F464388

General Info

Members Datasets Scaffolds Average Seq Length
566 333 1132 148

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10165158|Ga0105239_101651582
Length 181
Sequence LTAALGDMVDARARLFLRGKAACADAFPAHPMLALIQRVTRAEVRVADESVGAIGPGLLALVAVEPGDGEPQAQRLCERLLGYRVFDDGDGRMNRSLADTGGGLLLVSQFTLAADTRKGMRPGFSTAATPEVGLRWFNRLAEIAKTCHPQVEIGRYGAHMQIELVNDGPVTFLLVARSQPG

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
62 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
175 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
176 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
179 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
180 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
184 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
187 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
188 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
243 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
244 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
245 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
289 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
290 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
291 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
292 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
293 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
294 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
295 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
296 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
297 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
298 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
303 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
304 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
305 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
306 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
314 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
315 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
316 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
317 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
318 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
321 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
322 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 2547132374 Acidovorax radicis N35 Isolate Unclassified
327 2643221570 Acidovorax sp. Root568 Isolate Unclassified
328 2643221609 Acidovorax sp. Root217 Isolate Unclassified
329 2643221611 Acidovorax sp. Root219 Isolate Unclassified
330 2643221652 Acidovorax sp. Root402 Isolate Unclassified
331 2643221717 Acidovorax sp. Root267 Isolate Unclassified
332 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
333 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 0.35
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 0
Rhizoplane 3.53
Rhizosphere 82.33
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10165158 3300010375 Bacteria 2475
2 SwRhRL3b_contig_2972607 2162886006 Bacteria 2084
3 JGI25151J46595_10015980 3300003187 Bacteria 3293
4 JGI25406J46586_10003534 3300003203 Bacteria 7339
5 Ga0006562J51391_1026968 3300003578 Bacteria 14220
6 Ga0006562J51391_1026972 3300003578 Bacteria 9050
7 Ga0055536_1013519 3300003781 Bacteria 2935
8 Ga0055530_10004848 3300003791 Bacteria 6723
9 Ga0055531_10023046 3300003794 Bacteria 2350
10 Ga0055531_10031230 3300003794 Bacteria 1768
11 Ga0065704_10093065 3300005289 Bacteria 2619
12 Ga0065715_10132194 3300005293 Bacteria 1994
13 Ga0065715_10552691 3300005293 Bacteria 739
14 Ga0070658_10013000 3300005327 Bacteria 6680
15 Ga0070683_100417513 3300005329 Bacteria 1280
16 Ga0070670_100065955 3300005331 Bacteria 3106
17 Ga0070670_100110501 3300005331 Bacteria 2368
18 Ga0070670_100489414 3300005331 Bacteria 1093
19 Ga0068869_100053777 3300005334 Bacteria 2928
20 Ga0068869_100394469 3300005334 Bacteria 1137
21 Ga0068869_100776897 3300005334 Bacteria 822
22 Ga0070666_10000001 3300005335 Bacteria 543080
23 Ga0070680_100644025 3300005336 Bacteria 911
24 Ga0070682_100659763 3300005337 Bacteria 834
25 Ga0068868_100050204 3300005338 Bacteria 3275
26 Ga0070689_100323480 3300005340 Bacteria 1288
27 Ga0070691_10151167 3300005341 Bacteria 1190
28 Ga0070661_100016152 3300005344 Bacteria 5270
29 Ga0070661_100753317 3300005344 Bacteria 796
30 Ga0070668_100022301 3300005347 Bacteria 4785
31 Ga0070667_100000465 3300005367 Bacteria 41668
32 Ga0070667_100898497 3300005367 Bacteria 824
33 Ga0070667_100994506 3300005367 Bacteria 782
34 Ga0070663_100017743 3300005455 Bacteria 4652
35 Ga0070663_100151336 3300005455 Bacteria 1779
36 Ga0070662_100704968 3300005457 Bacteria 854
37 Ga0070706_100831551 3300005467 Bacteria 854
38 Ga0070699_101929381 3300005518 Bacteria 540
39 Ga0070684_100421023 3300005535 Bacteria 1233
40 Ga0070684_100943987 3300005535 Bacteria 809
41 Ga0068853_100341013 3300005539 Bacteria 1392
42 Ga0068853_100678879 3300005539 Bacteria 981
43 Ga0068853_100962073 3300005539 Bacteria 821
44 Ga0070665_100026645 3300005548 Bacteria 5820
45 Ga0070665_100094508 3300005548 Bacteria 2994
46 Ga0070665_100204427 3300005548 Bacteria 1975
47 Ga0070665_100292763 3300005548 Bacteria 1630
48 Ga0070665_100300367 3300005548 Bacteria 1608
49 Ga0070665_100641034 3300005548 Bacteria 1075
50 Ga0068855_100135814 3300005563 Bacteria 2806
51 Ga0068855_100438241 3300005563 Bacteria 1427
52 Ga0070664_100064937 3300005564 Bacteria 3113
53 Ga0070664_100583636 3300005564 Bacteria 1036
54 Ga0068852_100066547 3300005616 Bacteria 3147
55 Ga0068852_100086798 3300005616 Bacteria 2790
56 Ga0068852_100554300 3300005616 Bacteria 1150
57 Ga0068852_100693768 3300005616 Bacteria 1028
58 Ga0068852_101298173 3300005616 Bacteria 749
59 Ga0068859_100015514 3300005617 Bacteria 7654
60 Ga0068859_100821289 3300005617 Bacteria 1016
61 Ga0068859_101345086 3300005617 Unclassified 787
62 Ga0068864_100053622 3300005618 Bacteria 3479
63 Ga0068851_10009487 3300005834 Bacteria 4527
64 Ga0068851_10078268 3300005834 Bacteria 1723
65 Ga0068851_10195837 3300005834 Bacteria 1126
66 Ga0068863_100060881 3300005841 Bacteria 3570
67 Ga0068863_100104501 3300005841 Bacteria 2694
68 Ga0068863_100944657 3300005841 Bacteria 863
69 Ga0068863_101181979 3300005841 Bacteria 770
70 Ga0068858_100046015 3300005842 Bacteria 4045
71 Ga0068858_100083220 3300005842 Bacteria 2975
72 Ga0068858_101167354 3300005842 Bacteria 756
73 Ga0068860_100040462 3300005843 Bacteria 4454
74 Ga0068860_100354739 3300005843 Bacteria 1444
75 Ga0068862_100000076 3300005844 Bacteria 117053
76 Ga0068862_100067410 3300005844 Bacteria 3085
77 Ga0068862_100703070 3300005844 Bacteria 979
78 Ga0068862_101598105 3300005844 Bacteria 659
79 Ga0081455_10000460 3300005937 Bacteria 53331
80 Ga0081540_1042908 3300005983 Bacteria 2327
81 Ga0081539_10000007 3300005985 Bacteria 532790
82 Ga0075367_10531423 3300006178 Bacteria 747
83 Ga0075366_10000521 3300006195 Bacteria 17803
84 Ga0097621_100090659 3300006237 Bacteria 2558
85 Ga0097621_100168872 3300006237 Bacteria 1884
86 Ga0097621_100173364 3300006237 Bacteria 1860
87 Ga0068871_100046799 3300006358 Bacteria 3486
88 Ga0068871_100049867 3300006358 Bacteria 3385
89 Ga0068871_100122799 3300006358 Bacteria 2195
90 Ga0068871_100255787 3300006358 Bacteria 1526
91 Ga0068871_101700667 3300006358 Bacteria 598
92 Ga0075430_101735460 3300006846 Bacteria 512
93 Ga0068865_100056294 3300006881 Bacteria 2739
94 Ga0097620_100015515 3300006931 Bacteria 7654
95 Ga0097620_100821321 3300006931 Bacteria 1016
96 Ga0097620_101345511 3300006931 Unclassified 787
97 Ga0105251_10006229 3300009011 Bacteria 7647
98 Ga0105244_10018457 3300009036 Bacteria 3914
99 Ga0105244_10051533 3300009036 Bacteria 2097
100 Ga0105244_10231377 3300009036 Bacteria 865
101 Ga0105250_10112934 3300009092 Bacteria 1113
102 Ga0105240_10561322 3300009093 Bacteria 1262
103 Ga0105245_10283426 3300009098 Bacteria 1620
104 Ga0105247_10000804 3300009101 Bacteria 23935
105 Ga0105247_10059220 3300009101 Bacteria 2371
106 Ga0105247_10086053 3300009101 Bacteria 1988
107 Ga0105243_13124911 3300009148 Bacteria 501
108 Ga0105248_10035211 3300009177 Bacteria 5601
109 Ga0105248_10149032 3300009177 Bacteria 2640
110 Ga0105237_10216574 3300009545 Bacteria 1915
111 Ga0105237_10362614 3300009545 Bacteria 1453
112 Ga0105237_10720901 3300009545 Bacteria 1004
113 Ga0105237_11178394 3300009545 Bacteria 773
114 Ga0105238_10000729 3300009551 Bacteria 34322
115 Ga0105238_10159934 3300009551 Bacteria 2228
116 Ga0105238_10219101 3300009551 Bacteria 1879
117 Ga0105239_10001310 3300010375 Bacteria 33536
118 Ga0105239_10152865 3300010375 Bacteria 2576
119 Ga0105239_10226422 3300010375 Bacteria 2098
120 Ga0157317_1004006 3300012475 Bacteria 943
121 Ga0157329_1003994 3300012491 Bacteria 934
122 Ga0157373_10418109 3300013100 Bacteria 962
123 Ga0157371_10010277 3300013102 Bacteria 7300
124 Ga0157370_10031743 3300013104 Bacteria 5164
125 Ga0157370_10228224 3300013104 Bacteria 1724
126 Ga0157370_10919356 3300013104 Bacteria 794
127 Ga0157369_10006959 3300013105 Bacteria 13044
128 Ga0157369_10311131 3300013105 Bacteria 1638
129 Ga0157374_10560897 3300013296 Bacteria 1150
130 Ga0157378_10179126 3300013297 Bacteria 1993
131 Ga0163162_10000310 3300013306 Bacteria 45072
132 Ga0157372_10049630 3300013307 Bacteria 4667
133 Ga0157372_10185943 3300013307 Bacteria 2406
134 Ga0157372_10371636 3300013307 Bacteria 1666
135 Ga0157372_10908423 3300013307 Bacteria 1021
136 Ga0157372_10932414 3300013307 Bacteria 1007
137 Ga0157375_10172013 3300013308 Bacteria 2314
138 Ga0157375_10251947 3300013308 Bacteria 1926
139 Ga0163163_11430681 3300014325 Bacteria 753
140 Ga0182008_10015693 3300014497 Bacteria 3949
141 Ga0157379_10049724 3300014968 Bacteria 3743
142 Ga0157379_10272710 3300014968 Bacteria 1539
143 Ga0157379_10671244 3300014968 Bacteria 971
144 Ga0157376_10005857 3300014969 Bacteria 8620
145 Ga0157376_10378293 3300014969 Bacteria 1363
146 Ga0157376_10803576 3300014969 Bacteria 953
147 Ga0157376_11427513 3300014969 Bacteria 724
148 Ga0182007_10000142 3300015262 Bacteria 47856
149 Ga0182007_10005399 3300015262 Bacteria 5617
150 Ga0182005_1000456 3300015265 Bacteria 21433
151 Ga0182005_1005723 3300015265 Bacteria 3858
152 Ga0163161_10006187 3300017792 Bacteria 8293
153 Ga0163161_10030811 3300017792 Bacteria 3820
154 Ga0209148_1000686 3300025254 Bacteria 28101
155 Ga0209673_1010180 3300025273 Bacteria 3989
156 Ga0209675_1014305 3300025291 Bacteria 2422
157 Ga0209676_1000052 3300025292 Bacteria 371539
158 Ga0209676_1000612 3300025292 Bacteria 52191
159 Ga0209676_1003607 3300025292 Bacteria 9320
160 Ga0209676_1033599 3300025292 Bacteria 1526
161 Ga0209025_1011950 3300025294 Bacteria 5641
162 Ga0209564_1005388 3300025295 Bacteria 7330
163 Ga0209050_1004964 3300025298 Bacteria 8665
164 Ga0209256_1003876 3300025299 Bacteria 9931
165 Ga0209256_1006477 3300025299 Bacteria 6166
166 Ga0209256_1019151 3300025299 Bacteria 2192
167 Ga0209051_1022393 3300025303 Bacteria 2661
168 Ga0209257_1000261 3300025304 Bacteria 121357
169 Ga0209257_1008033 3300025304 Bacteria 6147
170 Ga0209257_1008123 3300025304 Bacteria 6093
171 Ga0209257_1008529 3300025304 Bacteria 5792
172 Ga0207656_10025181 3300025321 Bacteria 2413
173 Ga0207656_10027086 3300025321 Bacteria 2342
174 Ga0207655_1022900 3300025728 Bacteria 3113
175 Ga0207692_10197443 3300025898 Bacteria 1181
176 Ga0207710_10028070 3300025900 Bacteria 2441
177 Ga0207680_10000003 3300025903 Bacteria 925264
178 Ga0207680_10176690 3300025903 Bacteria 1441
179 Ga0207705_10018223 3300025909 Bacteria 5020
180 Ga0207671_10093721 3300025914 Bacteria 2265
181 Ga0207671_10158417 3300025914 Bacteria 1752
182 Ga0207671_11359181 3300025914 Bacteria 552
183 Ga0207660_10891057 3300025917 Bacteria 726
184 Ga0207649_10009717 3300025920 Bacteria 5268
185 Ga0207649_10091633 3300025920 Bacteria 1991
186 Ga0207649_10230572 3300025920 Bacteria 1324
187 Ga0207649_10272671 3300025920 Bacteria 1227
188 Ga0207681_10494999 3300025923 Bacteria 1000
189 Ga0207694_10000336 3300025924 Bacteria 44443
190 Ga0207694_10032818 3300025924 Bacteria 3976
191 Ga0207694_10695077 3300025924 Bacteria 858
192 Ga0207650_10372361 3300025925 Bacteria 1178
193 Ga0207650_10392351 3300025925 Bacteria 1148
194 Ga0207650_11052700 3300025925 Bacteria 692
195 Ga0207687_10181411 3300025927 Bacteria 1631
196 Ga0207690_11296709 3300025932 Bacteria 609
197 Ga0207706_10828811 3300025933 Bacteria 784
198 Ga0207704_10128029 3300025938 Bacteria 1752
199 Ga0207711_10646443 3300025941 Bacteria 987
200 Ga0207689_10034615 3300025942 Bacteria 4195
201 Ga0207661_10056674 3300025944 Bacteria 3147
202 Ga0207667_10603878 3300025949 Bacteria 1106
203 Ga0207712_10751137 3300025961 Bacteria 854
204 Ga0207668_10187970 3300025972 Bacteria 1634
205 Ga0207668_10684651 3300025972 Bacteria 900
206 Ga0207640_10809010 3300025981 Bacteria 812
207 Ga0207658_10062749 3300025986 Bacteria 2782
208 Ga0207658_10668084 3300025986 Bacteria 937
209 Ga0207677_10250485 3300026023 Bacteria 1438
210 Ga0207703_10328594 3300026035 Bacteria 1402
211 Ga0207639_10111615 3300026041 Bacteria 2229
212 Ga0207639_10749378 3300026041 Bacteria 908
213 Ga0207678_10021801 3300026067 Bacteria 5618
214 Ga0207678_10159979 3300026067 Bacteria 1923
215 Ga0207678_10161076 3300026067 Bacteria 1916
216 Ga0207702_10999831 3300026078 Bacteria 830
217 Ga0207641_10551263 3300026088 Bacteria 1124
218 Ga0207641_12160990 3300026088 Unclassified 557
219 Ga0207674_11835847 3300026116 Bacteria 573
220 Ga0207675_101334640 3300026118 Bacteria 738
221 Ga0207698_10064973 3300026142 Bacteria 2863
222 Ga0209984_1063570 3300027424 Bacteria 548
223 Ga0209995_1030627 3300027471 Bacteria 900
224 Ga0209982_1008725 3300027552 Bacteria 1490
225 Ga0210002_1013705 3300027617 Bacteria 1267
226 Ga0209971_1002018 3300027682 Bacteria 4935
227 Ga0209974_10016938 3300027876 Bacteria 2419
228 Ga0209974_10161704 3300027876 Bacteria 812
229 Ga0268266_10000011 3300028379 Bacteria 757403
230 Ga0268266_10027462 3300028379 Bacteria 4839
231 Ga0268266_10090491 3300028379 Bacteria 2682
232 Ga0268266_10101567 3300028379 Bacteria 2536
233 Ga0268266_10143530 3300028379 Bacteria 2144
234 Ga0268265_10000054 3300028380 Bacteria 165504
235 Ga0268265_10027941 3300028380 Bacteria 4034
236 Ga0268265_10747165 3300028380 Bacteria 949
237 Ga0268264_10045880 3300028381 Bacteria 3630
238 Ga0268264_11561243 3300028381 Bacteria 671
239 Ga0265337_1005508 3300028556 Bacteria 5023
240 Ga0265326_10138458 3300028558 Bacteria 694
241 Ga0265323_10053101 3300028653 Bacteria 1432
242 Ga0265323_10074653 3300028653 Bacteria 1153
243 Ga0265322_10021312 3300028654 Bacteria 1857
244 Ga0265330_10000267 3300031235 Bacteria 38266
245 Ga0265330_10000425 3300031235 Bacteria 28316
246 Ga0265330_10003657 3300031235 Bacteria 7994
247 Ga0265330_10025461 3300031235 Bacteria 2681
248 Ga0265330_10087550 3300031235 Bacteria 1338
249 Ga0265332_10000031 3300031238 Bacteria 162330
250 Ga0265332_10182304 3300031238 Bacteria 874
251 Ga0265320_10132836 3300031240 Bacteria 1130
252 Ga0265325_10003142 3300031241 Bacteria 10891
253 Ga0265325_10027234 3300031241 Bacteria 3091
254 Ga0265329_10000026 3300031242 Bacteria 61009
255 Ga0265329_10127460 3300031242 Bacteria 818
256 Ga0265340_10002395 3300031247 Bacteria 10666
257 Ga0265340_10015502 3300031247 Bacteria 3960
258 Ga0265340_10315639 3300031247 Bacteria 692
259 Ga0265339_10080517 3300031249 Bacteria 1722
260 Ga0265331_10009095 3300031250 Bacteria 5609
261 Ga0265331_10319595 3300031250 Bacteria 695
262 Ga0265316_10000041 3300031344 Bacteria 137206
263 Ga0265316_10174729 3300031344 Bacteria 1601
264 Ga0265316_10314063 3300031344 Bacteria 1139
265 Ga0307509_10262981 3300031507 Bacteria 1499
266 Ga0307408_100315384 3300031548 Bacteria 1315
267 Ga0307408_100556977 3300031548 Bacteria 1012
268 Ga0316575_10013903 3300031665 Bacteria 3015
269 Ga0316575_10255907 3300031665 Bacteria 735
270 Ga0316579_10109102 3300031691 Bacteria 1328
271 Ga0265314_10000040 3300031711 Bacteria 218764
272 Ga0265314_10000095 3300031711 Bacteria 134372
273 Ga0265314_10001552 3300031711 Bacteria 25312
274 Ga0265314_10022605 3300031711 Bacteria 4816
275 Ga0265314_10209430 3300031711 Bacteria 1146
276 Ga0265342_10000053 3300031712 Bacteria 121955
277 Ga0265342_10000534 3300031712 Bacteria 40495
278 Ga0265342_10005068 3300031712 Bacteria 10153
279 Ga0265342_10005916 3300031712 Bacteria 9216
280 Ga0265342_10194306 3300031712 Bacteria 1106
281 Ga0316576_10055399 3300031727 Bacteria 2894
282 Ga0316576_10058891 3300031727 Bacteria 2810
283 Ga0316576_10097345 3300031727 Bacteria 2197
284 Ga0316576_10386571 3300031727 Bacteria 1038
285 Ga0316578_10003230 3300031728 Bacteria 7398
286 Ga0316578_10018765 3300031728 Bacteria 3797
287 Ga0307405_10251909 3300031731 Bacteria 1314
288 Ga0316577_10680407 3300031733 Bacteria 585
289 Ga0307413_10035842 3300031824 Bacteria 2850
290 Ga0307413_10161570 3300031824 Bacteria 1574
291 Ga0307407_10049146 3300031903 Bacteria 2405
292 Ga0307412_10002538 3300031911 Bacteria 10147
293 Ga0307412_10162169 3300031911 Bacteria 1662
294 Ga0307409_100309035 3300031995 Bacteria 1474
295 Ga0307409_102148253 3300031995 Bacteria 588
296 Ga0307416_100279249 3300032002 Bacteria 1646
297 Ga0307416_100365210 3300032002 Bacteria 1467
298 Ga0307414_10141984 3300032004 Bacteria 1881
299 Ga0307411_10127826 3300032005 Bacteria 1851
300 Ga0307411_10632296 3300032005 Bacteria 924
301 Ga0307415_101935825 3300032126 Bacteria 573
302 Ga0316583_10002064 3300032133 Bacteria 6894
303 Ga0316580_10003696 3300032139 Bacteria 4378
304 Ga0307510_10037923 3300033180 Bacteria 5336
305 Ga0373951_0137921 3300035091 Bacteria 675
306 Ga0316574_0010361 3300035398 Bacteria 5265
307 Ga0316574_0037278 3300035398 Bacteria 2981
308 Ga0316574_0159411 3300035398 Bacteria 1453
309 Ga0316582_0224787 3300036647 Bacteria 1284
310 Ga0316582_0445910 3300036647 Bacteria 892
311 Ga0316584_0023954 3300036712 Bacteria 4463
312 Ga0316584_0085084 3300036712 Bacteria 2368
313 Ga0395900_0243213 3300037418 Bacteria 1804
314 Ga0395905_0004059 3300037471 Bacteria 15349
315 Ga0439453_0098399 3300041408 Bacteria 650
316 Ga0439465_0002275 3300041413 Bacteria 6310
317 Ga0439465_0004449 3300041413 Bacteria 4535
318 Ga0451791_0048244 3300041451 Bacteria 568
319 Ga0451795_0606827 3300041456 Bacteria 985
320 Ga0451800_1248717 3300041459 Bacteria 529
321 Ga0451804_1093370 3300041463 Bacteria 508
322 Ga0451807_0165466 3300041486 Bacteria 852
323 Ga0451807_0484707 3300041486 Bacteria 663
324 Ga0451833_1090284 3300041491 Bacteria 790
325 Ga0451837_1099414 3300041494 Bacteria 1719
326 Ga0451841_0410757 3300041498 Bacteria 1067
327 Ga0439445_0141555 3300042004 Bacteria 697
328 Ga0439449_0040165 3300042007 Bacteria 1739
329 Ga0439450_006902 3300042008 Bacteria 2061
330 Ga0439452_067921 3300042010 Bacteria 789
331 Ga0439462_0031205 3300042015 Bacteria 1411
332 Ga0450912_019654 3300042116 Bacteria 646
333 Ga0450921_011842 3300042123 Bacteria 749
334 Ga0450897_007632 3300042128 Bacteria 990
335 Ga0450908_000010 3300042184 Bacteria 47196
336 Ga0450909_022902 3300042185 Bacteria 936
337 Ga0451577_0334223 3300042876 Bacteria 1374
338 Ga0451577_0626694 3300042876 Bacteria 976
339 Ga0439440_0029733 3300042993 Bacteria 1283
340 Ga0453683_0780882 3300044673 Bacteria 628
341 Ga0453684_0041513 3300044712 Bacteria 6220
342 Ga0451576_0072851 3300045051 Bacteria 3574
343 Ga0495617_000085 3300046452 Bacteria 67837
344 Ga0495617_001170 3300046452 Bacteria 11853
345 Ga0495603_0003097 3300046455 Bacteria 9880
346 Ga0495591_019008 3300046458 Bacteria 2313
347 Ga0495629_0002905 3300046459 Bacteria 13070
348 Ga0495638_0000754 3300046460 Bacteria 34482
349 Ga0495638_0059747 3300046460 Bacteria 2359
350 Ga0495650_0000191 3300046471 Bacteria 132016
351 Ga0495650_0001130 3300046471 Bacteria 29006
352 Ga0495650_0011597 3300046471 Bacteria 4815
353 Ga0495650_0053605 3300046471 Bacteria 1650
354 Ga0495582_0031889 3300046473 Bacteria 2898
355 Ga0495662_0159366 3300046476 Bacteria 1112
356 Ga0495664_0233741 3300046477 Bacteria 1112
357 Ga0495584_0000457 3300046491 Bacteria 28087
358 Ga0495584_0267902 3300046491 Bacteria 868
359 Ga0495585_0000008 3300046492 Bacteria 278949
360 Ga0495585_0004032 3300046492 Bacteria 9672
361 Ga0495607_0000006 3300046501 Bacteria 281664
362 Ga0495607_0000131 3300046501 Bacteria 80259
363 Ga0495583_0043459 3300046506 Bacteria 2092
364 Ga0495606_0001253 3300046507 Bacteria 35422
365 Ga0495606_0001443 3300046507 Bacteria 31874
366 Ga0495606_0026870 3300046507 Bacteria 4090
367 Ga0495606_0175841 3300046507 Bacteria 1238
368 Ga0495608_0193802 3300046511 Bacteria 1282
369 Ga0495610_0003274 3300046512 Bacteria 12764
370 Ga0495610_0013443 3300046512 Bacteria 4864
371 Ga0495616_0000401 3300046513 Bacteria 33353
372 Ga0495616_0002110 3300046513 Bacteria 13330
373 Ga0495620_0000365 3300046515 Bacteria 31131
374 Ga0495620_0004937 3300046515 Bacteria 7484
375 Ga0495631_0000444 3300046518 Bacteria 28367
376 Ga0495631_0004475 3300046518 Bacteria 7442
377 Ga0495632_0000531 3300046519 Bacteria 36042
378 Ga0495632_0033849 3300046519 Bacteria 2620
379 Ga0495632_0050691 3300046519 Bacteria 2045
380 Ga0495632_0254188 3300046519 Bacteria 787
381 Ga0495637_0005634 3300046520 Bacteria 6357
382 Ga0495644_0101185 3300046523 Bacteria 1090
383 Ga0495648_0000878 3300046524 Bacteria 31691
384 Ga0495648_0086672 3300046524 Bacteria 1765
385 Ga0495648_0347489 3300046524 Bacteria 678
386 Ga0495663_0120084 3300046525 Bacteria 879
387 Ga0495654_0031990 3300046530 Bacteria 2668
388 Ga0495665_0015986 3300046531 Bacteria 4044
389 Ga0495586_0114105 3300046535 Bacteria 1505
390 Ga0495597_0000256 3300046542 Bacteria 48492
391 Ga0495645_0019844 3300046543 Bacteria 4843
392 Ga0495667_0036668 3300046559 Bacteria 3271
393 Ga0495668_0008520 3300046616 Bacteria 6387
394 Ga0495634_0206359 3300046642 Bacteria 1218
395 Ga0495611_0000002 3300046648 Bacteria 705677
396 Ga0495611_0000381 3300046648 Bacteria 28324
397 Ga0495625_0000002 3300046660 Bacteria 813323
398 Ga0495625_0005416 3300046660 Bacteria 11653
399 Ga0495661_0000184 3300046665 Bacteria 71844
400 Ga0495646_0007986 3300046680 Bacteria 6727
401 Ga0495669_0031766 3300046684 Bacteria 2319
402 Ga0495624_0141422 3300046690 Bacteria 1474
403 Ga0495670_0011921 3300046691 Bacteria 4277
404 Ga0495670_0013664 3300046691 Bacteria 3993
405 Ga0495670_0040492 3300046691 Bacteria 2323
406 Ga0495670_0060173 3300046691 Bacteria 1908
407 Ga0495671_0000622 3300046692 Bacteria 25995
408 Ga0495649_0019027 3300046694 Bacteria 3858
409 Ga0495589_0000190 3300046794 Bacteria 54374
410 Ga0495589_0017164 3300046794 Bacteria 3717
411 Ga0495600_0015858 3300046809 Bacteria 4773
412 Ga0495660_0000437 3300046810 Bacteria 34919
413 Ga0495660_0000447 3300046810 Bacteria 34412
414 Ga0495581_0012810 3300047315 Bacteria 4857
415 Ga0495680_0064046 3300047322 Bacteria 2821
416 Ga0495683_0001059 3300047323 Bacteria 19067
417 Ga0495679_000003 3300047446 Bacteria 787868
418 Ga0495679_171020 3300047446 Bacteria 578
419 Ga0495673_0000004 3300047469 Bacteria 1354526
420 Ga0495673_0000062 3300047469 Bacteria 226461
421 Ga0495673_0002144 3300047469 Bacteria 14333
422 Ga0495681_0191049 3300047470 Bacteria 836
423 Ga0495684_0147266 3300047471 Bacteria 1763
424 Ga0495686_0000426 3300047472 Bacteria 66285
425 Ga0495686_0001228 3300047472 Bacteria 29296
426 Ga0495686_0004756 3300047472 Bacteria 10985
427 Ga0495593_0041278 3300047673 Bacteria 2481
428 Ga0496100_0031620 3300048903 Bacteria 3292
429 Ga0496101_0001031 3300048904 Bacteria 16431
430 Ga0496101_0020135 3300048904 Bacteria 4563
431 Ga0496101_0125986 3300048904 Bacteria 1941
432 Ga0496101_1357283 3300048904 Bacteria 555
433 Ga0496102_0600125 3300048905 Bacteria 1024
434 Ga0496103_0119197 3300048906 Bacteria 1680
435 Ga0496104_0105231 3300048907 Bacteria 2704
436 Ga0496106_0000168 3300048909 Bacteria 47597
437 Ga0496106_0406384 3300048909 Bacteria 1094
438 Ga0496110_0291989 3300048913 Bacteria 1485
439 Ga0496112_0104348 3300048915 Bacteria 2805
440 Ga0496114_0146325 3300048917 Bacteria 2048
441 Ga0496115_0020344 3300048918 Bacteria 5119
442 Ga0496116_0061514 3300048919 Bacteria 2430
443 Ga0496116_0253420 3300048919 Bacteria 874
444 Ga0496117_0035395 3300048920 Bacteria 3748
445 Ga0496117_0113572 3300048920 Bacteria 1681
446 Ga0496117_0358411 3300048920 Bacteria 750
447 Ga0496118_0002160 3300048921 Bacteria 27394
448 Ga0496118_0009060 3300048921 Bacteria 10142
449 Ga0496118_0022644 3300048921 Bacteria 5484
450 Ga0496118_0135233 3300048921 Bacteria 1575
451 Ga0496119_0008949 3300048922 Bacteria 8694
452 Ga0496119_0083452 3300048922 Bacteria 1835
453 Ga0496121_0000116 3300048924 Bacteria 177260
454 Ga0496121_0006433 3300048924 Bacteria 14585
455 Ga0496121_0008592 3300048924 Bacteria 11958
456 Ga0496121_0034074 3300048924 Bacteria 4590
457 Ga0496121_0142932 3300048924 Bacteria 1772
458 Ga0496122_0014195 3300048925 Bacteria 7721
459 Ga0496122_0028952 3300048925 Bacteria 4684
460 Ga0496123_0047473 3300048926 Bacteria 2900
461 Ga0496124_0001136 3300048927 Bacteria 41813
462 Ga0496124_0007875 3300048927 Bacteria 11223
463 Ga0496125_0059226 3300048928 Bacteria 3088
464 Ga0496126_0054700 3300048929 Bacteria 3613
465 Ga0496126_0119457 3300048929 Bacteria 2287
466 Ga0496126_0346849 3300048929 Bacteria 1215
467 Ga0495678_000019 3300049459 Bacteria 269723
468 Ga0501031_0168964 3300049568 Bacteria 1429
469 Ga0501032_0088609 3300049569 Bacteria 2054
470 Ga0501033_0009449 3300049570 Bacteria 7508
471 Ga0501033_0062339 3300049570 Bacteria 2745
472 Ga0501033_0286759 3300049570 Bacteria 1161
473 Ga0501034_0001985 3300049571 Bacteria 25904
474 Ga0501034_0022477 3300049571 Bacteria 6427
475 Ga0501034_0066222 3300049571 Bacteria 3625
476 Ga0501034_0686007 3300049571 Bacteria 924
477 Ga0501036_0105873 3300049572 Bacteria 2378
478 Ga0501036_0150059 3300049572 Bacteria 1966
479 Ga0501037_0000790 3300049573 Bacteria 23802
480 Ga0501037_0350041 3300049573 Bacteria 1019
481 Ga0501037_0881384 3300049573 Bacteria 587
482 Ga0501038_0001202 3300049574 Bacteria 23488
483 Ga0501038_0019743 3300049574 Bacteria 6066
484 Ga0501038_0045790 3300049574 Bacteria 3796
485 Ga0501038_0254902 3300049574 Bacteria 1389
486 Ga0501039_0730831 3300049575 Bacteria 773
487 Ga0501042_0090035 3300049578 Bacteria 2202
488 Ga0501042_0927908 3300049578 Bacteria 634
489 Ga0501043_0004402 3300049579 Bacteria 11442
490 Ga0501043_0102173 3300049579 Bacteria 2253
491 Ga0501043_0116266 3300049579 Bacteria 2099
492 Ga0501043_0301978 3300049579 Bacteria 1223
493 Ga0501043_0347927 3300049579 Bacteria 1126
494 Ga0501046_0038711 3300049580 Bacteria 3824
495 Ga0501046_0066893 3300049580 Bacteria 2799
496 Ga0501046_0397348 3300049580 Bacteria 996
497 Ga0501046_0445529 3300049580 Bacteria 931
498 Ga0501047_0081899 3300049581 Bacteria 3102
499 Ga0501047_0092413 3300049581 Bacteria 2904
500 Ga0501068_0086983 3300049584 Bacteria 1925
501 Ga0501069_0203463 3300049585 Bacteria 1148
502 Ga0501070_0125679 3300049586 Bacteria 2119
503 Ga0501070_0636909 3300049586 Bacteria 847
504 Ga0501071_0182958 3300049587 Bacteria 1570
505 Ga0501073_0000193 3300049589 Bacteria 40258
506 Ga0501073_0281894 3300049589 Bacteria 1147
507 Ga0501074_0215049 3300049590 Bacteria 1369
508 Ga0501209_083093 3300049656 Bacteria 925
509 Ga0501217_018851 3300049661 Bacteria 1606
510 Ga0501233_066785 3300049668 Bacteria 904
511 Ga0501235_016151 3300049669 Bacteria 1648
512 Ga0501242_017641 3300049674 Bacteria 902
513 Ga0501243_017862 3300049675 Bacteria 1152
514 Ga0501249_014675 3300049679 Bacteria 1671
515 Ga0501252_003627 3300049682 Bacteria 1602
516 Ga0501253_072571 3300049683 Bacteria 763
517 Ga0501257_011199 3300049686 Bacteria 2045
518 Ga0501258_005660 3300049687 Bacteria 1218
519 Ga0501079_0046800 3300049741 Bacteria 3338
520 Ga0501080_0023306 3300049742 Bacteria 5739
521 Ga0501080_0517975 3300049742 Bacteria 1064
522 Ga0501083_0323169 3300049744 Bacteria 1003
523 Ga0501083_0362637 3300049744 Bacteria 942
524 Ga0501083_1067829 3300049744 Bacteria 526
525 Ga0501232_093225 3300049757 Bacteria 520
526 Ga0501266_007768 3300049763 Bacteria 1347
527 Ga0501270_027563 3300049767 Bacteria 914
528 Ga0501274_046507 3300049771 Bacteria 534
529 Ga0501276_022681 3300049773 Bacteria 612
530 Ga0501035_0016516 3300049822 Bacteria 6806
531 Ga0501035_0211846 3300049822 Bacteria 1657
532 Ga0501035_0219353 3300049822 Bacteria 1624
533 Ga0501035_0662590 3300049822 Bacteria 845
534 Ga0501035_1052758 3300049822 Bacteria 637
535 Ga0501035_1422860 3300049822 Bacteria 531
536 Ga0501044_0000635 3300049823 Bacteria 42394
537 Ga0501044_0224861 3300049823 Bacteria 1826
538 Ga0501044_0683113 3300049823 Bacteria 913
539 Ga0501044_0726868 3300049823 Bacteria 876
540 Ga0501045_0422738 3300049824 Bacteria 991
541 nmdc:mga03683_423529_c1 3300050489 Bacteria 638
542 nmdc:mga00v17_5917_c1 3300050491 Bacteria 3109
543 nmdc:mga0k408_754_c1 3300050493 Bacteria 17806
544 Ga0500643_000101 3300053087 Bacteria 88318
545 Ga0500646_0006615 3300053090 Bacteria 2950
546 Ga0500651_0009615 3300053093 Bacteria 5759
547 Ga0500651_0296271 3300053093 Bacteria 929
548 Ga0500555_004699 3300053103 Bacteria 3879
549 Ga0500655_013659 3300053133 Bacteria 1483
550 Ga0500658_0016220 3300053134 Bacteria 2774
551 Ga0500559_0010047 3300053136 Bacteria 4076
552 Ga0500573_0017232 3300053140 Bacteria 4111
553 Ga0500588_0064122 3300053146 Bacteria 1186
554 Ga0500637_0162922 3300053178 Unclassified 1285
555 Ga0500645_000443 3300053730 Bacteria 28379
556 Ga0500656_000577 3300053732 Bacteria 2799
557 Ga0501082_0000055 3300060353 Bacteria 80800
558 Ga0501082_0510665 3300060353 Bacteria 1050
559 2548499438 2547132374 Bacteria 5530232
560 2643866262 2643221570 Bacteria 5103772
561 2644057491 2643221609 Bacteria 6756331
562 2644072420 2643221611 Bacteria 6820941
563 2644293062 2643221652 Bacteria 5140275
564 2644648102 2643221717 Bacteria 5676132
565 2974320780 2974320154 Bacteria 4571377
566 2990714314 2990710928 Bacteria 5002431
567 Ga0105239_10165158
568 SwRhRL3b_contig_2972607
569 JGI25151J46595_10015980
570 JGI25406J46586_10003534
571 Ga0006562J51391_1026968
572 Ga0006562J51391_1026972
573 Ga0055536_1013519
574 Ga0055530_10004848
575 Ga0055531_10023046
576 Ga0055531_10031230
577 Ga0065704_10093065
578 Ga0065715_10132194
579 Ga0065715_10552691
580 Ga0070658_10013000
581 Ga0070683_100417513
582 Ga0070670_100065955
583 Ga0070670_100110501
584 Ga0070670_100489414
585 Ga0068869_100053777
586 Ga0068869_100394469
587 Ga0068869_100776897
588 Ga0070666_10000001
589 Ga0070680_100644025
590 Ga0070682_100659763
591 Ga0068868_100050204
592 Ga0070689_100323480
593 Ga0070691_10151167
594 Ga0070661_100016152
595 Ga0070661_100753317
596 Ga0070668_100022301
597 Ga0070667_100000465
598 Ga0070667_100898497
599 Ga0070667_100994506
600 Ga0070663_100017743
601 Ga0070663_100151336
602 Ga0070662_100704968
603 Ga0070706_100831551
604 Ga0070699_101929381
605 Ga0070684_100421023
606 Ga0070684_100943987
607 Ga0068853_100341013
608 Ga0068853_100678879
609 Ga0068853_100962073
610 Ga0070665_100026645
611 Ga0070665_100094508
612 Ga0070665_100204427
613 Ga0070665_100292763
614 Ga0070665_100300367
615 Ga0070665_100641034
616 Ga0068855_100135814
617 Ga0068855_100438241
618 Ga0070664_100064937
619 Ga0070664_100583636
620 Ga0068852_100066547
621 Ga0068852_100086798
622 Ga0068852_100554300
623 Ga0068852_100693768
624 Ga0068852_101298173
625 Ga0068859_100015514
626 Ga0068859_100821289
627 Ga0068859_101345086
628 Ga0068864_100053622
629 Ga0068851_10009487
630 Ga0068851_10078268
631 Ga0068851_10195837
632 Ga0068863_100060881
633 Ga0068863_100104501
634 Ga0068863_100944657
635 Ga0068863_101181979
636 Ga0068858_100046015
637 Ga0068858_100083220
638 Ga0068858_101167354
639 Ga0068860_100040462
640 Ga0068860_100354739
641 Ga0068862_100000076
642 Ga0068862_100067410
643 Ga0068862_100703070
644 Ga0068862_101598105
645 Ga0081455_10000460
646 Ga0081540_1042908
647 Ga0081539_10000007
648 Ga0075367_10531423
649 Ga0075366_10000521
650 Ga0097621_100090659
651 Ga0097621_100168872
652 Ga0097621_100173364
653 Ga0068871_100046799
654 Ga0068871_100049867
655 Ga0068871_100122799
656 Ga0068871_100255787
657 Ga0068871_101700667
658 Ga0075430_101735460
659 Ga0068865_100056294
660 Ga0097620_100015515
661 Ga0097620_100821321
662 Ga0097620_101345511
663 Ga0105251_10006229
664 Ga0105244_10018457
665 Ga0105244_10051533
666 Ga0105244_10231377
667 Ga0105250_10112934
668 Ga0105240_10561322
669 Ga0105245_10283426
670 Ga0105247_10000804
671 Ga0105247_10059220
672 Ga0105247_10086053
673 Ga0105243_13124911
674 Ga0105248_10035211
675 Ga0105248_10149032
676 Ga0105237_10216574
677 Ga0105237_10362614
678 Ga0105237_10720901
679 Ga0105237_11178394
680 Ga0105238_10000729
681 Ga0105238_10159934
682 Ga0105238_10219101
683 Ga0105239_10001310
684 Ga0105239_10152865
685 Ga0105239_10226422
686 Ga0157317_1004006
687 Ga0157329_1003994
688 Ga0157373_10418109
689 Ga0157371_10010277
690 Ga0157370_10031743
691 Ga0157370_10228224
692 Ga0157370_10919356
693 Ga0157369_10006959
694 Ga0157369_10311131
695 Ga0157374_10560897
696 Ga0157378_10179126
697 Ga0163162_10000310
698 Ga0157372_10049630
699 Ga0157372_10185943
700 Ga0157372_10371636
701 Ga0157372_10908423
702 Ga0157372_10932414
703 Ga0157375_10172013
704 Ga0157375_10251947
705 Ga0163163_11430681
706 Ga0182008_10015693
707 Ga0157379_10049724
708 Ga0157379_10272710
709 Ga0157379_10671244
710 Ga0157376_10005857
711 Ga0157376_10378293
712 Ga0157376_10803576
713 Ga0157376_11427513
714 Ga0182007_10000142
715 Ga0182007_10005399
716 Ga0182005_1000456
717 Ga0182005_1005723
718 Ga0163161_10006187
719 Ga0163161_10030811
720 Ga0209148_1000686
721 Ga0209673_1010180
722 Ga0209675_1014305
723 Ga0209676_1000052
724 Ga0209676_1000612
725 Ga0209676_1003607
726 Ga0209676_1033599
727 Ga0209025_1011950
728 Ga0209564_1005388
729 Ga0209050_1004964
730 Ga0209256_1003876
731 Ga0209256_1006477
732 Ga0209256_1019151
733 Ga0209051_1022393
734 Ga0209257_1000261
735 Ga0209257_1008033
736 Ga0209257_1008123
737 Ga0209257_1008529
738 Ga0207656_10025181
739 Ga0207656_10027086
740 Ga0207655_1022900
741 Ga0207692_10197443
742 Ga0207710_10028070
743 Ga0207680_10000003
744 Ga0207680_10176690
745 Ga0207705_10018223
746 Ga0207671_10093721
747 Ga0207671_10158417
748 Ga0207671_11359181
749 Ga0207660_10891057
750 Ga0207649_10009717
751 Ga0207649_10091633
752 Ga0207649_10230572
753 Ga0207649_10272671
754 Ga0207681_10494999
755 Ga0207694_10000336
756 Ga0207694_10032818
757 Ga0207694_10695077
758 Ga0207650_10372361
759 Ga0207650_10392351
760 Ga0207650_11052700
761 Ga0207687_10181411
762 Ga0207690_11296709
763 Ga0207706_10828811
764 Ga0207704_10128029
765 Ga0207711_10646443
766 Ga0207689_10034615
767 Ga0207661_10056674
768 Ga0207667_10603878
769 Ga0207712_10751137
770 Ga0207668_10187970
771 Ga0207668_10684651
772 Ga0207640_10809010
773 Ga0207658_10062749
774 Ga0207658_10668084
775 Ga0207677_10250485
776 Ga0207703_10328594
777 Ga0207639_10111615
778 Ga0207639_10749378
779 Ga0207678_10021801
780 Ga0207678_10159979
781 Ga0207678_10161076
782 Ga0207702_10999831
783 Ga0207641_10551263
784 Ga0207641_12160990
785 Ga0207674_11835847
786 Ga0207675_101334640
787 Ga0207698_10064973
788 Ga0209984_1063570
789 Ga0209995_1030627
790 Ga0209982_1008725
791 Ga0210002_1013705
792 Ga0209971_1002018
793 Ga0209974_10016938
794 Ga0209974_10161704
795 Ga0268266_10000011
796 Ga0268266_10027462
797 Ga0268266_10090491
798 Ga0268266_10101567
799 Ga0268266_10143530
800 Ga0268265_10000054
801 Ga0268265_10027941
802 Ga0268265_10747165
803 Ga0268264_10045880
804 Ga0268264_11561243
805 Ga0265337_1005508
806 Ga0265326_10138458
807 Ga0265323_10053101
808 Ga0265323_10074653
809 Ga0265322_10021312
810 Ga0265330_10000267
811 Ga0265330_10000425
812 Ga0265330_10003657
813 Ga0265330_10025461
814 Ga0265330_10087550
815 Ga0265332_10000031
816 Ga0265332_10182304
817 Ga0265320_10132836
818 Ga0265325_10003142
819 Ga0265325_10027234
820 Ga0265329_10000026
821 Ga0265329_10127460
822 Ga0265340_10002395
823 Ga0265340_10015502
824 Ga0265340_10315639
825 Ga0265339_10080517
826 Ga0265331_10009095
827 Ga0265331_10319595
828 Ga0265316_10000041
829 Ga0265316_10174729
830 Ga0265316_10314063
831 Ga0307509_10262981
832 Ga0307408_100315384
833 Ga0307408_100556977
834 Ga0316575_10013903
835 Ga0316575_10255907
836 Ga0316579_10109102
837 Ga0265314_10000040
838 Ga0265314_10000095
839 Ga0265314_10001552
840 Ga0265314_10022605
841 Ga0265314_10209430
842 Ga0265342_10000053
843 Ga0265342_10000534
844 Ga0265342_10005068
845 Ga0265342_10005916
846 Ga0265342_10194306
847 Ga0316576_10055399
848 Ga0316576_10058891
849 Ga0316576_10097345
850 Ga0316576_10386571
851 Ga0316578_10003230
852 Ga0316578_10018765
853 Ga0307405_10251909
854 Ga0316577_10680407
855 Ga0307413_10035842
856 Ga0307413_10161570
857 Ga0307407_10049146
858 Ga0307412_10002538
859 Ga0307412_10162169
860 Ga0307409_100309035
861 Ga0307409_102148253
862 Ga0307416_100279249
863 Ga0307416_100365210
864 Ga0307414_10141984
865 Ga0307411_10127826
866 Ga0307411_10632296
867 Ga0307415_101935825
868 Ga0316583_10002064
869 Ga0316580_10003696
870 Ga0307510_10037923
871 Ga0373951_0137921
872 Ga0316574_0010361
873 Ga0316574_0037278
874 Ga0316574_0159411
875 Ga0316582_0224787
876 Ga0316582_0445910
877 Ga0316584_0023954
878 Ga0316584_0085084
879 Ga0395900_0243213
880 Ga0395905_0004059
881 Ga0439453_0098399
882 Ga0439465_0002275
883 Ga0439465_0004449
884 Ga0451791_0048244
885 Ga0451795_0606827
886 Ga0451800_1248717
887 Ga0451804_1093370
888 Ga0451807_0165466
889 Ga0451807_0484707
890 Ga0451833_1090284
891 Ga0451837_1099414
892 Ga0451841_0410757
893 Ga0439445_0141555
894 Ga0439449_0040165
895 Ga0439450_006902
896 Ga0439452_067921
897 Ga0439462_0031205
898 Ga0450912_019654
899 Ga0450921_011842
900 Ga0450897_007632
901 Ga0450908_000010
902 Ga0450909_022902
903 Ga0451577_0334223
904 Ga0451577_0626694
905 Ga0439440_0029733
906 Ga0453683_0780882
907 Ga0453684_0041513
908 Ga0451576_0072851
909 Ga0495617_000085
910 Ga0495617_001170
911 Ga0495603_0003097
912 Ga0495591_019008
913 Ga0495629_0002905
914 Ga0495638_0000754
915 Ga0495638_0059747
916 Ga0495650_0000191
917 Ga0495650_0001130
918 Ga0495650_0011597
919 Ga0495650_0053605
920 Ga0495582_0031889
921 Ga0495662_0159366
922 Ga0495664_0233741
923 Ga0495584_0000457
924 Ga0495584_0267902
925 Ga0495585_0000008
926 Ga0495585_0004032
927 Ga0495607_0000006
928 Ga0495607_0000131
929 Ga0495583_0043459
930 Ga0495606_0001253
931 Ga0495606_0001443
932 Ga0495606_0026870
933 Ga0495606_0175841
934 Ga0495608_0193802
935 Ga0495610_0003274
936 Ga0495610_0013443
937 Ga0495616_0000401
938 Ga0495616_0002110
939 Ga0495620_0000365
940 Ga0495620_0004937
941 Ga0495631_0000444
942 Ga0495631_0004475
943 Ga0495632_0000531
944 Ga0495632_0033849
945 Ga0495632_0050691
946 Ga0495632_0254188
947 Ga0495637_0005634
948 Ga0495644_0101185
949 Ga0495648_0000878
950 Ga0495648_0086672
951 Ga0495648_0347489
952 Ga0495663_0120084
953 Ga0495654_0031990
954 Ga0495665_0015986
955 Ga0495586_0114105
956 Ga0495597_0000256
957 Ga0495645_0019844
958 Ga0495667_0036668
959 Ga0495668_0008520
960 Ga0495634_0206359
961 Ga0495611_0000002
962 Ga0495611_0000381
963 Ga0495625_0000002
964 Ga0495625_0005416
965 Ga0495661_0000184
966 Ga0495646_0007986
967 Ga0495669_0031766
968 Ga0495624_0141422
969 Ga0495670_0011921
970 Ga0495670_0013664
971 Ga0495670_0040492
972 Ga0495670_0060173
973 Ga0495671_0000622
974 Ga0495649_0019027
975 Ga0495589_0000190
976 Ga0495589_0017164
977 Ga0495600_0015858
978 Ga0495660_0000437
979 Ga0495660_0000447
980 Ga0495581_0012810
981 Ga0495680_0064046
982 Ga0495683_0001059
983 Ga0495679_000003
984 Ga0495679_171020
985 Ga0495673_0000004
986 Ga0495673_0000062
987 Ga0495673_0002144
988 Ga0495681_0191049
989 Ga0495684_0147266
990 Ga0495686_0000426
991 Ga0495686_0001228
992 Ga0495686_0004756
993 Ga0495593_0041278
994 Ga0496100_0031620
995 Ga0496101_0001031
996 Ga0496101_0020135
997 Ga0496101_0125986
998 Ga0496101_1357283
999 Ga0496102_0600125
1000 Ga0496103_0119197
1001 Ga0496104_0105231
1002 Ga0496106_0000168
1003 Ga0496106_0406384
1004 Ga0496110_0291989
1005 Ga0496112_0104348
1006 Ga0496114_0146325
1007 Ga0496115_0020344
1008 Ga0496116_0061514
1009 Ga0496116_0253420
1010 Ga0496117_0035395
1011 Ga0496117_0113572
1012 Ga0496117_0358411
1013 Ga0496118_0002160
1014 Ga0496118_0009060
1015 Ga0496118_0022644
1016 Ga0496118_0135233
1017 Ga0496119_0008949
1018 Ga0496119_0083452
1019 Ga0496121_0000116
1020 Ga0496121_0006433
1021 Ga0496121_0008592
1022 Ga0496121_0034074
1023 Ga0496121_0142932
1024 Ga0496122_0014195
1025 Ga0496122_0028952
1026 Ga0496123_0047473
1027 Ga0496124_0001136
1028 Ga0496124_0007875
1029 Ga0496125_0059226
1030 Ga0496126_0054700
1031 Ga0496126_0119457
1032 Ga0496126_0346849
1033 Ga0495678_000019
1034 Ga0501031_0168964
1035 Ga0501032_0088609
1036 Ga0501033_0009449
1037 Ga0501033_0062339
1038 Ga0501033_0286759
1039 Ga0501034_0001985
1040 Ga0501034_0022477
1041 Ga0501034_0066222
1042 Ga0501034_0686007
1043 Ga0501036_0105873
1044 Ga0501036_0150059
1045 Ga0501037_0000790
1046 Ga0501037_0350041
1047 Ga0501037_0881384
1048 Ga0501038_0001202
1049 Ga0501038_0019743
1050 Ga0501038_0045790
1051 Ga0501038_0254902
1052 Ga0501039_0730831
1053 Ga0501042_0090035
1054 Ga0501042_0927908
1055 Ga0501043_0004402
1056 Ga0501043_0102173
1057 Ga0501043_0116266
1058 Ga0501043_0301978
1059 Ga0501043_0347927
1060 Ga0501046_0038711
1061 Ga0501046_0066893
1062 Ga0501046_0397348
1063 Ga0501046_0445529
1064 Ga0501047_0081899
1065 Ga0501047_0092413
1066 Ga0501068_0086983
1067 Ga0501069_0203463
1068 Ga0501070_0125679
1069 Ga0501070_0636909
1070 Ga0501071_0182958
1071 Ga0501073_0000193
1072 Ga0501073_0281894
1073 Ga0501074_0215049
1074 Ga0501209_083093
1075 Ga0501217_018851
1076 Ga0501233_066785
1077 Ga0501235_016151
1078 Ga0501242_017641
1079 Ga0501243_017862
1080 Ga0501249_014675
1081 Ga0501252_003627
1082 Ga0501253_072571
1083 Ga0501257_011199
1084 Ga0501258_005660
1085 Ga0501079_0046800
1086 Ga0501080_0023306
1087 Ga0501080_0517975
1088 Ga0501083_0323169
1089 Ga0501083_0362637
1090 Ga0501083_1067829
1091 Ga0501232_093225
1092 Ga0501266_007768
1093 Ga0501270_027563
1094 Ga0501274_046507
1095 Ga0501276_022681
1096 Ga0501035_0016516
1097 Ga0501035_0211846
1098 Ga0501035_0219353
1099 Ga0501035_0662590
1100 Ga0501035_1052758
1101 Ga0501035_1422860
1102 Ga0501044_0000635
1103 Ga0501044_0224861
1104 Ga0501044_0683113
1105 Ga0501044_0726868
1106 Ga0501045_0422738
1107 nmdc:mga03683_423529_c1
1108 nmdc:mga00v17_5917_c1
1109 nmdc:mga0k408_754_c1
1110 Ga0500643_000101
1111 Ga0500646_0006615
1112 Ga0500651_0009615
1113 Ga0500651_0296271
1114 Ga0500555_004699
1115 Ga0500655_013659
1116 Ga0500658_0016220
1117 Ga0500559_0010047
1118 Ga0500573_0017232
1119 Ga0500588_0064122
1120 Ga0500637_0162922
1121 Ga0500645_000443
1122 Ga0500656_000577
1123 Ga0501082_0000055
1124 Ga0501082_0510665
1125 2548499438
1126 2643866262
1127 2644057491
1128 2644072420
1129 2644293062
1130 2644648102
1131 2974320780
1132 2990714314

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

33

175

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9809 1 145
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9778 1 145
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9743 1 145
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9712 1 145
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9559 1 144
ID Description Score Start End Superfamily
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9809 1 145 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9743 1 145 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9559 1 144 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9448 1 145 3.50.80.10
af_F1QGC8_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9442 1 146 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A1B3B8D5-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9879 2 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1F6TM15-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.986 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1I7K6K3-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9859 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A521VUH1-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9855 1 146 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A661D976-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9854 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Map