507_10350215 Ga0307507_103502152 150
198 3300033180 Ga0307510_10018408 Ga0307510_1001840810 150
199 3300033180 Ga0307510_10112163 Ga0307510_101121635 150
200 3300033180 Ga0307510_10346108 Ga0307510_103461082 150
201 3300041459 Ga0451800_1639784 Ga0451800_1639784_62_514 150
202 3300041498 Ga0451841_0330448 Ga0451841_0330448_523_975 150
203 3300041505 Ga0451849_0112419 Ga0451849_0112419_465_917 150
204 3300041507 Ga0451851_0489528 Ga0451851_0489528_217_669 150
205 3300041512 Ga0451853_1418287 Ga0451853_1418287_1754_2206 150
206 3300041512 Ga0451853_2445157 Ga0451853_2445157_2906_3358 150
207 3300042007 Ga0439449_0006827 Ga0439449_0006827_1969_2421 150
208 3300042014 Ga0439457_065447 Ga0439457_065447_132_584 150
209 3300042131 Ga0450894_000469 Ga0450894_000469_641_1093 150
210 3300042132 Ga0450895_001743 Ga0450895_001743_286_738 150
211 3300042133 Ga0450896_000106 Ga0450896_000106_4713_5165 150
212 3300042134 Ga0450898_000563 Ga0450898_000563_485_937 150
213 3300042135 Ga0450899_001353 Ga0450899_001353_1741_2193 150
214 3300042138 Ga0450903_001178 Ga0450903_001178_1378_1830 150
215 3300042138 Ga0450903_008536 Ga0450903_008536_340_798 150
216 3300042145 Ga0450906_005126 Ga0450906_005126_1904_2356 150
217 3300042157 Ga0439458_0002293 Ga0439458_0002293_3129_3581 150
218 3300042157 Ga0439458_0043027 Ga0439458_0043027_461_913 150
219 3300042184 Ga0450908_011632 Ga0450908_011632_347_799 150
220 3300044656 Ga0466969_0043040 Ga0466969_0043040_422_877 150
221 3300044658 Ga0466972_0010134 Ga0466972_0010134_1410_1865 150
222 3300044658 Ga0466972_0024615 Ga0466972_0024615_1727_2179 150
223 3300044658 Ga0466972_0057751 Ga0466972_0057751_859_1314 150
224 3300044658 Ga0466972_0196731 Ga0466972_0196731_156_611 150
225 3300044683 Ga0466965_0016619 Ga0466965_0016619_2780_3232 150
226 3300044683 Ga0466965_0065937 Ga0466965_0065937_695_1150 150
227 3300044684 Ga0466966_0003728 Ga0466966_0003728_2550_3005 150
228 3300044684 Ga0466966_0010844 Ga0466966_0010844_3411_3863 150
229 3300044693 Ga0466961_0003156 Ga0466961_0003156_8514_8966 150
230 3300044693 Ga0466961_0011629 Ga0466961_0011629_4306_4761 150
231 3300044694 Ga0466963_0000957 Ga0466963_0000957_4259_4711 150
232 3300044694 Ga0466963_0006510 Ga0466963_0006510_5890_6345 150
233 3300044694 Ga0466963_0021923 Ga0466963_0021923_638_1093 150
234 3300044694 Ga0466963_0038865 Ga0466963_0038865_2645_3097 150
235 3300044706 Ga0466964_0015454 Ga0466964_0015454_267_719 150
236 3300044706 Ga0466964_0347073 Ga0466964_0347073_86_538 150
237 3300044719 Ga0466971_0162560 Ga0466971_0162560_277_732 150
238 3300044765 Ga0466970_0008565 Ga0466970_0008565_323_799 150
239 3300044765 Ga0466970_0085712 Ga0466970_0085712_476_928 150
240 3300044765 Ga0466970_0246953 Ga0466970_0246953_497_952 150
241 3300044842 Ga0466957_0016285 Ga0466957_0016285_2599_3051 150
242 3300044842 Ga0466957_0240896 Ga0466957_0240896_409_864 150
243 3300044901 Ga0466960_0156298 Ga0466960_0156298_486_941 150
244 3300045049 Ga0466959_0021835 Ga0466959_0021835_305_757 150
245 3300045049 Ga0466959_0381969 Ga0466959_0381969_422_877 150
246 3300045836 Ga0466958_0021709 Ga0466958_0021709_651_1103 150
247 3300045976 Ga0466967_0046949 Ga0466967_0046949_2941_3393 150
248 3300045976 Ga0466967_0941244 Ga0466967_0941244_163_615 150
249 3300046452 Ga0495617_030494 Ga0495617_030494_948_1400 150
250 3300046453 Ga0495627_025594 Ga0495627_025594_546_998 150
251 3300046454 Ga0495592_0029582 Ga0495592_0029582_488_940 150
252 3300046454 Ga0495592_0040174 Ga0495592_0040174_1494_1946 150
253 3300046455 Ga0495603_0026701 Ga0495603_0026701_24_476 150
254 3300046455 Ga0495603_0146297 Ga0495603_0146297_348_800 150
255 3300046455 Ga0495603_0162172 Ga0495603_0162172_413_865 150
256 3300046457 Ga0495590_0029568 Ga0495590_0029568_1428_1880 150
257 3300046459 Ga0495629_0005008 Ga0495629_0005008_285_737 150
258 3300046459 Ga0495629_0154578 Ga0495629_0154578_822_1274 150
259 3300046460 Ga0495638_0207122 Ga0495638_0207122_267_719 150
260 3300046462 Ga0495651_0001402 Ga0495651_0001402_15366_15818 150
261 3300046462 Ga0495651_0072771 Ga0495651_0072771_1766_2218 150
262 3300046463 Ga0495653_0311163 Ga0495653_0311163_338_790 150
263 3300046473 Ga0495582_0060722 Ga0495582_0060722_1366_1818 150
264 3300046473 Ga0495582_0167790 Ga0495582_0167790_433_885 150
265 3300046474 Ga0495605_0055468 Ga0495605_0055468_770_1222 150
266 3300046474 Ga0495605_0100549 Ga0495605_0100549_158_610 150
267 3300046474 Ga0495605_0208343 Ga0495605_0208343_324_776 150
268 3300046475 Ga0495639_0022765 Ga0495639_0022765_772_1224 150
269 3300046475 Ga0495639_0204674 Ga0495639_0204674_186_638 150
270 3300046476 Ga0495662_0000039 Ga0495662_0000039_27648_28100 150
271 3300046476 Ga0495662_0025273 Ga0495662_0025273_2337_2789 150
272 3300046476 Ga0495662_0218371 Ga0495662_0218371_265_717 150
273 3300046477 Ga0495664_0001560 Ga0495664_0001560_8281_8733 150
274 3300046477 Ga0495664_0641831 Ga0495664_0641831_114_566 150
275 3300046492 Ga0495585_0146295 Ga0495585_0146295_58_510 150
276 3300046499 Ga0495594_0049497 Ga0495594_0049497_1426_1878 150
277 3300046499 Ga0495594_0269746 Ga0495594_0269746_23_475 150
278 3300046499 Ga0495594_0392155 Ga0495594_0392155_32_484 150
279 3300046501 Ga0495607_0024376 Ga0495607_0024376_697_1149 150
280 3300046506 Ga0495583_0025119 Ga0495583_0025119_2206_2658 150
281 3300046506 Ga0495583_0189727 Ga0495583_0189727_325_777 150
282 3300046507 Ga0495606_0042550 Ga0495606_0042550_742_1194 150
283 3300046507 Ga0495606_0510999 Ga0495606_0510999_104_556 150
284 3300046511 Ga0495608_0135746 Ga0495608_0135746_375_827 150
285 3300046511 Ga0495608_0384995 Ga0495608_0384995_171_623 150
286 3300046513 Ga0495616_0018387 Ga0495616_0018387_763_1215 150
287 3300046515 Ga0495620_0001872 Ga0495620_0001872_11206_11658 150
288 3300046515 Ga0495620_0174093 Ga0495620_0174093_324_776 150
289 3300046515 Ga0495620_0350674 Ga0495620_0350674_21_473 150
290 3300046515 Ga0495620_0360099 Ga0495620_0360099_23_475 150
291 3300046516 Ga0495628_0021408 Ga0495628_0021408_1052_1504 150
292 3300046516 Ga0495628_0133203 Ga0495628_0133203_1220_1672 150
293 3300046517 Ga0495630_0455912 Ga0495630_0455912_307_759 150
294 3300046522 Ga0495643_0006297 Ga0495643_0006297_706_1158 150
295 3300046522 Ga0495643_0246011 Ga0495643_0246011_189_641 150
296 3300046524 Ga0495648_0057012 Ga0495648_0057012_693_1145 150
297 3300046526 Ga0495666_0011232 Ga0495666_0011232_3068_3520 150
298 3300046529 Ga0495652_0023121 Ga0495652_0023121_3372_3824 150
299 3300046530 Ga0495654_0051553 Ga0495654_0051553_560_1012 150
300 3300046533 Ga0495640_0025755 Ga0495640_0025755_701_1153 150
301 3300046535 Ga0495586_0021896 Ga0495586_0021896_2326_2778 150
302 3300046535 Ga0495586_0080684 Ga0495586_0080684_261_713 150
303 3300046538 Ga0495609_0020901 Ga0495609_0020901_1872_2324 150
304 3300046542 Ga0495597_0108213 Ga0495597_0108213_393_845 150
305 3300046543 Ga0495645_0021671 Ga0495645_0021671_864_1316 150
306 3300046543 Ga0495645_0630419 Ga0495645_0630419_158_610 150
307 3300046557 Ga0495622_0058996 Ga0495622_0058996_1182_1634 150
308 3300046557 Ga0495622_0090396 Ga0495622_0090396_482_934 150
309 3300046557 Ga0495622_0106326 Ga0495622_0106326_110_562 150
310 3300046558 Ga0495633_0040675 Ga0495633_0040675_734_1186 150
311 3300046615 Ga0495656_0007263 Ga0495656_0007263_230_682 150
312 3300046616 Ga0495668_0083190 Ga0495668_0083190_979_1431 150
313 3300046642 Ga0495634_0174497 Ga0495634_0174497_532_984 150
314 3300046660 Ga0495625_0010562 Ga0495625_0010562_3102_3554 150
315 3300046660 Ga0495625_0081511 Ga0495625_0081511_1615_2067 150
316 3300046660 Ga0495625_0156742 Ga0495625_0156742_1018_1470 150
317 3300046660 Ga0495625_0354366 Ga0495625_0354366_242_694 150
318 3300046660 Ga0495625_0850930 Ga0495625_0850930_58_510 150
319 3300046663 Ga0495635_0074129 Ga0495635_0074129_1233_1685 150
320 3300046665 Ga0495661_0021151 Ga0495661_0021151_3097_3549 150
321 3300046674 Ga0495588_0007513 Ga0495588_0007513_646_1098 150
322 3300046674 Ga0495588_0094612 Ga0495588_0094612_567_1019 150
323 3300046674 Ga0495588_0221098 Ga0495588_0221098_201_653 150
324 3300046675 Ga0495657_0009083 Ga0495657_0009083_5549_6001 150
325 3300046678 Ga0495599_0206969 Ga0495599_0206969_690_1142 150
326 3300046679 Ga0495623_0290225 Ga0495623_0290225_444_896 150
327 3300046680 Ga0495646_0000605 Ga0495646_0000605_3854_4306 150
328 3300046680 Ga0495646_0134272 Ga0495646_0134272_473_925 150
329 3300046689 Ga0495613_0007081 Ga0495613_0007081_182_634 150
330 3300046689 Ga0495613_0037030 Ga0495613_0037030_2866_3318 150
331 3300046689 Ga0495613_0160860 Ga0495613_0160860_995_1447 150
332 3300046689 Ga0495613_0229689 Ga0495613_0229689_560_1012 150
333 3300046690 Ga0495624_0122380 Ga0495624_0122380_671_1123 150
334 3300046690 Ga0495624_0406205 Ga0495624_0406205_127_579 150
335 3300046691 Ga0495670_0103230 Ga0495670_0103230_480_932 150
336 3300046692 Ga0495671_0167261 Ga0495671_0167261_241_693 150
337 3300046694 Ga0495649_0114629 Ga0495649_0114629_365_817 150
338 3300046794 Ga0495589_0023713 Ga0495589_0023713_2644_3096 150
339 3300046794 Ga0495589_0064548 Ga0495589_0064548_835_1287 150
340 3300046794 Ga0495589_0100173 Ga0495589_0100173_705_1157 150
341 3300046794 Ga0495589_0119339 Ga0495589_0119339_110_562 150
342 3300046809 Ga0495600_0015114 Ga0495600_0015114_3798_4250 150
343 3300046809 Ga0495600_0239975 Ga0495600_0239975_297_749 150
344 3300046810 Ga0495660_0041166 Ga0495660_0041166_412_864 150
345 3300046810 Ga0495660_0067627 Ga0495660_0067627_102_554 150
346 3300047315 Ga0495581_0076201 Ga0495581_0076201_1154_1606 150
347 3300047315 Ga0495581_0098149 Ga0495581_0098149_864_1316 150
348 3300047315 Ga0495581_0155770 Ga0495581_0155770_597_1049 150
349 3300047317 Ga0495604_0362115 Ga0495604_0362115_247_699 150
350 3300047318 Ga0495636_0072780 Ga0495636_0072780_238_690 150
351 3300047318 Ga0495636_0164295 Ga0495636_0164295_456_908 150
352 3300047318 Ga0495636_0192147 Ga0495636_0192147_451_903 150
353 3300047318 Ga0495636_0214223 Ga0495636_0214223_131_583 150
354 3300047318 Ga0495636_0258699 Ga0495636_0258699_284_736 150
355 3300047319 Ga0495674_0415562 Ga0495674_0415562_278_730 150
356 3300047320 Ga0495672_0080858 Ga0495672_0080858_674_1126 150
357 3300047321 Ga0495676_0043154 Ga0495676_0043154_654_1106 150
358 3300047321 Ga0495676_0054130 Ga0495676_0054130_1166_1618 150
359 3300047321 Ga0495676_0191871 Ga0495676_0191871_541_993 150
360 3300047322 Ga0495680_0043327 Ga0495680_0043327_239_691 150
361 3300047323 Ga0495683_0256675 Ga0495683_0256675_170_622 150
362 3300047443 Ga0495687_002749 Ga0495687_002749_9570_10022 150
363 3300047443 Ga0495687_027772 Ga0495687_027772_1955_2407 150
364 3300047443 Ga0495687_067923 Ga0495687_067923_724_1176 150
365 3300047444 Ga0495675_0005789 Ga0495675_0005789_4591_5043 150
366 3300047444 Ga0495675_0164823 Ga0495675_0164823_657_1109 150
367 3300047444 Ga0495675_0429947 Ga0495675_0429947_104_556 150
368 3300047447 Ga0495685_018341 Ga0495685_018341_276_728 150
369 3300047447 Ga0495685_042964 Ga0495685_042964_1079_1531 150
370 3300047447 Ga0495685_095087 Ga0495685_095087_209_661 150
371 3300047447 Ga0495685_160023 Ga0495685_160023_182_634 150
372 3300047470 Ga0495681_0001709 Ga0495681_0001709_5103_5627 150
373 3300047470 Ga0495681_0084660 Ga0495681_0084660_488_940 150
374 3300047470 Ga0495681_0175939 Ga0495681_0175939_367_819 150
375 3300047472 Ga0495686_0034412 Ga0495686_0034412_189_641 150
376 3300047472 Ga0495686_0254138 Ga0495686_0254138_431_883 150
377 3300047673 Ga0495593_0117687 Ga0495593_0117687_264_716 150
378 3300048088 Ga0495602_0140524 Ga0495602_0140524_1138_1590 150
379 3300048088 Ga0495602_0467570 Ga0495602_0467570_394_846 150
380 3300048089 Ga0495614_0000938 Ga0495614_0000938_8990_9442 150
381 3300048089 Ga0495614_0006161 Ga0495614_0006161_1447_1899 150
382 3300048089 Ga0495614_0214989 Ga0495614_0214989_202_654 150
383 3300048091 Ga0495626_0084312 Ga0495626_0084312_630_1082 150
384 3300048907 Ga0496104_0364416 Ga0496104_0364416_569_1021 150
385 3300048908 Ga0496105_0401674 Ga0496105_0401674_117_569 150
386 3300048910 Ga0496107_0527454 Ga0496107_0527454_241_849 150
387 3300048911 Ga0496108_0047129 Ga0496108_0047129_2811_3263 150
388 3300048912 Ga0496109_0076090 Ga0496109_0076090_1331_1939 150
389 3300049459 Ga0495678_084334 Ga0495678_084334_445_897 150
390 3300049460 Ga0495682_0047951 Ga0495682_0047951_1037_1489 150
391 3300049568 Ga0501031_0065920 Ga0501031_0065920_458_913 150
392 3300049569 Ga0501032_0081247 Ga0501032_0081247_209_661 150
393 3300049569 Ga0501032_0106060 Ga0501032_0106060_345_800 150
394 3300049569 Ga0501032_0254580 Ga0501032_0254580_499_951 150
395 3300049570 Ga0501033_0071280 Ga0501033_0071280_646_1098 150
396 3300049570 Ga0501033_0149407 Ga0501033_0149407_832_1287 150
397 3300049570 Ga0501033_0278697 Ga0501033_0278697_374_826 150
398 3300049570 Ga0501033_0331707 Ga0501033_0331707_407_859 150
399 3300049571 Ga0501034_0006593 Ga0501034_0006593_2545_2997 150
400 3300049571 Ga0501034_0209390 Ga0501034_0209390_237_692 150
401 3300049571 Ga0501034_0464910 Ga0501034_0464910_173_625 150
402 3300049571 Ga0501034_0975093 Ga0501034_0975093_261_716 150
403 3300049572 Ga0501036_0037447 Ga0501036_0037447_2522_2974 150
404 3300049572 Ga0501036_0183634 Ga0501036_0183634_52_504 150
405 3300049573 Ga0501037_0034831 Ga0501037_0034831_3041_3496 150
406 3300049573 Ga0501037_0039709 Ga0501037_0039709_284_739 150
407 3300049573 Ga0501037_0425577 Ga0501037_0425577_233_685 150
408 3300049573 Ga0501037_0570441 Ga0501037_0570441_277_729 150
409 3300049573 Ga0501037_0907690 Ga0501037_0907690_35_487 150
410 3300049574 Ga0501038_0060289 Ga0501038_0060289_2564_3016 150
411 3300049574 Ga0501038_0076521 Ga0501038_0076521_464_919 150
412 3300049574 Ga0501038_0316145 Ga0501038_0316145_495_947 150
413 3300049575 Ga0501039_0046430 Ga0501039_0046430_668_1120 150
414 3300049575 Ga0501039_0181754 Ga0501039_0181754_186_641 150
415 3300049575 Ga0501039_0492659 Ga0501039_0492659_245_697 150
416 3300049578 Ga0501042_0051940 Ga0501042_0051940_936_1391 150
417 3300049579 Ga0501043_0255990 Ga0501043_0255990_549_1001 150
418 3300049580 Ga0501046_0039312 Ga0501046_0039312_1397_1852 150
419 3300049580 Ga0501046_0583286 Ga0501046_0583286_304_759 150
420 3300049581 Ga0501047_0013451 Ga0501047_0013451_6804_7259 150
421 3300049581 Ga0501047_0318857 Ga0501047_0318857_713_1165 150
422 3300049581 Ga0501047_0725585 Ga0501047_0725585_159_611 150
423 3300049582 Ga0501048_0012919 Ga0501048_0012919_5359_5814 150
424 3300049582 Ga0501048_0339089 Ga0501048_0339089_371_826 150
425 3300049583 Ga0501067_0770112 Ga0501067_0770112_42_494 150
426 3300049586 Ga0501070_0050464 Ga0501070_0050464_1482_1934 150
427 3300049586 Ga0501070_0211943 Ga0501070_0211943_68_523 150
428 3300049586 Ga0501070_0527280 Ga0501070_0527280_143_595 150
429 3300049586 Ga0501070_0618823 Ga0501070_0618823_185_637 150
430 3300049587 Ga0501071_0525603 Ga0501071_0525603_391_843 150
431 3300049589 Ga0501073_0056713 Ga0501073_0056713_1685_2137 150
432 3300049590 Ga0501074_0001056 Ga0501074_0001056_13499_13951 150
433 3300049742 Ga0501080_0584927 Ga0501080_0584927_232_687 150
434 3300049822 Ga0501035_0037723 Ga0501035_0037723_2591_3046 150
435 3300049822 Ga0501035_0082515 Ga0501035_0082515_1016_1468 150
436 3300049822 Ga0501035_0171319 Ga0501035_0171319_378_830 150
437 3300049822 Ga0501035_0171324 Ga0501035_0171324_1050_1502 150
438 3300049822 Ga0501035_0293258 Ga0501035_0293258_644_1096 150
439 3300049823 Ga0501044_0029838 Ga0501044_0029838_376_828 150
440 3300049823 Ga0501044_0330417 Ga0501044_0330417_526_981 150
441 3300049823 Ga0501044_0759081 Ga0501044_0759081_20_475 150
442 3300049824 Ga0501045_0132674 Ga0501045_0132674_1157_1609 150
443 3300049824 Ga0501045_0719199 Ga0501045_0719199_209_664 150
444 3300050490 nmdc:mga03n38_108653_c1 nmdc:mga03n38_108653_c1_233_685 150
445 3300050490 nmdc:mga03n38_183796_c1 nmdc:mga03n38_183796_c1_465_917 150
446 3300050494 nmdc:mga06z11_4831_c1 nmdc:mga06z11_4831_c1_2784_3236 150
447 3300053079 Ga0500610_0161031 Ga0500610_0161031_544_996 150
448 3300053080 Ga0500635_0118403 Ga0500635_0118403_498_950 150
449 3300053086 Ga0500578_0224682 Ga0500578_0224682_68_520 150
450 3300053095 Ga0500640_026758 Ga0500640_026758_1756_2208 150
451 3300053096 Ga0500641_0031844 Ga0500641_0031844_208_660 150
452 3300053107 Ga0500560_000044 Ga0500560_000044_3118_3570 150
453 3300053111 Ga0500572_004725 Ga0500572_004725_1257_1709 150
454 3300053123 Ga0500614_029287 Ga0500614_029287_686_1138 150
455 3300053140 Ga0500573_0305951 Ga0500573_0305951_113_565 150
456 3300053157 Ga0500624_004805 Ga0500624_004805_1142_1594 150
457 3300053160 Ga0500633_0263370 Ga0500633_0263370_114_566 150
458 3300060353 Ga0501082_1271817 Ga0501082_1271817_159_614 150
459 3300061719 Ga0466962_0004114 Ga0466962_0004114_5911_6363 150
460 3300061719 Ga0466962_0042214 Ga0466962_0042214_373_828 150
461 3300005435 Ga0070714_101403813 Ga0070714_1014038132 151
462 3300006038 Ga0075365_10134791 Ga0075365_101347913 151
463 3300009036 Ga0105244_10150753 Ga0105244_101507532 151
464 3300009092 Ga0105250_10257411 Ga0105250_102574112 151
465 3300011119 Ga0105246_10584441 Ga0105246_105844413 151
466 3300028794 Ga0307515_10446540 Ga0307515_104465402 151
467 3300031456 Ga0307513_10144890 Ga0307513_101448903 151
468 3300031616 Ga0307508_10224302 Ga0307508_102243021 151
469 3300031852 Ga0307410_11279396 Ga0307410_112793961 151
470 3300032002 Ga0307416_100757339 Ga0307416_1007573392 151
471 3300042136 Ga0450900_014387 Ga0450900_014387_108_572 151
472 3300046499 Ga0495594_0290687 Ga0495594_0290687_256_714 151
473 3300046674 Ga0495588_0351901 Ga0495588_0351901_196_654 151
474 3300046679 Ga0495623_0124655 Ga0495623_0124655_701_1159 151
475 3300047317 Ga0495604_0013361 Ga0495604_0013361_3031_3489 151
476 3300047444 Ga0495675_0141588 Ga0495675_0141588_791_1249 151
477 3300047444 Ga0495675_0528159 Ga0495675_0528159_111_569 151
478 3300048911 Ga0496108_0864834 Ga0496108_0864834_270_728 151
479 3300048916 Ga0496113_0483364 Ga0496113_0483364_180_638 151
480 iso_pu_bacteria 2643221601 2644014511 151
481 iso_pu_bacteria 2643221714 2644633316 151
482 iso_pu_bacteria 2946072368 2946077080 151
483 3300004799 Ga0058863_11947591 Ga0058863_119475912 152
484 3300004800 Ga0058861_12038154 Ga0058861_120381543 152
485 3300005530 Ga0070679_100221328 Ga0070679_1002213282 152
486 3300049570 Ga0501033_0624489 Ga0501033_0624489_100_597 152
487 3300049571 Ga0501034_0769220 Ga0501034_0769220_155_652 152
488 3300049573 Ga0501037_0021280 Ga0501037_0021280_3156_3653 152
489 3300049574 Ga0501038_0501072 Ga0501038_0501072_179_676 152
490 3300049579 Ga0501043_0079722 Ga0501043_0079722_1950_2447 152
491 3300049822 Ga0501035_0105935 Ga0501035_0105935_1666_2163 152
492 iso_pu_bacteria 2862705112 2862709767 152
493 iso_pu_bacteria 2990044586 2990047429 152
494 iso_pu_bacteria 8008485437 8008490464 152
495 iso_pu_bacteria 8025524527 8025529766 152
496 3300003792 Ga0055540_1011466 Ga0055540_10114666 153
497 3300006038 Ga0075365_10088257 Ga0075365_100882575 153
498 3300006186 Ga0075369_10276500 Ga0075369_102765002 153
499 3300006353 Ga0075370_10445662 Ga0075370_104456622 153
500 3300025303 Ga0209051_1001489 Ga0209051_100148918 153
501 3300050492 nmdc:mga0yw44_74996_c1 nmdc:mga0yw44_74996_c1_477_953 153
502 3300050496 nmdc:mga07m45_210088_c1 nmdc:mga07m45_210088_c1_181_657 153
503 3300009093 Ga0105240_10053636 Ga0105240_100536363 154
504 3300009551 Ga0105238_10738460 Ga0105238_107384602 154
505 3300049570 Ga0501033_0183875 Ga0501033_0183875_872_1417 154
506 iso_pu_bacteria 2808606359 2808843289 154
507 iso_pu_bacteria 2939582691 2939586759 154
508 3300005456 Ga0070678_101501135 Ga0070678_1015011351 155
509 3300005543 Ga0070672_100144409 Ga0070672_1001444094 155
510 3300009098 Ga0105245_11314485 Ga0105245_113144852 155
511 3300009148 Ga0105243_10038845 Ga0105243_100388452 155
512 3300011119 Ga0105246_11216591 Ga0105246_112165912 155
513 3300046454 Ga0495592_0038013 Ga0495592_0038013_1291_1761 155
514 3300046455 Ga0495603_0300097 Ga0495603_0300097_380_850 155
515 3300046459 Ga0495629_0098282 Ga0495629_0098282_1553_2023 155
516 3300046462 Ga0495651_0152601 Ga0495651_0152601_426_896 155
517 3300046477 Ga0495664_0410246 Ga0495664_0410246_52_522 155
518 3300046499 Ga0495594_0244581 Ga0495594_0244581_65_535 155
519 3300046516 Ga0495628_0017262 Ga0495628_0017262_4445_4915 155
520 3300046526 Ga0495666_0145425 Ga0495666_0145425_496_966 155
521 3300046529 Ga0495652_0064037 Ga0495652_0064037_2423_2893 155
522 3300046533 Ga0495640_0057922 Ga0495640_0057922_1104_1574 155
523 3300046559 Ga0495667_0027757 Ga0495667_0027757_297_767 155
524 3300046642 Ga0495634_0080193 Ga0495634_0080193_202_672 155
525 3300046675 Ga0495657_0038438 Ga0495657_0038438_102_572 155
526 3300046678 Ga0495599_0749652 Ga0495599_0749652_51_521 155
527 3300046689 Ga0495613_0004137 Ga0495613_0004137_320_790 155
528 3300046690 Ga0495624_0151132 Ga0495624_0151132_500_970 155
529 3300046809 Ga0495600_0027958 Ga0495600_0027958_495_965 155
530 3300047315 Ga0495581_0150459 Ga0495581_0150459_541_1011 155
531 3300047317 Ga0495604_0036315 Ga0495604_0036315_2067_2537 155
532 3300047321 Ga0495676_0003054 Ga0495676_0003054_13204_13674 155
533 3300047444 Ga0495675_0034826 Ga0495675_0034826_235_705 155
534 3300048089 Ga0495614_0249855 Ga0495614_0249855_102_572 155
535 3300049822 Ga0501035_0489440 Ga0501035_0489440_19_489 155
536 3300049823 Ga0501044_0052436 Ga0501044_0052436_2810_3280 155
537 3300044842 Ga0466957_0481545 Ga0466957_0481545_114_590 156
538 3300045836 Ga0466958_0104809 Ga0466958_0104809_640_1116 156
539 3300049569 Ga0501032_0183684 Ga0501032_0183684_516_1079 156
540 3300049571 Ga0501034_0136853 Ga0501034_0136853_452_1015 156
541 3300049572 Ga0501036_0020178 Ga0501036_0020178_3213_3776 156
542 3300049574 Ga0501038_0043950 Ga0501038_0043950_1843_2406 156
543 3300049575 Ga0501039_0233377 Ga0501039_0233377_641_1186 156
544 3300049579 Ga0501043_0097710 Ga0501043_0097710_302_865 156
545 3300049581 Ga0501047_0073219 Ga0501047_0073219_1001_1564 156
546 3300049586 Ga0501070_0082368 Ga0501070_0082368_1274_1837 156
547 3300049823 Ga0501044_0016943 Ga0501044_0016943_2808_3371 156
548 3300061719 Ga0466962_0171262 Ga0466962_0171262_318_794 156
549 3300046492 Ga0495585_0006093 Ga0495585_0006093_2957_3433 157
550 3300046499 Ga0495594_0174376 Ga0495594_0174376_290_766 157
551 3300046526 Ga0495666_0230884 Ga0495666_0230884_306_782 157
552 3300046533 Ga0495640_0095764 Ga0495640_0095764_1223_1699 157
553 3300046689 Ga0495613_0077848 Ga0495613_0077848_308_784 157
554 3300047317 Ga0495604_0044597 Ga0495604_0044597_834_1310 157
555 3300047321 Ga0495676_0497658 Ga0495676_0497658_290_766 157
556 3300049824 Ga0501045_0163556 Ga0501045_0163556_895_1383 157
557 3300000546 LJNas_1027718 LJNas_10277181 158
558 3300005539 Ga0068853_100079996 Ga0068853_1000799966 158
559 3300025944 Ga0207661_10384874 Ga0207661_103848742 158
560 3300026041 Ga0207639_10022607 Ga0207639_100226076 158
561 3300031852 Ga0307410_10073600 Ga0307410_100736005 158
562 3300031903 Ga0307407_10047708 Ga0307407_100477084 158
563 3300031995 Ga0307409_100054088 Ga0307409_1000540885 158
564 3300032126 Ga0307415_100005650 Ga0307415_1000056509 158
565 3300046463 Ga0495653_0380888 Ga0495653_0380888_329_805 158
566 3300048929 Ga0496126_0296746 Ga0496126_0296746_668_1144 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

36

168

0.93

PF01575

MaoC_dehydratas

MaoC like domain

35

161

0.89

PF22622

MFE-2_hydrat-2_N

MFE-2 hydratase 2 N-terminal domain

48

176

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rv2-assembly1.cif.gz_A-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.9478 7 144
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9471 3 146
5zy8-assembly1.cif.gz_C crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9423 7 144
5zy8-assembly1.cif.gz_A crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9413 7 142
4rv2-assembly1.cif.gz_A-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.9411 7 144
ID Description Score Start End Superfamily
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9478 7 144 3.10.129.10
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9414 4 146 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9411 7 144 3.10.129.10
af_P9WFJ9_1_152_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9223 1 150 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9216 1 157 3.10.129.10
ID Description Score Start End GO Terms
AF-Q0RYL4-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9605 5 147
AF-A0A150A8F5-F1-model_v4 Acyl dehydratase 0.9579 5 147 GO:0006633
GO:0019171
AF-A0A3A4KYV6-F1-model_v4 (R)-hydratase 0.9536 6 146
AF-A0A0Q6JTU2-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.953 5 147 GO:0016836
AF-A0A260BLY3-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9519 5 145

Feature Viewer

pLDDT pTM Quality
87.08 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map