F464388
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 333 | 1132 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10165158|Ga0105239_101651582 |
| Length | 181 |
| Sequence | LTAALGDMVDARARLFLRGKAACADAFPAHPMLALIQRVTRAEVRVADESVGAIGPGLLALVAVEPGDGEPQAQRLCERLLGYRVFDDGDGRMNRSLADTGGGLLLVSQFTLAADTRKGMRPGFSTAATPEVGLRWFNRLAEIAKTCHPQVEIGRYGAHMQIELVNDGPVTFLLVARSQPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 62 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 139 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 147 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 151 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 163 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 164 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 165 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 167 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 168 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 172 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 173 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 179 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 180 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 181 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 182 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 183 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 184 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 185 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 186 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 187 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 188 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 189 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 190 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 193 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 289 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 290 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 294 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 297 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 298 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 303 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 304 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 306 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 313 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 314 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 315 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 316 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 318 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 321 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 322 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 323 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 327 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 328 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 329 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 330 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 331 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 332 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 333 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.23 |
| Metatranscriptomes | 0.35 |
| Isolates | 1.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.24 |
| Nodule | 0 |
| Rhizoplane | 3.53 |
| Rhizosphere | 82.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10165158 | 3300010375 | Bacteria | 2475 |
| 2 | SwRhRL3b_contig_2972607 | 2162886006 | Bacteria | 2084 |
| 3 | JGI25151J46595_10015980 | 3300003187 | Bacteria | 3293 |
| 4 | JGI25406J46586_10003534 | 3300003203 | Bacteria | 7339 |
| 5 | Ga0006562J51391_1026968 | 3300003578 | Bacteria | 14220 |
| 6 | Ga0006562J51391_1026972 | 3300003578 | Bacteria | 9050 |
| 7 | Ga0055536_1013519 | 3300003781 | Bacteria | 2935 |
| 8 | Ga0055530_10004848 | 3300003791 | Bacteria | 6723 |
| 9 | Ga0055531_10023046 | 3300003794 | Bacteria | 2350 |
| 10 | Ga0055531_10031230 | 3300003794 | Bacteria | 1768 |
| 11 | Ga0065704_10093065 | 3300005289 | Bacteria | 2619 |
| 12 | Ga0065715_10132194 | 3300005293 | Bacteria | 1994 |
| 13 | Ga0065715_10552691 | 3300005293 | Bacteria | 739 |
| 14 | Ga0070658_10013000 | 3300005327 | Bacteria | 6680 |
| 15 | Ga0070683_100417513 | 3300005329 | Bacteria | 1280 |
| 16 | Ga0070670_100065955 | 3300005331 | Bacteria | 3106 |
| 17 | Ga0070670_100110501 | 3300005331 | Bacteria | 2368 |
| 18 | Ga0070670_100489414 | 3300005331 | Bacteria | 1093 |
| 19 | Ga0068869_100053777 | 3300005334 | Bacteria | 2928 |
| 20 | Ga0068869_100394469 | 3300005334 | Bacteria | 1137 |
| 21 | Ga0068869_100776897 | 3300005334 | Bacteria | 822 |
| 22 | Ga0070666_10000001 | 3300005335 | Bacteria | 543080 |
| 23 | Ga0070680_100644025 | 3300005336 | Bacteria | 911 |
| 24 | Ga0070682_100659763 | 3300005337 | Bacteria | 834 |
| 25 | Ga0068868_100050204 | 3300005338 | Bacteria | 3275 |
| 26 | Ga0070689_100323480 | 3300005340 | Bacteria | 1288 |
| 27 | Ga0070691_10151167 | 3300005341 | Bacteria | 1190 |
| 28 | Ga0070661_100016152 | 3300005344 | Bacteria | 5270 |
| 29 | Ga0070661_100753317 | 3300005344 | Bacteria | 796 |
| 30 | Ga0070668_100022301 | 3300005347 | Bacteria | 4785 |
| 31 | Ga0070667_100000465 | 3300005367 | Bacteria | 41668 |
| 32 | Ga0070667_100898497 | 3300005367 | Bacteria | 824 |
| 33 | Ga0070667_100994506 | 3300005367 | Bacteria | 782 |
| 34 | Ga0070663_100017743 | 3300005455 | Bacteria | 4652 |
| 35 | Ga0070663_100151336 | 3300005455 | Bacteria | 1779 |
| 36 | Ga0070662_100704968 | 3300005457 | Bacteria | 854 |
| 37 | Ga0070706_100831551 | 3300005467 | Bacteria | 854 |
| 38 | Ga0070699_101929381 | 3300005518 | Bacteria | 540 |
| 39 | Ga0070684_100421023 | 3300005535 | Bacteria | 1233 |
| 40 | Ga0070684_100943987 | 3300005535 | Bacteria | 809 |
| 41 | Ga0068853_100341013 | 3300005539 | Bacteria | 1392 |
| 42 | Ga0068853_100678879 | 3300005539 | Bacteria | 981 |
| 43 | Ga0068853_100962073 | 3300005539 | Bacteria | 821 |
| 44 | Ga0070665_100026645 | 3300005548 | Bacteria | 5820 |
| 45 | Ga0070665_100094508 | 3300005548 | Bacteria | 2994 |
| 46 | Ga0070665_100204427 | 3300005548 | Bacteria | 1975 |
| 47 | Ga0070665_100292763 | 3300005548 | Bacteria | 1630 |
| 48 | Ga0070665_100300367 | 3300005548 | Bacteria | 1608 |
| 49 | Ga0070665_100641034 | 3300005548 | Bacteria | 1075 |
| 50 | Ga0068855_100135814 | 3300005563 | Bacteria | 2806 |
| 51 | Ga0068855_100438241 | 3300005563 | Bacteria | 1427 |
| 52 | Ga0070664_100064937 | 3300005564 | Bacteria | 3113 |
| 53 | Ga0070664_100583636 | 3300005564 | Bacteria | 1036 |
| 54 | Ga0068852_100066547 | 3300005616 | Bacteria | 3147 |
| 55 | Ga0068852_100086798 | 3300005616 | Bacteria | 2790 |
| 56 | Ga0068852_100554300 | 3300005616 | Bacteria | 1150 |
| 57 | Ga0068852_100693768 | 3300005616 | Bacteria | 1028 |
| 58 | Ga0068852_101298173 | 3300005616 | Bacteria | 749 |
| 59 | Ga0068859_100015514 | 3300005617 | Bacteria | 7654 |
| 60 | Ga0068859_100821289 | 3300005617 | Bacteria | 1016 |
| 61 | Ga0068859_101345086 | 3300005617 | Unclassified | 787 |
| 62 | Ga0068864_100053622 | 3300005618 | Bacteria | 3479 |
| 63 | Ga0068851_10009487 | 3300005834 | Bacteria | 4527 |
| 64 | Ga0068851_10078268 | 3300005834 | Bacteria | 1723 |
| 65 | Ga0068851_10195837 | 3300005834 | Bacteria | 1126 |
| 66 | Ga0068863_100060881 | 3300005841 | Bacteria | 3570 |
| 67 | Ga0068863_100104501 | 3300005841 | Bacteria | 2694 |
| 68 | Ga0068863_100944657 | 3300005841 | Bacteria | 863 |
| 69 | Ga0068863_101181979 | 3300005841 | Bacteria | 770 |
| 70 | Ga0068858_100046015 | 3300005842 | Bacteria | 4045 |
| 71 | Ga0068858_100083220 | 3300005842 | Bacteria | 2975 |
| 72 | Ga0068858_101167354 | 3300005842 | Bacteria | 756 |
| 73 | Ga0068860_100040462 | 3300005843 | Bacteria | 4454 |
| 74 | Ga0068860_100354739 | 3300005843 | Bacteria | 1444 |
| 75 | Ga0068862_100000076 | 3300005844 | Bacteria | 117053 |
| 76 | Ga0068862_100067410 | 3300005844 | Bacteria | 3085 |
| 77 | Ga0068862_100703070 | 3300005844 | Bacteria | 979 |
| 78 | Ga0068862_101598105 | 3300005844 | Bacteria | 659 |
| 79 | Ga0081455_10000460 | 3300005937 | Bacteria | 53331 |
| 80 | Ga0081540_1042908 | 3300005983 | Bacteria | 2327 |
| 81 | Ga0081539_10000007 | 3300005985 | Bacteria | 532790 |
| 82 | Ga0075367_10531423 | 3300006178 | Bacteria | 747 |
| 83 | Ga0075366_10000521 | 3300006195 | Bacteria | 17803 |
| 84 | Ga0097621_100090659 | 3300006237 | Bacteria | 2558 |
| 85 | Ga0097621_100168872 | 3300006237 | Bacteria | 1884 |
| 86 | Ga0097621_100173364 | 3300006237 | Bacteria | 1860 |
| 87 | Ga0068871_100046799 | 3300006358 | Bacteria | 3486 |
| 88 | Ga0068871_100049867 | 3300006358 | Bacteria | 3385 |
| 89 | Ga0068871_100122799 | 3300006358 | Bacteria | 2195 |
| 90 | Ga0068871_100255787 | 3300006358 | Bacteria | 1526 |
| 91 | Ga0068871_101700667 | 3300006358 | Bacteria | 598 |
| 92 | Ga0075430_101735460 | 3300006846 | Bacteria | 512 |
| 93 | Ga0068865_100056294 | 3300006881 | Bacteria | 2739 |
| 94 | Ga0097620_100015515 | 3300006931 | Bacteria | 7654 |
| 95 | Ga0097620_100821321 | 3300006931 | Bacteria | 1016 |
| 96 | Ga0097620_101345511 | 3300006931 | Unclassified | 787 |
| 97 | Ga0105251_10006229 | 3300009011 | Bacteria | 7647 |
| 98 | Ga0105244_10018457 | 3300009036 | Bacteria | 3914 |
| 99 | Ga0105244_10051533 | 3300009036 | Bacteria | 2097 |
| 100 | Ga0105244_10231377 | 3300009036 | Bacteria | 865 |
| 101 | Ga0105250_10112934 | 3300009092 | Bacteria | 1113 |
| 102 | Ga0105240_10561322 | 3300009093 | Bacteria | 1262 |
| 103 | Ga0105245_10283426 | 3300009098 | Bacteria | 1620 |
| 104 | Ga0105247_10000804 | 3300009101 | Bacteria | 23935 |
| 105 | Ga0105247_10059220 | 3300009101 | Bacteria | 2371 |
| 106 | Ga0105247_10086053 | 3300009101 | Bacteria | 1988 |
| 107 | Ga0105243_13124911 | 3300009148 | Bacteria | 501 |
| 108 | Ga0105248_10035211 | 3300009177 | Bacteria | 5601 |
| 109 | Ga0105248_10149032 | 3300009177 | Bacteria | 2640 |
| 110 | Ga0105237_10216574 | 3300009545 | Bacteria | 1915 |
| 111 | Ga0105237_10362614 | 3300009545 | Bacteria | 1453 |
| 112 | Ga0105237_10720901 | 3300009545 | Bacteria | 1004 |
| 113 | Ga0105237_11178394 | 3300009545 | Bacteria | 773 |
| 114 | Ga0105238_10000729 | 3300009551 | Bacteria | 34322 |
| 115 | Ga0105238_10159934 | 3300009551 | Bacteria | 2228 |
| 116 | Ga0105238_10219101 | 3300009551 | Bacteria | 1879 |
| 117 | Ga0105239_10001310 | 3300010375 | Bacteria | 33536 |
| 118 | Ga0105239_10152865 | 3300010375 | Bacteria | 2576 |
| 119 | Ga0105239_10226422 | 3300010375 | Bacteria | 2098 |
| 120 | Ga0157317_1004006 | 3300012475 | Bacteria | 943 |
| 121 | Ga0157329_1003994 | 3300012491 | Bacteria | 934 |
| 122 | Ga0157373_10418109 | 3300013100 | Bacteria | 962 |
| 123 | Ga0157371_10010277 | 3300013102 | Bacteria | 7300 |
| 124 | Ga0157370_10031743 | 3300013104 | Bacteria | 5164 |
| 125 | Ga0157370_10228224 | 3300013104 | Bacteria | 1724 |
| 126 | Ga0157370_10919356 | 3300013104 | Bacteria | 794 |
| 127 | Ga0157369_10006959 | 3300013105 | Bacteria | 13044 |
| 128 | Ga0157369_10311131 | 3300013105 | Bacteria | 1638 |
| 129 | Ga0157374_10560897 | 3300013296 | Bacteria | 1150 |
| 130 | Ga0157378_10179126 | 3300013297 | Bacteria | 1993 |
| 131 | Ga0163162_10000310 | 3300013306 | Bacteria | 45072 |
| 132 | Ga0157372_10049630 | 3300013307 | Bacteria | 4667 |
| 133 | Ga0157372_10185943 | 3300013307 | Bacteria | 2406 |
| 134 | Ga0157372_10371636 | 3300013307 | Bacteria | 1666 |
| 135 | Ga0157372_10908423 | 3300013307 | Bacteria | 1021 |
| 136 | Ga0157372_10932414 | 3300013307 | Bacteria | 1007 |
| 137 | Ga0157375_10172013 | 3300013308 | Bacteria | 2314 |
| 138 | Ga0157375_10251947 | 3300013308 | Bacteria | 1926 |
| 139 | Ga0163163_11430681 | 3300014325 | Bacteria | 753 |
| 140 | Ga0182008_10015693 | 3300014497 | Bacteria | 3949 |
| 141 | Ga0157379_10049724 | 3300014968 | Bacteria | 3743 |
| 142 | Ga0157379_10272710 | 3300014968 | Bacteria | 1539 |
| 143 | Ga0157379_10671244 | 3300014968 | Bacteria | 971 |
| 144 | Ga0157376_10005857 | 3300014969 | Bacteria | 8620 |
| 145 | Ga0157376_10378293 | 3300014969 | Bacteria | 1363 |
| 146 | Ga0157376_10803576 | 3300014969 | Bacteria | 953 |
| 147 | Ga0157376_11427513 | 3300014969 | Bacteria | 724 |
| 148 | Ga0182007_10000142 | 3300015262 | Bacteria | 47856 |
| 149 | Ga0182007_10005399 | 3300015262 | Bacteria | 5617 |
| 150 | Ga0182005_1000456 | 3300015265 | Bacteria | 21433 |
| 151 | Ga0182005_1005723 | 3300015265 | Bacteria | 3858 |
| 152 | Ga0163161_10006187 | 3300017792 | Bacteria | 8293 |
| 153 | Ga0163161_10030811 | 3300017792 | Bacteria | 3820 |
| 154 | Ga0209148_1000686 | 3300025254 | Bacteria | 28101 |
| 155 | Ga0209673_1010180 | 3300025273 | Bacteria | 3989 |
| 156 | Ga0209675_1014305 | 3300025291 | Bacteria | 2422 |
| 157 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 158 | Ga0209676_1000612 | 3300025292 | Bacteria | 52191 |
| 159 | Ga0209676_1003607 | 3300025292 | Bacteria | 9320 |
| 160 | Ga0209676_1033599 | 3300025292 | Bacteria | 1526 |
| 161 | Ga0209025_1011950 | 3300025294 | Bacteria | 5641 |
| 162 | Ga0209564_1005388 | 3300025295 | Bacteria | 7330 |
| 163 | Ga0209050_1004964 | 3300025298 | Bacteria | 8665 |
| 164 | Ga0209256_1003876 | 3300025299 | Bacteria | 9931 |
| 165 | Ga0209256_1006477 | 3300025299 | Bacteria | 6166 |
| 166 | Ga0209256_1019151 | 3300025299 | Bacteria | 2192 |
| 167 | Ga0209051_1022393 | 3300025303 | Bacteria | 2661 |
| 168 | Ga0209257_1000261 | 3300025304 | Bacteria | 121357 |
| 169 | Ga0209257_1008033 | 3300025304 | Bacteria | 6147 |
| 170 | Ga0209257_1008123 | 3300025304 | Bacteria | 6093 |
| 171 | Ga0209257_1008529 | 3300025304 | Bacteria | 5792 |
| 172 | Ga0207656_10025181 | 3300025321 | Bacteria | 2413 |
| 173 | Ga0207656_10027086 | 3300025321 | Bacteria | 2342 |
| 174 | Ga0207655_1022900 | 3300025728 | Bacteria | 3113 |
| 175 | Ga0207692_10197443 | 3300025898 | Bacteria | 1181 |
| 176 | Ga0207710_10028070 | 3300025900 | Bacteria | 2441 |
| 177 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 178 | Ga0207680_10176690 | 3300025903 | Bacteria | 1441 |
| 179 | Ga0207705_10018223 | 3300025909 | Bacteria | 5020 |
| 180 | Ga0207671_10093721 | 3300025914 | Bacteria | 2265 |
| 181 | Ga0207671_10158417 | 3300025914 | Bacteria | 1752 |
| 182 | Ga0207671_11359181 | 3300025914 | Bacteria | 552 |
| 183 | Ga0207660_10891057 | 3300025917 | Bacteria | 726 |
| 184 | Ga0207649_10009717 | 3300025920 | Bacteria | 5268 |
| 185 | Ga0207649_10091633 | 3300025920 | Bacteria | 1991 |
| 186 | Ga0207649_10230572 | 3300025920 | Bacteria | 1324 |
| 187 | Ga0207649_10272671 | 3300025920 | Bacteria | 1227 |
| 188 | Ga0207681_10494999 | 3300025923 | Bacteria | 1000 |
| 189 | Ga0207694_10000336 | 3300025924 | Bacteria | 44443 |
| 190 | Ga0207694_10032818 | 3300025924 | Bacteria | 3976 |
| 191 | Ga0207694_10695077 | 3300025924 | Bacteria | 858 |
| 192 | Ga0207650_10372361 | 3300025925 | Bacteria | 1178 |
| 193 | Ga0207650_10392351 | 3300025925 | Bacteria | 1148 |
| 194 | Ga0207650_11052700 | 3300025925 | Bacteria | 692 |
| 195 | Ga0207687_10181411 | 3300025927 | Bacteria | 1631 |
| 196 | Ga0207690_11296709 | 3300025932 | Bacteria | 609 |
| 197 | Ga0207706_10828811 | 3300025933 | Bacteria | 784 |
| 198 | Ga0207704_10128029 | 3300025938 | Bacteria | 1752 |
| 199 | Ga0207711_10646443 | 3300025941 | Bacteria | 987 |
| 200 | Ga0207689_10034615 | 3300025942 | Bacteria | 4195 |
| 201 | Ga0207661_10056674 | 3300025944 | Bacteria | 3147 |
| 202 | Ga0207667_10603878 | 3300025949 | Bacteria | 1106 |
| 203 | Ga0207712_10751137 | 3300025961 | Bacteria | 854 |
| 204 | Ga0207668_10187970 | 3300025972 | Bacteria | 1634 |
| 205 | Ga0207668_10684651 | 3300025972 | Bacteria | 900 |
| 206 | Ga0207640_10809010 | 3300025981 | Bacteria | 812 |
| 207 | Ga0207658_10062749 | 3300025986 | Bacteria | 2782 |
| 208 | Ga0207658_10668084 | 3300025986 | Bacteria | 937 |
| 209 | Ga0207677_10250485 | 3300026023 | Bacteria | 1438 |
| 210 | Ga0207703_10328594 | 3300026035 | Bacteria | 1402 |
| 211 | Ga0207639_10111615 | 3300026041 | Bacteria | 2229 |
| 212 | Ga0207639_10749378 | 3300026041 | Bacteria | 908 |
| 213 | Ga0207678_10021801 | 3300026067 | Bacteria | 5618 |
| 214 | Ga0207678_10159979 | 3300026067 | Bacteria | 1923 |
| 215 | Ga0207678_10161076 | 3300026067 | Bacteria | 1916 |
| 216 | Ga0207702_10999831 | 3300026078 | Bacteria | 830 |
| 217 | Ga0207641_10551263 | 3300026088 | Bacteria | 1124 |
| 218 | Ga0207641_12160990 | 3300026088 | Unclassified | 557 |
| 219 | Ga0207674_11835847 | 3300026116 | Bacteria | 573 |
| 220 | Ga0207675_101334640 | 3300026118 | Bacteria | 738 |
| 221 | Ga0207698_10064973 | 3300026142 | Bacteria | 2863 |
| 222 | Ga0209984_1063570 | 3300027424 | Bacteria | 548 |
| 223 | Ga0209995_1030627 | 3300027471 | Bacteria | 900 |
| 224 | Ga0209982_1008725 | 3300027552 | Bacteria | 1490 |
| 225 | Ga0210002_1013705 | 3300027617 | Bacteria | 1267 |
| 226 | Ga0209971_1002018 | 3300027682 | Bacteria | 4935 |
| 227 | Ga0209974_10016938 | 3300027876 | Bacteria | 2419 |
| 228 | Ga0209974_10161704 | 3300027876 | Bacteria | 812 |
| 229 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 230 | Ga0268266_10027462 | 3300028379 | Bacteria | 4839 |
| 231 | Ga0268266_10090491 | 3300028379 | Bacteria | 2682 |
| 232 | Ga0268266_10101567 | 3300028379 | Bacteria | 2536 |
| 233 | Ga0268266_10143530 | 3300028379 | Bacteria | 2144 |
| 234 | Ga0268265_10000054 | 3300028380 | Bacteria | 165504 |
| 235 | Ga0268265_10027941 | 3300028380 | Bacteria | 4034 |
| 236 | Ga0268265_10747165 | 3300028380 | Bacteria | 949 |
| 237 | Ga0268264_10045880 | 3300028381 | Bacteria | 3630 |
| 238 | Ga0268264_11561243 | 3300028381 | Bacteria | 671 |
| 239 | Ga0265337_1005508 | 3300028556 | Bacteria | 5023 |
| 240 | Ga0265326_10138458 | 3300028558 | Bacteria | 694 |
| 241 | Ga0265323_10053101 | 3300028653 | Bacteria | 1432 |
| 242 | Ga0265323_10074653 | 3300028653 | Bacteria | 1153 |
| 243 | Ga0265322_10021312 | 3300028654 | Bacteria | 1857 |
| 244 | Ga0265330_10000267 | 3300031235 | Bacteria | 38266 |
| 245 | Ga0265330_10000425 | 3300031235 | Bacteria | 28316 |
| 246 | Ga0265330_10003657 | 3300031235 | Bacteria | 7994 |
| 247 | Ga0265330_10025461 | 3300031235 | Bacteria | 2681 |
| 248 | Ga0265330_10087550 | 3300031235 | Bacteria | 1338 |
| 249 | Ga0265332_10000031 | 3300031238 | Bacteria | 162330 |
| 250 | Ga0265332_10182304 | 3300031238 | Bacteria | 874 |
| 251 | Ga0265320_10132836 | 3300031240 | Bacteria | 1130 |
| 252 | Ga0265325_10003142 | 3300031241 | Bacteria | 10891 |
| 253 | Ga0265325_10027234 | 3300031241 | Bacteria | 3091 |
| 254 | Ga0265329_10000026 | 3300031242 | Bacteria | 61009 |
| 255 | Ga0265329_10127460 | 3300031242 | Bacteria | 818 |
| 256 | Ga0265340_10002395 | 3300031247 | Bacteria | 10666 |
| 257 | Ga0265340_10015502 | 3300031247 | Bacteria | 3960 |
| 258 | Ga0265340_10315639 | 3300031247 | Bacteria | 692 |
| 259 | Ga0265339_10080517 | 3300031249 | Bacteria | 1722 |
| 260 | Ga0265331_10009095 | 3300031250 | Bacteria | 5609 |
| 261 | Ga0265331_10319595 | 3300031250 | Bacteria | 695 |
| 262 | Ga0265316_10000041 | 3300031344 | Bacteria | 137206 |
| 263 | Ga0265316_10174729 | 3300031344 | Bacteria | 1601 |
| 264 | Ga0265316_10314063 | 3300031344 | Bacteria | 1139 |
| 265 | Ga0307509_10262981 | 3300031507 | Bacteria | 1499 |
| 266 | Ga0307408_100315384 | 3300031548 | Bacteria | 1315 |
| 267 | Ga0307408_100556977 | 3300031548 | Bacteria | 1012 |
| 268 | Ga0316575_10013903 | 3300031665 | Bacteria | 3015 |
| 269 | Ga0316575_10255907 | 3300031665 | Bacteria | 735 |
| 270 | Ga0316579_10109102 | 3300031691 | Bacteria | 1328 |
| 271 | Ga0265314_10000040 | 3300031711 | Bacteria | 218764 |
| 272 | Ga0265314_10000095 | 3300031711 | Bacteria | 134372 |
| 273 | Ga0265314_10001552 | 3300031711 | Bacteria | 25312 |
| 274 | Ga0265314_10022605 | 3300031711 | Bacteria | 4816 |
| 275 | Ga0265314_10209430 | 3300031711 | Bacteria | 1146 |
| 276 | Ga0265342_10000053 | 3300031712 | Bacteria | 121955 |
| 277 | Ga0265342_10000534 | 3300031712 | Bacteria | 40495 |
| 278 | Ga0265342_10005068 | 3300031712 | Bacteria | 10153 |
| 279 | Ga0265342_10005916 | 3300031712 | Bacteria | 9216 |
| 280 | Ga0265342_10194306 | 3300031712 | Bacteria | 1106 |
| 281 | Ga0316576_10055399 | 3300031727 | Bacteria | 2894 |
| 282 | Ga0316576_10058891 | 3300031727 | Bacteria | 2810 |
| 283 | Ga0316576_10097345 | 3300031727 | Bacteria | 2197 |
| 284 | Ga0316576_10386571 | 3300031727 | Bacteria | 1038 |
| 285 | Ga0316578_10003230 | 3300031728 | Bacteria | 7398 |
| 286 | Ga0316578_10018765 | 3300031728 | Bacteria | 3797 |
| 287 | Ga0307405_10251909 | 3300031731 | Bacteria | 1314 |
| 288 | Ga0316577_10680407 | 3300031733 | Bacteria | 585 |
| 289 | Ga0307413_10035842 | 3300031824 | Bacteria | 2850 |
| 290 | Ga0307413_10161570 | 3300031824 | Bacteria | 1574 |
| 291 | Ga0307407_10049146 | 3300031903 | Bacteria | 2405 |
| 292 | Ga0307412_10002538 | 3300031911 | Bacteria | 10147 |
| 293 | Ga0307412_10162169 | 3300031911 | Bacteria | 1662 |
| 294 | Ga0307409_100309035 | 3300031995 | Bacteria | 1474 |
| 295 | Ga0307409_102148253 | 3300031995 | Bacteria | 588 |
| 296 | Ga0307416_100279249 | 3300032002 | Bacteria | 1646 |
| 297 | Ga0307416_100365210 | 3300032002 | Bacteria | 1467 |
| 298 | Ga0307414_10141984 | 3300032004 | Bacteria | 1881 |
| 299 | Ga0307411_10127826 | 3300032005 | Bacteria | 1851 |
| 300 | Ga0307411_10632296 | 3300032005 | Bacteria | 924 |
| 301 | Ga0307415_101935825 | 3300032126 | Bacteria | 573 |
| 302 | Ga0316583_10002064 | 3300032133 | Bacteria | 6894 |
| 303 | Ga0316580_10003696 | 3300032139 | Bacteria | 4378 |
| 304 | Ga0307510_10037923 | 3300033180 | Bacteria | 5336 |
| 305 | Ga0373951_0137921 | 3300035091 | Bacteria | 675 |
| 306 | Ga0316574_0010361 | 3300035398 | Bacteria | 5265 |
| 307 | Ga0316574_0037278 | 3300035398 | Bacteria | 2981 |
| 308 | Ga0316574_0159411 | 3300035398 | Bacteria | 1453 |
| 309 | Ga0316582_0224787 | 3300036647 | Bacteria | 1284 |
| 310 | Ga0316582_0445910 | 3300036647 | Bacteria | 892 |
| 311 | Ga0316584_0023954 | 3300036712 | Bacteria | 4463 |
| 312 | Ga0316584_0085084 | 3300036712 | Bacteria | 2368 |
| 313 | Ga0395900_0243213 | 3300037418 | Bacteria | 1804 |
| 314 | Ga0395905_0004059 | 3300037471 | Bacteria | 15349 |
| 315 | Ga0439453_0098399 | 3300041408 | Bacteria | 650 |
| 316 | Ga0439465_0002275 | 3300041413 | Bacteria | 6310 |
| 317 | Ga0439465_0004449 | 3300041413 | Bacteria | 4535 |
| 318 | Ga0451791_0048244 | 3300041451 | Bacteria | 568 |
| 319 | Ga0451795_0606827 | 3300041456 | Bacteria | 985 |
| 320 | Ga0451800_1248717 | 3300041459 | Bacteria | 529 |
| 321 | Ga0451804_1093370 | 3300041463 | Bacteria | 508 |
| 322 | Ga0451807_0165466 | 3300041486 | Bacteria | 852 |
| 323 | Ga0451807_0484707 | 3300041486 | Bacteria | 663 |
| 324 | Ga0451833_1090284 | 3300041491 | Bacteria | 790 |
| 325 | Ga0451837_1099414 | 3300041494 | Bacteria | 1719 |
| 326 | Ga0451841_0410757 | 3300041498 | Bacteria | 1067 |
| 327 | Ga0439445_0141555 | 3300042004 | Bacteria | 697 |
| 328 | Ga0439449_0040165 | 3300042007 | Bacteria | 1739 |
| 329 | Ga0439450_006902 | 3300042008 | Bacteria | 2061 |
| 330 | Ga0439452_067921 | 3300042010 | Bacteria | 789 |
| 331 | Ga0439462_0031205 | 3300042015 | Bacteria | 1411 |
| 332 | Ga0450912_019654 | 3300042116 | Bacteria | 646 |
| 333 | Ga0450921_011842 | 3300042123 | Bacteria | 749 |
| 334 | Ga0450897_007632 | 3300042128 | Bacteria | 990 |
| 335 | Ga0450908_000010 | 3300042184 | Bacteria | 47196 |
| 336 | Ga0450909_022902 | 3300042185 | Bacteria | 936 |
| 337 | Ga0451577_0334223 | 3300042876 | Bacteria | 1374 |
| 338 | Ga0451577_0626694 | 3300042876 | Bacteria | 976 |
| 339 | Ga0439440_0029733 | 3300042993 | Bacteria | 1283 |
| 340 | Ga0453683_0780882 | 3300044673 | Bacteria | 628 |
| 341 | Ga0453684_0041513 | 3300044712 | Bacteria | 6220 |
| 342 | Ga0451576_0072851 | 3300045051 | Bacteria | 3574 |
| 343 | Ga0495617_000085 | 3300046452 | Bacteria | 67837 |
| 344 | Ga0495617_001170 | 3300046452 | Bacteria | 11853 |
| 345 | Ga0495603_0003097 | 3300046455 | Bacteria | 9880 |
| 346 | Ga0495591_019008 | 3300046458 | Bacteria | 2313 |
| 347 | Ga0495629_0002905 | 3300046459 | Bacteria | 13070 |
| 348 | Ga0495638_0000754 | 3300046460 | Bacteria | 34482 |
| 349 | Ga0495638_0059747 | 3300046460 | Bacteria | 2359 |
| 350 | Ga0495650_0000191 | 3300046471 | Bacteria | 132016 |
| 351 | Ga0495650_0001130 | 3300046471 | Bacteria | 29006 |
| 352 | Ga0495650_0011597 | 3300046471 | Bacteria | 4815 |
| 353 | Ga0495650_0053605 | 3300046471 | Bacteria | 1650 |
| 354 | Ga0495582_0031889 | 3300046473 | Bacteria | 2898 |
| 355 | Ga0495662_0159366 | 3300046476 | Bacteria | 1112 |
| 356 | Ga0495664_0233741 | 3300046477 | Bacteria | 1112 |
| 357 | Ga0495584_0000457 | 3300046491 | Bacteria | 28087 |
| 358 | Ga0495584_0267902 | 3300046491 | Bacteria | 868 |
| 359 | Ga0495585_0000008 | 3300046492 | Bacteria | 278949 |
| 360 | Ga0495585_0004032 | 3300046492 | Bacteria | 9672 |
| 361 | Ga0495607_0000006 | 3300046501 | Bacteria | 281664 |
| 362 | Ga0495607_0000131 | 3300046501 | Bacteria | 80259 |
| 363 | Ga0495583_0043459 | 3300046506 | Bacteria | 2092 |
| 364 | Ga0495606_0001253 | 3300046507 | Bacteria | 35422 |
| 365 | Ga0495606_0001443 | 3300046507 | Bacteria | 31874 |
| 366 | Ga0495606_0026870 | 3300046507 | Bacteria | 4090 |
| 367 | Ga0495606_0175841 | 3300046507 | Bacteria | 1238 |
| 368 | Ga0495608_0193802 | 3300046511 | Bacteria | 1282 |
| 369 | Ga0495610_0003274 | 3300046512 | Bacteria | 12764 |
| 370 | Ga0495610_0013443 | 3300046512 | Bacteria | 4864 |
| 371 | Ga0495616_0000401 | 3300046513 | Bacteria | 33353 |
| 372 | Ga0495616_0002110 | 3300046513 | Bacteria | 13330 |
| 373 | Ga0495620_0000365 | 3300046515 | Bacteria | 31131 |
| 374 | Ga0495620_0004937 | 3300046515 | Bacteria | 7484 |
| 375 | Ga0495631_0000444 | 3300046518 | Bacteria | 28367 |
| 376 | Ga0495631_0004475 | 3300046518 | Bacteria | 7442 |
| 377 | Ga0495632_0000531 | 3300046519 | Bacteria | 36042 |
| 378 | Ga0495632_0033849 | 3300046519 | Bacteria | 2620 |
| 379 | Ga0495632_0050691 | 3300046519 | Bacteria | 2045 |
| 380 | Ga0495632_0254188 | 3300046519 | Bacteria | 787 |
| 381 | Ga0495637_0005634 | 3300046520 | Bacteria | 6357 |
| 382 | Ga0495644_0101185 | 3300046523 | Bacteria | 1090 |
| 383 | Ga0495648_0000878 | 3300046524 | Bacteria | 31691 |
| 384 | Ga0495648_0086672 | 3300046524 | Bacteria | 1765 |
| 385 | Ga0495648_0347489 | 3300046524 | Bacteria | 678 |
| 386 | Ga0495663_0120084 | 3300046525 | Bacteria | 879 |
| 387 | Ga0495654_0031990 | 3300046530 | Bacteria | 2668 |
| 388 | Ga0495665_0015986 | 3300046531 | Bacteria | 4044 |
| 389 | Ga0495586_0114105 | 3300046535 | Bacteria | 1505 |
| 390 | Ga0495597_0000256 | 3300046542 | Bacteria | 48492 |
| 391 | Ga0495645_0019844 | 3300046543 | Bacteria | 4843 |
| 392 | Ga0495667_0036668 | 3300046559 | Bacteria | 3271 |
| 393 | Ga0495668_0008520 | 3300046616 | Bacteria | 6387 |
| 394 | Ga0495634_0206359 | 3300046642 | Bacteria | 1218 |
| 395 | Ga0495611_0000002 | 3300046648 | Bacteria | 705677 |
| 396 | Ga0495611_0000381 | 3300046648 | Bacteria | 28324 |
| 397 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 398 | Ga0495625_0005416 | 3300046660 | Bacteria | 11653 |
| 399 | Ga0495661_0000184 | 3300046665 | Bacteria | 71844 |
| 400 | Ga0495646_0007986 | 3300046680 | Bacteria | 6727 |
| 401 | Ga0495669_0031766 | 3300046684 | Bacteria | 2319 |
| 402 | Ga0495624_0141422 | 3300046690 | Bacteria | 1474 |
| 403 | Ga0495670_0011921 | 3300046691 | Bacteria | 4277 |
| 404 | Ga0495670_0013664 | 3300046691 | Bacteria | 3993 |
| 405 | Ga0495670_0040492 | 3300046691 | Bacteria | 2323 |
| 406 | Ga0495670_0060173 | 3300046691 | Bacteria | 1908 |
| 407 | Ga0495671_0000622 | 3300046692 | Bacteria | 25995 |
| 408 | Ga0495649_0019027 | 3300046694 | Bacteria | 3858 |
| 409 | Ga0495589_0000190 | 3300046794 | Bacteria | 54374 |
| 410 | Ga0495589_0017164 | 3300046794 | Bacteria | 3717 |
| 411 | Ga0495600_0015858 | 3300046809 | Bacteria | 4773 |
| 412 | Ga0495660_0000437 | 3300046810 | Bacteria | 34919 |
| 413 | Ga0495660_0000447 | 3300046810 | Bacteria | 34412 |
| 414 | Ga0495581_0012810 | 3300047315 | Bacteria | 4857 |
| 415 | Ga0495680_0064046 | 3300047322 | Bacteria | 2821 |
| 416 | Ga0495683_0001059 | 3300047323 | Bacteria | 19067 |
| 417 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 418 | Ga0495679_171020 | 3300047446 | Bacteria | 578 |
| 419 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 420 | Ga0495673_0000062 | 3300047469 | Bacteria | 226461 |
| 421 | Ga0495673_0002144 | 3300047469 | Bacteria | 14333 |
| 422 | Ga0495681_0191049 | 3300047470 | Bacteria | 836 |
| 423 | Ga0495684_0147266 | 3300047471 | Bacteria | 1763 |
| 424 | Ga0495686_0000426 | 3300047472 | Bacteria | 66285 |
| 425 | Ga0495686_0001228 | 3300047472 | Bacteria | 29296 |
| 426 | Ga0495686_0004756 | 3300047472 | Bacteria | 10985 |
| 427 | Ga0495593_0041278 | 3300047673 | Bacteria | 2481 |
| 428 | Ga0496100_0031620 | 3300048903 | Bacteria | 3292 |
| 429 | Ga0496101_0001031 | 3300048904 | Bacteria | 16431 |
| 430 | Ga0496101_0020135 | 3300048904 | Bacteria | 4563 |
| 431 | Ga0496101_0125986 | 3300048904 | Bacteria | 1941 |
| 432 | Ga0496101_1357283 | 3300048904 | Bacteria | 555 |
| 433 | Ga0496102_0600125 | 3300048905 | Bacteria | 1024 |
| 434 | Ga0496103_0119197 | 3300048906 | Bacteria | 1680 |
| 435 | Ga0496104_0105231 | 3300048907 | Bacteria | 2704 |
| 436 | Ga0496106_0000168 | 3300048909 | Bacteria | 47597 |
| 437 | Ga0496106_0406384 | 3300048909 | Bacteria | 1094 |
| 438 | Ga0496110_0291989 | 3300048913 | Bacteria | 1485 |
| 439 | Ga0496112_0104348 | 3300048915 | Bacteria | 2805 |
| 440 | Ga0496114_0146325 | 3300048917 | Bacteria | 2048 |
| 441 | Ga0496115_0020344 | 3300048918 | Bacteria | 5119 |
| 442 | Ga0496116_0061514 | 3300048919 | Bacteria | 2430 |
| 443 | Ga0496116_0253420 | 3300048919 | Bacteria | 874 |
| 444 | Ga0496117_0035395 | 3300048920 | Bacteria | 3748 |
| 445 | Ga0496117_0113572 | 3300048920 | Bacteria | 1681 |
| 446 | Ga0496117_0358411 | 3300048920 | Bacteria | 750 |
| 447 | Ga0496118_0002160 | 3300048921 | Bacteria | 27394 |
| 448 | Ga0496118_0009060 | 3300048921 | Bacteria | 10142 |
| 449 | Ga0496118_0022644 | 3300048921 | Bacteria | 5484 |
| 450 | Ga0496118_0135233 | 3300048921 | Bacteria | 1575 |
| 451 | Ga0496119_0008949 | 3300048922 | Bacteria | 8694 |
| 452 | Ga0496119_0083452 | 3300048922 | Bacteria | 1835 |
| 453 | Ga0496121_0000116 | 3300048924 | Bacteria | 177260 |
| 454 | Ga0496121_0006433 | 3300048924 | Bacteria | 14585 |
| 455 | Ga0496121_0008592 | 3300048924 | Bacteria | 11958 |
| 456 | Ga0496121_0034074 | 3300048924 | Bacteria | 4590 |
| 457 | Ga0496121_0142932 | 3300048924 | Bacteria | 1772 |
| 458 | Ga0496122_0014195 | 3300048925 | Bacteria | 7721 |
| 459 | Ga0496122_0028952 | 3300048925 | Bacteria | 4684 |
| 460 | Ga0496123_0047473 | 3300048926 | Bacteria | 2900 |
| 461 | Ga0496124_0001136 | 3300048927 | Bacteria | 41813 |
| 462 | Ga0496124_0007875 | 3300048927 | Bacteria | 11223 |
| 463 | Ga0496125_0059226 | 3300048928 | Bacteria | 3088 |
| 464 | Ga0496126_0054700 | 3300048929 | Bacteria | 3613 |
| 465 | Ga0496126_0119457 | 3300048929 | Bacteria | 2287 |
| 466 | Ga0496126_0346849 | 3300048929 | Bacteria | 1215 |
| 467 | Ga0495678_000019 | 3300049459 | Bacteria | 269723 |
| 468 | Ga0501031_0168964 | 3300049568 | Bacteria | 1429 |
| 469 | Ga0501032_0088609 | 3300049569 | Bacteria | 2054 |
| 470 | Ga0501033_0009449 | 3300049570 | Bacteria | 7508 |
| 471 | Ga0501033_0062339 | 3300049570 | Bacteria | 2745 |
| 472 | Ga0501033_0286759 | 3300049570 | Bacteria | 1161 |
| 473 | Ga0501034_0001985 | 3300049571 | Bacteria | 25904 |
| 474 | Ga0501034_0022477 | 3300049571 | Bacteria | 6427 |
| 475 | Ga0501034_0066222 | 3300049571 | Bacteria | 3625 |
| 476 | Ga0501034_0686007 | 3300049571 | Bacteria | 924 |
| 477 | Ga0501036_0105873 | 3300049572 | Bacteria | 2378 |
| 478 | Ga0501036_0150059 | 3300049572 | Bacteria | 1966 |
| 479 | Ga0501037_0000790 | 3300049573 | Bacteria | 23802 |
| 480 | Ga0501037_0350041 | 3300049573 | Bacteria | 1019 |
| 481 | Ga0501037_0881384 | 3300049573 | Bacteria | 587 |
| 482 | Ga0501038_0001202 | 3300049574 | Bacteria | 23488 |
| 483 | Ga0501038_0019743 | 3300049574 | Bacteria | 6066 |
| 484 | Ga0501038_0045790 | 3300049574 | Bacteria | 3796 |
| 485 | Ga0501038_0254902 | 3300049574 | Bacteria | 1389 |
| 486 | Ga0501039_0730831 | 3300049575 | Bacteria | 773 |
| 487 | Ga0501042_0090035 | 3300049578 | Bacteria | 2202 |
| 488 | Ga0501042_0927908 | 3300049578 | Bacteria | 634 |
| 489 | Ga0501043_0004402 | 3300049579 | Bacteria | 11442 |
| 490 | Ga0501043_0102173 | 3300049579 | Bacteria | 2253 |
| 491 | Ga0501043_0116266 | 3300049579 | Bacteria | 2099 |
| 492 | Ga0501043_0301978 | 3300049579 | Bacteria | 1223 |
| 493 | Ga0501043_0347927 | 3300049579 | Bacteria | 1126 |
| 494 | Ga0501046_0038711 | 3300049580 | Bacteria | 3824 |
| 495 | Ga0501046_0066893 | 3300049580 | Bacteria | 2799 |
| 496 | Ga0501046_0397348 | 3300049580 | Bacteria | 996 |
| 497 | Ga0501046_0445529 | 3300049580 | Bacteria | 931 |
| 498 | Ga0501047_0081899 | 3300049581 | Bacteria | 3102 |
| 499 | Ga0501047_0092413 | 3300049581 | Bacteria | 2904 |
| 500 | Ga0501068_0086983 | 3300049584 | Bacteria | 1925 |
| 501 | Ga0501069_0203463 | 3300049585 | Bacteria | 1148 |
| 502 | Ga0501070_0125679 | 3300049586 | Bacteria | 2119 |
| 503 | Ga0501070_0636909 | 3300049586 | Bacteria | 847 |
| 504 | Ga0501071_0182958 | 3300049587 | Bacteria | 1570 |
| 505 | Ga0501073_0000193 | 3300049589 | Bacteria | 40258 |
| 506 | Ga0501073_0281894 | 3300049589 | Bacteria | 1147 |
| 507 | Ga0501074_0215049 | 3300049590 | Bacteria | 1369 |
| 508 | Ga0501209_083093 | 3300049656 | Bacteria | 925 |
| 509 | Ga0501217_018851 | 3300049661 | Bacteria | 1606 |
| 510 | Ga0501233_066785 | 3300049668 | Bacteria | 904 |
| 511 | Ga0501235_016151 | 3300049669 | Bacteria | 1648 |
| 512 | Ga0501242_017641 | 3300049674 | Bacteria | 902 |
| 513 | Ga0501243_017862 | 3300049675 | Bacteria | 1152 |
| 514 | Ga0501249_014675 | 3300049679 | Bacteria | 1671 |
| 515 | Ga0501252_003627 | 3300049682 | Bacteria | 1602 |
| 516 | Ga0501253_072571 | 3300049683 | Bacteria | 763 |
| 517 | Ga0501257_011199 | 3300049686 | Bacteria | 2045 |
| 518 | Ga0501258_005660 | 3300049687 | Bacteria | 1218 |
| 519 | Ga0501079_0046800 | 3300049741 | Bacteria | 3338 |
| 520 | Ga0501080_0023306 | 3300049742 | Bacteria | 5739 |
| 521 | Ga0501080_0517975 | 3300049742 | Bacteria | 1064 |
| 522 | Ga0501083_0323169 | 3300049744 | Bacteria | 1003 |
| 523 | Ga0501083_0362637 | 3300049744 | Bacteria | 942 |
| 524 | Ga0501083_1067829 | 3300049744 | Bacteria | 526 |
| 525 | Ga0501232_093225 | 3300049757 | Bacteria | 520 |
| 526 | Ga0501266_007768 | 3300049763 | Bacteria | 1347 |
| 527 | Ga0501270_027563 | 3300049767 | Bacteria | 914 |
| 528 | Ga0501274_046507 | 3300049771 | Bacteria | 534 |
| 529 | Ga0501276_022681 | 3300049773 | Bacteria | 612 |
| 530 | Ga0501035_0016516 | 3300049822 | Bacteria | 6806 |
| 531 | Ga0501035_0211846 | 3300049822 | Bacteria | 1657 |
| 532 | Ga0501035_0219353 | 3300049822 | Bacteria | 1624 |
| 533 | Ga0501035_0662590 | 3300049822 | Bacteria | 845 |
| 534 | Ga0501035_1052758 | 3300049822 | Bacteria | 637 |
| 535 | Ga0501035_1422860 | 3300049822 | Bacteria | 531 |
| 536 | Ga0501044_0000635 | 3300049823 | Bacteria | 42394 |
| 537 | Ga0501044_0224861 | 3300049823 | Bacteria | 1826 |
| 538 | Ga0501044_0683113 | 3300049823 | Bacteria | 913 |
| 539 | Ga0501044_0726868 | 3300049823 | Bacteria | 876 |
| 540 | Ga0501045_0422738 | 3300049824 | Bacteria | 991 |
| 541 | nmdc:mga03683_423529_c1 | 3300050489 | Bacteria | 638 |
| 542 | nmdc:mga00v17_5917_c1 | 3300050491 | Bacteria | 3109 |
| 543 | nmdc:mga0k408_754_c1 | 3300050493 | Bacteria | 17806 |
| 544 | Ga0500643_000101 | 3300053087 | Bacteria | 88318 |
| 545 | Ga0500646_0006615 | 3300053090 | Bacteria | 2950 |
| 546 | Ga0500651_0009615 | 3300053093 | Bacteria | 5759 |
| 547 | Ga0500651_0296271 | 3300053093 | Bacteria | 929 |
| 548 | Ga0500555_004699 | 3300053103 | Bacteria | 3879 |
| 549 | Ga0500655_013659 | 3300053133 | Bacteria | 1483 |
| 550 | Ga0500658_0016220 | 3300053134 | Bacteria | 2774 |
| 551 | Ga0500559_0010047 | 3300053136 | Bacteria | 4076 |
| 552 | Ga0500573_0017232 | 3300053140 | Bacteria | 4111 |
| 553 | Ga0500588_0064122 | 3300053146 | Bacteria | 1186 |
| 554 | Ga0500637_0162922 | 3300053178 | Unclassified | 1285 |
| 555 | Ga0500645_000443 | 3300053730 | Bacteria | 28379 |
| 556 | Ga0500656_000577 | 3300053732 | Bacteria | 2799 |
| 557 | Ga0501082_0000055 | 3300060353 | Bacteria | 80800 |
| 558 | Ga0501082_0510665 | 3300060353 | Bacteria | 1050 |
| 559 | 2548499438 | 2547132374 | Bacteria | 5530232 |
| 560 | 2643866262 | 2643221570 | Bacteria | 5103772 |
| 561 | 2644057491 | 2643221609 | Bacteria | 6756331 |
| 562 | 2644072420 | 2643221611 | Bacteria | 6820941 |
| 563 | 2644293062 | 2643221652 | Bacteria | 5140275 |
| 564 | 2644648102 | 2643221717 | Bacteria | 5676132 |
| 565 | 2974320780 | 2974320154 | Bacteria | 4571377 |
| 566 | 2990714314 | 2990710928 | Bacteria | 5002431 |
| 567 | Ga0105239_10165158 | |||
| 568 | SwRhRL3b_contig_2972607 | |||
| 569 | JGI25151J46595_10015980 | |||
| 570 | JGI25406J46586_10003534 | |||
| 571 | Ga0006562J51391_1026968 | |||
| 572 | Ga0006562J51391_1026972 | |||
| 573 | Ga0055536_1013519 | |||
| 574 | Ga0055530_10004848 | |||
| 575 | Ga0055531_10023046 | |||
| 576 | Ga0055531_10031230 | |||
| 577 | Ga0065704_10093065 | |||
| 578 | Ga0065715_10132194 | |||
| 579 | Ga0065715_10552691 | |||
| 580 | Ga0070658_10013000 | |||
| 581 | Ga0070683_100417513 | |||
| 582 | Ga0070670_100065955 | |||
| 583 | Ga0070670_100110501 | |||
| 584 | Ga0070670_100489414 | |||
| 585 | Ga0068869_100053777 | |||
| 586 | Ga0068869_100394469 | |||
| 587 | Ga0068869_100776897 | |||
| 588 | Ga0070666_10000001 | |||
| 589 | Ga0070680_100644025 | |||
| 590 | Ga0070682_100659763 | |||
| 591 | Ga0068868_100050204 | |||
| 592 | Ga0070689_100323480 | |||
| 593 | Ga0070691_10151167 | |||
| 594 | Ga0070661_100016152 | |||
| 595 | Ga0070661_100753317 | |||
| 596 | Ga0070668_100022301 | |||
| 597 | Ga0070667_100000465 | |||
| 598 | Ga0070667_100898497 | |||
| 599 | Ga0070667_100994506 | |||
| 600 | Ga0070663_100017743 | |||
| 601 | Ga0070663_100151336 | |||
| 602 | Ga0070662_100704968 | |||
| 603 | Ga0070706_100831551 | |||
| 604 | Ga0070699_101929381 | |||
| 605 | Ga0070684_100421023 | |||
| 606 | Ga0070684_100943987 | |||
| 607 | Ga0068853_100341013 | |||
| 608 | Ga0068853_100678879 | |||
| 609 | Ga0068853_100962073 | |||
| 610 | Ga0070665_100026645 | |||
| 611 | Ga0070665_100094508 | |||
| 612 | Ga0070665_100204427 | |||
| 613 | Ga0070665_100292763 | |||
| 614 | Ga0070665_100300367 | |||
| 615 | Ga0070665_100641034 | |||
| 616 | Ga0068855_100135814 | |||
| 617 | Ga0068855_100438241 | |||
| 618 | Ga0070664_100064937 | |||
| 619 | Ga0070664_100583636 | |||
| 620 | Ga0068852_100066547 | |||
| 621 | Ga0068852_100086798 | |||
| 622 | Ga0068852_100554300 | |||
| 623 | Ga0068852_100693768 | |||
| 624 | Ga0068852_101298173 | |||
| 625 | Ga0068859_100015514 | |||
| 626 | Ga0068859_100821289 | |||
| 627 | Ga0068859_101345086 | |||
| 628 | Ga0068864_100053622 | |||
| 629 | Ga0068851_10009487 | |||
| 630 | Ga0068851_10078268 | |||
| 631 | Ga0068851_10195837 | |||
| 632 | Ga0068863_100060881 | |||
| 633 | Ga0068863_100104501 | |||
| 634 | Ga0068863_100944657 | |||
| 635 | Ga0068863_101181979 | |||
| 636 | Ga0068858_100046015 | |||
| 637 | Ga0068858_100083220 | |||
| 638 | Ga0068858_101167354 | |||
| 639 | Ga0068860_100040462 | |||
| 640 | Ga0068860_100354739 | |||
| 641 | Ga0068862_100000076 | |||
| 642 | Ga0068862_100067410 | |||
| 643 | Ga0068862_100703070 | |||
| 644 | Ga0068862_101598105 | |||
| 645 | Ga0081455_10000460 | |||
| 646 | Ga0081540_1042908 | |||
| 647 | Ga0081539_10000007 | |||
| 648 | Ga0075367_10531423 | |||
| 649 | Ga0075366_10000521 | |||
| 650 | Ga0097621_100090659 | |||
| 651 | Ga0097621_100168872 | |||
| 652 | Ga0097621_100173364 | |||
| 653 | Ga0068871_100046799 | |||
| 654 | Ga0068871_100049867 | |||
| 655 | Ga0068871_100122799 | |||
| 656 | Ga0068871_100255787 | |||
| 657 | Ga0068871_101700667 | |||
| 658 | Ga0075430_101735460 | |||
| 659 | Ga0068865_100056294 | |||
| 660 | Ga0097620_100015515 | |||
| 661 | Ga0097620_100821321 | |||
| 662 | Ga0097620_101345511 | |||
| 663 | Ga0105251_10006229 | |||
| 664 | Ga0105244_10018457 | |||
| 665 | Ga0105244_10051533 | |||
| 666 | Ga0105244_10231377 | |||
| 667 | Ga0105250_10112934 | |||
| 668 | Ga0105240_10561322 | |||
| 669 | Ga0105245_10283426 | |||
| 670 | Ga0105247_10000804 | |||
| 671 | Ga0105247_10059220 | |||
| 672 | Ga0105247_10086053 | |||
| 673 | Ga0105243_13124911 | |||
| 674 | Ga0105248_10035211 | |||
| 675 | Ga0105248_10149032 | |||
| 676 | Ga0105237_10216574 | |||
| 677 | Ga0105237_10362614 | |||
| 678 | Ga0105237_10720901 | |||
| 679 | Ga0105237_11178394 | |||
| 680 | Ga0105238_10000729 | |||
| 681 | Ga0105238_10159934 | |||
| 682 | Ga0105238_10219101 | |||
| 683 | Ga0105239_10001310 | |||
| 684 | Ga0105239_10152865 | |||
| 685 | Ga0105239_10226422 | |||
| 686 | Ga0157317_1004006 | |||
| 687 | Ga0157329_1003994 | |||
| 688 | Ga0157373_10418109 | |||
| 689 | Ga0157371_10010277 | |||
| 690 | Ga0157370_10031743 | |||
| 691 | Ga0157370_10228224 | |||
| 692 | Ga0157370_10919356 | |||
| 693 | Ga0157369_10006959 | |||
| 694 | Ga0157369_10311131 | |||
| 695 | Ga0157374_10560897 | |||
| 696 | Ga0157378_10179126 | |||
| 697 | Ga0163162_10000310 | |||
| 698 | Ga0157372_10049630 | |||
| 699 | Ga0157372_10185943 | |||
| 700 | Ga0157372_10371636 | |||
| 701 | Ga0157372_10908423 | |||
| 702 | Ga0157372_10932414 | |||
| 703 | Ga0157375_10172013 | |||
| 704 | Ga0157375_10251947 | |||
| 705 | Ga0163163_11430681 | |||
| 706 | Ga0182008_10015693 | |||
| 707 | Ga0157379_10049724 | |||
| 708 | Ga0157379_10272710 | |||
| 709 | Ga0157379_10671244 | |||
| 710 | Ga0157376_10005857 | |||
| 711 | Ga0157376_10378293 | |||
| 712 | Ga0157376_10803576 | |||
| 713 | Ga0157376_11427513 | |||
| 714 | Ga0182007_10000142 | |||
| 715 | Ga0182007_10005399 | |||
| 716 | Ga0182005_1000456 | |||
| 717 | Ga0182005_1005723 | |||
| 718 | Ga0163161_10006187 | |||
| 719 | Ga0163161_10030811 | |||
| 720 | Ga0209148_1000686 | |||
| 721 | Ga0209673_1010180 | |||
| 722 | Ga0209675_1014305 | |||
| 723 | Ga0209676_1000052 | |||
| 724 | Ga0209676_1000612 | |||
| 725 | Ga0209676_1003607 | |||
| 726 | Ga0209676_1033599 | |||
| 727 | Ga0209025_1011950 | |||
| 728 | Ga0209564_1005388 | |||
| 729 | Ga0209050_1004964 | |||
| 730 | Ga0209256_1003876 | |||
| 731 | Ga0209256_1006477 | |||
| 732 | Ga0209256_1019151 | |||
| 733 | Ga0209051_1022393 | |||
| 734 | Ga0209257_1000261 | |||
| 735 | Ga0209257_1008033 | |||
| 736 | Ga0209257_1008123 | |||
| 737 | Ga0209257_1008529 | |||
| 738 | Ga0207656_10025181 | |||
| 739 | Ga0207656_10027086 | |||
| 740 | Ga0207655_1022900 | |||
| 741 | Ga0207692_10197443 | |||
| 742 | Ga0207710_10028070 | |||
| 743 | Ga0207680_10000003 | |||
| 744 | Ga0207680_10176690 | |||
| 745 | Ga0207705_10018223 | |||
| 746 | Ga0207671_10093721 | |||
| 747 | Ga0207671_10158417 | |||
| 748 | Ga0207671_11359181 | |||
| 749 | Ga0207660_10891057 | |||
| 750 | Ga0207649_10009717 | |||
| 751 | Ga0207649_10091633 | |||
| 752 | Ga0207649_10230572 | |||
| 753 | Ga0207649_10272671 | |||
| 754 | Ga0207681_10494999 | |||
| 755 | Ga0207694_10000336 | |||
| 756 | Ga0207694_10032818 | |||
| 757 | Ga0207694_10695077 | |||
| 758 | Ga0207650_10372361 | |||
| 759 | Ga0207650_10392351 | |||
| 760 | Ga0207650_11052700 | |||
| 761 | Ga0207687_10181411 | |||
| 762 | Ga0207690_11296709 | |||
| 763 | Ga0207706_10828811 | |||
| 764 | Ga0207704_10128029 | |||
| 765 | Ga0207711_10646443 | |||
| 766 | Ga0207689_10034615 | |||
| 767 | Ga0207661_10056674 | |||
| 768 | Ga0207667_10603878 | |||
| 769 | Ga0207712_10751137 | |||
| 770 | Ga0207668_10187970 | |||
| 771 | Ga0207668_10684651 | |||
| 772 | Ga0207640_10809010 | |||
| 773 | Ga0207658_10062749 | |||
| 774 | Ga0207658_10668084 | |||
| 775 | Ga0207677_10250485 | |||
| 776 | Ga0207703_10328594 | |||
| 777 | Ga0207639_10111615 | |||
| 778 | Ga0207639_10749378 | |||
| 779 | Ga0207678_10021801 | |||
| 780 | Ga0207678_10159979 | |||
| 781 | Ga0207678_10161076 | |||
| 782 | Ga0207702_10999831 | |||
| 783 | Ga0207641_10551263 | |||
| 784 | Ga0207641_12160990 | |||
| 785 | Ga0207674_11835847 | |||
| 786 | Ga0207675_101334640 | |||
| 787 | Ga0207698_10064973 | |||
| 788 | Ga0209984_1063570 | |||
| 789 | Ga0209995_1030627 | |||
| 790 | Ga0209982_1008725 | |||
| 791 | Ga0210002_1013705 | |||
| 792 | Ga0209971_1002018 | |||
| 793 | Ga0209974_10016938 | |||
| 794 | Ga0209974_10161704 | |||
| 795 | Ga0268266_10000011 | |||
| 796 | Ga0268266_10027462 | |||
| 797 | Ga0268266_10090491 | |||
| 798 | Ga0268266_10101567 | |||
| 799 | Ga0268266_10143530 | |||
| 800 | Ga0268265_10000054 | |||
| 801 | Ga0268265_10027941 | |||
| 802 | Ga0268265_10747165 | |||
| 803 | Ga0268264_10045880 | |||
| 804 | Ga0268264_11561243 | |||
| 805 | Ga0265337_1005508 | |||
| 806 | Ga0265326_10138458 | |||
| 807 | Ga0265323_10053101 | |||
| 808 | Ga0265323_10074653 | |||
| 809 | Ga0265322_10021312 | |||
| 810 | Ga0265330_10000267 | |||
| 811 | Ga0265330_10000425 | |||
| 812 | Ga0265330_10003657 | |||
| 813 | Ga0265330_10025461 | |||
| 814 | Ga0265330_10087550 | |||
| 815 | Ga0265332_10000031 | |||
| 816 | Ga0265332_10182304 | |||
| 817 | Ga0265320_10132836 | |||
| 818 | Ga0265325_10003142 | |||
| 819 | Ga0265325_10027234 | |||
| 820 | Ga0265329_10000026 | |||
| 821 | Ga0265329_10127460 | |||
| 822 | Ga0265340_10002395 | |||
| 823 | Ga0265340_10015502 | |||
| 824 | Ga0265340_10315639 | |||
| 825 | Ga0265339_10080517 | |||
| 826 | Ga0265331_10009095 | |||
| 827 | Ga0265331_10319595 | |||
| 828 | Ga0265316_10000041 | |||
| 829 | Ga0265316_10174729 | |||
| 830 | Ga0265316_10314063 | |||
| 831 | Ga0307509_10262981 | |||
| 832 | Ga0307408_100315384 | |||
| 833 | Ga0307408_100556977 | |||
| 834 | Ga0316575_10013903 | |||
| 835 | Ga0316575_10255907 | |||
| 836 | Ga0316579_10109102 | |||
| 837 | Ga0265314_10000040 | |||
| 838 | Ga0265314_10000095 | |||
| 839 | Ga0265314_10001552 | |||
| 840 | Ga0265314_10022605 | |||
| 841 | Ga0265314_10209430 | |||
| 842 | Ga0265342_10000053 | |||
| 843 | Ga0265342_10000534 | |||
| 844 | Ga0265342_10005068 | |||
| 845 | Ga0265342_10005916 | |||
| 846 | Ga0265342_10194306 | |||
| 847 | Ga0316576_10055399 | |||
| 848 | Ga0316576_10058891 | |||
| 849 | Ga0316576_10097345 | |||
| 850 | Ga0316576_10386571 | |||
| 851 | Ga0316578_10003230 | |||
| 852 | Ga0316578_10018765 | |||
| 853 | Ga0307405_10251909 | |||
| 854 | Ga0316577_10680407 | |||
| 855 | Ga0307413_10035842 | |||
| 856 | Ga0307413_10161570 | |||
| 857 | Ga0307407_10049146 | |||
| 858 | Ga0307412_10002538 | |||
| 859 | Ga0307412_10162169 | |||
| 860 | Ga0307409_100309035 | |||
| 861 | Ga0307409_102148253 | |||
| 862 | Ga0307416_100279249 | |||
| 863 | Ga0307416_100365210 | |||
| 864 | Ga0307414_10141984 | |||
| 865 | Ga0307411_10127826 | |||
| 866 | Ga0307411_10632296 | |||
| 867 | Ga0307415_101935825 | |||
| 868 | Ga0316583_10002064 | |||
| 869 | Ga0316580_10003696 | |||
| 870 | Ga0307510_10037923 | |||
| 871 | Ga0373951_0137921 | |||
| 872 | Ga0316574_0010361 | |||
| 873 | Ga0316574_0037278 | |||
| 874 | Ga0316574_0159411 | |||
| 875 | Ga0316582_0224787 | |||
| 876 | Ga0316582_0445910 | |||
| 877 | Ga0316584_0023954 | |||
| 878 | Ga0316584_0085084 | |||
| 879 | Ga0395900_0243213 | |||
| 880 | Ga0395905_0004059 | |||
| 881 | Ga0439453_0098399 | |||
| 882 | Ga0439465_0002275 | |||
| 883 | Ga0439465_0004449 | |||
| 884 | Ga0451791_0048244 | |||
| 885 | Ga0451795_0606827 | |||
| 886 | Ga0451800_1248717 | |||
| 887 | Ga0451804_1093370 | |||
| 888 | Ga0451807_0165466 | |||
| 889 | Ga0451807_0484707 | |||
| 890 | Ga0451833_1090284 | |||
| 891 | Ga0451837_1099414 | |||
| 892 | Ga0451841_0410757 | |||
| 893 | Ga0439445_0141555 | |||
| 894 | Ga0439449_0040165 | |||
| 895 | Ga0439450_006902 | |||
| 896 | Ga0439452_067921 | |||
| 897 | Ga0439462_0031205 | |||
| 898 | Ga0450912_019654 | |||
| 899 | Ga0450921_011842 | |||
| 900 | Ga0450897_007632 | |||
| 901 | Ga0450908_000010 | |||
| 902 | Ga0450909_022902 | |||
| 903 | Ga0451577_0334223 | |||
| 904 | Ga0451577_0626694 | |||
| 905 | Ga0439440_0029733 | |||
| 906 | Ga0453683_0780882 | |||
| 907 | Ga0453684_0041513 | |||
| 908 | Ga0451576_0072851 | |||
| 909 | Ga0495617_000085 | |||
| 910 | Ga0495617_001170 | |||
| 911 | Ga0495603_0003097 | |||
| 912 | Ga0495591_019008 | |||
| 913 | Ga0495629_0002905 | |||
| 914 | Ga0495638_0000754 | |||
| 915 | Ga0495638_0059747 | |||
| 916 | Ga0495650_0000191 | |||
| 917 | Ga0495650_0001130 | |||
| 918 | Ga0495650_0011597 | |||
| 919 | Ga0495650_0053605 | |||
| 920 | Ga0495582_0031889 | |||
| 921 | Ga0495662_0159366 | |||
| 922 | Ga0495664_0233741 | |||
| 923 | Ga0495584_0000457 | |||
| 924 | Ga0495584_0267902 | |||
| 925 | Ga0495585_0000008 | |||
| 926 | Ga0495585_0004032 | |||
| 927 | Ga0495607_0000006 | |||
| 928 | Ga0495607_0000131 | |||
| 929 | Ga0495583_0043459 | |||
| 930 | Ga0495606_0001253 | |||
| 931 | Ga0495606_0001443 | |||
| 932 | Ga0495606_0026870 | |||
| 933 | Ga0495606_0175841 | |||
| 934 | Ga0495608_0193802 | |||
| 935 | Ga0495610_0003274 | |||
| 936 | Ga0495610_0013443 | |||
| 937 | Ga0495616_0000401 | |||
| 938 | Ga0495616_0002110 | |||
| 939 | Ga0495620_0000365 | |||
| 940 | Ga0495620_0004937 | |||
| 941 | Ga0495631_0000444 | |||
| 942 | Ga0495631_0004475 | |||
| 943 | Ga0495632_0000531 | |||
| 944 | Ga0495632_0033849 | |||
| 945 | Ga0495632_0050691 | |||
| 946 | Ga0495632_0254188 | |||
| 947 | Ga0495637_0005634 | |||
| 948 | Ga0495644_0101185 | |||
| 949 | Ga0495648_0000878 | |||
| 950 | Ga0495648_0086672 | |||
| 951 | Ga0495648_0347489 | |||
| 952 | Ga0495663_0120084 | |||
| 953 | Ga0495654_0031990 | |||
| 954 | Ga0495665_0015986 | |||
| 955 | Ga0495586_0114105 | |||
| 956 | Ga0495597_0000256 | |||
| 957 | Ga0495645_0019844 | |||
| 958 | Ga0495667_0036668 | |||
| 959 | Ga0495668_0008520 | |||
| 960 | Ga0495634_0206359 | |||
| 961 | Ga0495611_0000002 | |||
| 962 | Ga0495611_0000381 | |||
| 963 | Ga0495625_0000002 | |||
| 964 | Ga0495625_0005416 | |||
| 965 | Ga0495661_0000184 | |||
| 966 | Ga0495646_0007986 | |||
| 967 | Ga0495669_0031766 | |||
| 968 | Ga0495624_0141422 | |||
| 969 | Ga0495670_0011921 | |||
| 970 | Ga0495670_0013664 | |||
| 971 | Ga0495670_0040492 | |||
| 972 | Ga0495670_0060173 | |||
| 973 | Ga0495671_0000622 | |||
| 974 | Ga0495649_0019027 | |||
| 975 | Ga0495589_0000190 | |||
| 976 | Ga0495589_0017164 | |||
| 977 | Ga0495600_0015858 | |||
| 978 | Ga0495660_0000437 | |||
| 979 | Ga0495660_0000447 | |||
| 980 | Ga0495581_0012810 | |||
| 981 | Ga0495680_0064046 | |||
| 982 | Ga0495683_0001059 | |||
| 983 | Ga0495679_000003 | |||
| 984 | Ga0495679_171020 | |||
| 985 | Ga0495673_0000004 | |||
| 986 | Ga0495673_0000062 | |||
| 987 | Ga0495673_0002144 | |||
| 988 | Ga0495681_0191049 | |||
| 989 | Ga0495684_0147266 | |||
| 990 | Ga0495686_0000426 | |||
| 991 | Ga0495686_0001228 | |||
| 992 | Ga0495686_0004756 | |||
| 993 | Ga0495593_0041278 | |||
| 994 | Ga0496100_0031620 | |||
| 995 | Ga0496101_0001031 | |||
| 996 | Ga0496101_0020135 | |||
| 997 | Ga0496101_0125986 | |||
| 998 | Ga0496101_1357283 | |||
| 999 | Ga0496102_0600125 | |||
| 1000 | Ga0496103_0119197 | |||
| 1001 | Ga0496104_0105231 | |||
| 1002 | Ga0496106_0000168 | |||
| 1003 | Ga0496106_0406384 | |||
| 1004 | Ga0496110_0291989 | |||
| 1005 | Ga0496112_0104348 | |||
| 1006 | Ga0496114_0146325 | |||
| 1007 | Ga0496115_0020344 | |||
| 1008 | Ga0496116_0061514 | |||
| 1009 | Ga0496116_0253420 | |||
| 1010 | Ga0496117_0035395 | |||
| 1011 | Ga0496117_0113572 | |||
| 1012 | Ga0496117_0358411 | |||
| 1013 | Ga0496118_0002160 | |||
| 1014 | Ga0496118_0009060 | |||
| 1015 | Ga0496118_0022644 | |||
| 1016 | Ga0496118_0135233 | |||
| 1017 | Ga0496119_0008949 | |||
| 1018 | Ga0496119_0083452 | |||
| 1019 | Ga0496121_0000116 | |||
| 1020 | Ga0496121_0006433 | |||
| 1021 | Ga0496121_0008592 | |||
| 1022 | Ga0496121_0034074 | |||
| 1023 | Ga0496121_0142932 | |||
| 1024 | Ga0496122_0014195 | |||
| 1025 | Ga0496122_0028952 | |||
| 1026 | Ga0496123_0047473 | |||
| 1027 | Ga0496124_0001136 | |||
| 1028 | Ga0496124_0007875 | |||
| 1029 | Ga0496125_0059226 | |||
| 1030 | Ga0496126_0054700 | |||
| 1031 | Ga0496126_0119457 | |||
| 1032 | Ga0496126_0346849 | |||
| 1033 | Ga0495678_000019 | |||
| 1034 | Ga0501031_0168964 | |||
| 1035 | Ga0501032_0088609 | |||
| 1036 | Ga0501033_0009449 | |||
| 1037 | Ga0501033_0062339 | |||
| 1038 | Ga0501033_0286759 | |||
| 1039 | Ga0501034_0001985 | |||
| 1040 | Ga0501034_0022477 | |||
| 1041 | Ga0501034_0066222 | |||
| 1042 | Ga0501034_0686007 | |||
| 1043 | Ga0501036_0105873 | |||
| 1044 | Ga0501036_0150059 | |||
| 1045 | Ga0501037_0000790 | |||
| 1046 | Ga0501037_0350041 | |||
| 1047 | Ga0501037_0881384 | |||
| 1048 | Ga0501038_0001202 | |||
| 1049 | Ga0501038_0019743 | |||
| 1050 | Ga0501038_0045790 | |||
| 1051 | Ga0501038_0254902 | |||
| 1052 | Ga0501039_0730831 | |||
| 1053 | Ga0501042_0090035 | |||
| 1054 | Ga0501042_0927908 | |||
| 1055 | Ga0501043_0004402 | |||
| 1056 | Ga0501043_0102173 | |||
| 1057 | Ga0501043_0116266 | |||
| 1058 | Ga0501043_0301978 | |||
| 1059 | Ga0501043_0347927 | |||
| 1060 | Ga0501046_0038711 | |||
| 1061 | Ga0501046_0066893 | |||
| 1062 | Ga0501046_0397348 | |||
| 1063 | Ga0501046_0445529 | |||
| 1064 | Ga0501047_0081899 | |||
| 1065 | Ga0501047_0092413 | |||
| 1066 | Ga0501068_0086983 | |||
| 1067 | Ga0501069_0203463 | |||
| 1068 | Ga0501070_0125679 | |||
| 1069 | Ga0501070_0636909 | |||
| 1070 | Ga0501071_0182958 | |||
| 1071 | Ga0501073_0000193 | |||
| 1072 | Ga0501073_0281894 | |||
| 1073 | Ga0501074_0215049 | |||
| 1074 | Ga0501209_083093 | |||
| 1075 | Ga0501217_018851 | |||
| 1076 | Ga0501233_066785 | |||
| 1077 | Ga0501235_016151 | |||
| 1078 | Ga0501242_017641 | |||
| 1079 | Ga0501243_017862 | |||
| 1080 | Ga0501249_014675 | |||
| 1081 | Ga0501252_003627 | |||
| 1082 | Ga0501253_072571 | |||
| 1083 | Ga0501257_011199 | |||
| 1084 | Ga0501258_005660 | |||
| 1085 | Ga0501079_0046800 | |||
| 1086 | Ga0501080_0023306 | |||
| 1087 | Ga0501080_0517975 | |||
| 1088 | Ga0501083_0323169 | |||
| 1089 | Ga0501083_0362637 | |||
| 1090 | Ga0501083_1067829 | |||
| 1091 | Ga0501232_093225 | |||
| 1092 | Ga0501266_007768 | |||
| 1093 | Ga0501270_027563 | |||
| 1094 | Ga0501274_046507 | |||
| 1095 | Ga0501276_022681 | |||
| 1096 | Ga0501035_0016516 | |||
| 1097 | Ga0501035_0211846 | |||
| 1098 | Ga0501035_0219353 | |||
| 1099 | Ga0501035_0662590 | |||
| 1100 | Ga0501035_1052758 | |||
| 1101 | Ga0501035_1422860 | |||
| 1102 | Ga0501044_0000635 | |||
| 1103 | Ga0501044_0224861 | |||
| 1104 | Ga0501044_0683113 | |||
| 1105 | Ga0501044_0726868 | |||
| 1106 | Ga0501045_0422738 | |||
| 1107 | nmdc:mga03683_423529_c1 | |||
| 1108 | nmdc:mga00v17_5917_c1 | |||
| 1109 | nmdc:mga0k408_754_c1 | |||
| 1110 | Ga0500643_000101 | |||
| 1111 | Ga0500646_0006615 | |||
| 1112 | Ga0500651_0009615 | |||
| 1113 | Ga0500651_0296271 | |||
| 1114 | Ga0500555_004699 | |||
| 1115 | Ga0500655_013659 | |||
| 1116 | Ga0500658_0016220 | |||
| 1117 | Ga0500559_0010047 | |||
| 1118 | Ga0500573_0017232 | |||
| 1119 | Ga0500588_0064122 | |||
| 1120 | Ga0500637_0162922 | |||
| 1121 | Ga0500645_000443 | |||
| 1122 | Ga0500656_000577 | |||
| 1123 | Ga0501082_0000055 | |||
| 1124 | Ga0501082_0510665 | |||
| 1125 | 2548499438 | |||
| 1126 | 2643866262 | |||
| 1127 | 2644057491 | |||
| 1128 | 2644072420 | |||
| 1129 | 2644293062 | |||
| 1130 | 2644648102 | |||
| 1131 | 2974320780 | |||
| 1132 | 2990714314 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9809 | 1 | 145 |
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9778 | 1 | 145 |
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9743 | 1 | 145 |
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9712 | 1 | 145 |
| 2dbo-assembly1.cif.gz_A-2 | crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus | 0.9559 | 1 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9809 | 1 | 145 | 3.50.80.10 |
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9743 | 1 | 145 | 3.50.80.10 |
| 2dboA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9559 | 1 | 144 | 3.50.80.10 |
| af_Q2FXU2_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9448 | 1 | 145 | 3.50.80.10 |
| af_F1QGC8_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9442 | 1 | 146 | 3.50.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B3B8D5-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9879 | 2 | 145 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A1F6TM15-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.986 | 1 | 145 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A1I7K6K3-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9859 | 1 | 145 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A521VUH1-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9855 | 1 | 146 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A661D976-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9854 | 1 | 145 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |