F464436
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 282 | 566 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0230278|Ga0495668_0230278_287_865 |
| Length | 159 |
| Sequence | LERVNLRDRLHRPNLSIAEGLGGEYAGENMSDEKPELPADDQRPETGLSVYTHHGVTAAEREIGQRLVLDVRFDVGEPDALITDRVEDTIDYGEVCQVIALIAQQRSYKTLERLCAVIADRLATQFGAESVTVKAAKPEPPIPLPVEEVSVEVWREERP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 142 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 143 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 144 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 158 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 160 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 161 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 162 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 163 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 164 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 165 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 166 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 167 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 168 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 169 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 170 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 171 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 172 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 173 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 174 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 175 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 180 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 181 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 182 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 276 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 282 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 1.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 10.6 |
| Rhizosphere | 87.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1008877 | 3300000549 | Bacteria | 1216 |
| 2 | LJQas_1030268 | 3300000549 | Bacteria | 633 |
| 3 | JGI25407J50210_10003360 | 3300003373 | Bacteria | 3819 |
| 4 | JGI25407J50210_10031613 | 3300003373 | Bacteria | 1370 |
| 5 | Ga0070658_10106507 | 3300005327 | Bacteria | 2320 |
| 6 | Ga0070676_10249135 | 3300005328 | Bacteria | 1185 |
| 7 | Ga0070683_100089868 | 3300005329 | Bacteria | 2883 |
| 8 | Ga0070683_100424399 | 3300005329 | Bacteria | 1269 |
| 9 | Ga0070670_100996850 | 3300005331 | Bacteria | 762 |
| 10 | Ga0070680_100011130 | 3300005336 | Bacteria | 6955 |
| 11 | Ga0070682_100036178 | 3300005337 | Bacteria | 3017 |
| 12 | Ga0070682_100742291 | 3300005337 | Bacteria | 792 |
| 13 | Ga0070682_100746146 | 3300005337 | Bacteria | 790 |
| 14 | Ga0068868_100289784 | 3300005338 | Bacteria | 1388 |
| 15 | Ga0070660_100771662 | 3300005339 | Bacteria | 808 |
| 16 | Ga0070691_10195647 | 3300005341 | Bacteria | 1060 |
| 17 | Ga0070687_100168391 | 3300005343 | Bacteria | 1302 |
| 18 | Ga0070687_100364368 | 3300005343 | Bacteria | 937 |
| 19 | Ga0070661_100003576 | 3300005344 | Bacteria | 10695 |
| 20 | Ga0070661_100300793 | 3300005344 | Bacteria | 1249 |
| 21 | Ga0070661_101112438 | 3300005344 | Bacteria | 658 |
| 22 | Ga0070692_10140470 | 3300005345 | Bacteria | 1366 |
| 23 | Ga0070692_10287064 | 3300005345 | Bacteria | 1000 |
| 24 | Ga0070692_10960997 | 3300005345 | Bacteria | 595 |
| 25 | Ga0070692_10979564 | 3300005345 | Bacteria | 590 |
| 26 | Ga0070668_100152622 | 3300005347 | Bacteria | 1869 |
| 27 | Ga0070668_100288096 | 3300005347 | Bacteria | 1374 |
| 28 | Ga0070674_100062221 | 3300005356 | Bacteria | 2608 |
| 29 | Ga0070674_100320375 | 3300005356 | Bacteria | 1243 |
| 30 | Ga0070674_100322733 | 3300005356 | Bacteria | 1238 |
| 31 | Ga0070673_100841533 | 3300005364 | Bacteria | 849 |
| 32 | Ga0070659_100042892 | 3300005366 | Bacteria | 3537 |
| 33 | Ga0070659_100272044 | 3300005366 | Bacteria | 1408 |
| 34 | Ga0070714_100001858 | 3300005435 | Bacteria | 15374 |
| 35 | Ga0070714_100056010 | 3300005435 | Bacteria | 3371 |
| 36 | Ga0070714_100192946 | 3300005435 | Bacteria | 1860 |
| 37 | Ga0070700_100047515 | 3300005441 | Bacteria | 2656 |
| 38 | Ga0070700_100097517 | 3300005441 | Bacteria | 1931 |
| 39 | Ga0070663_100526355 | 3300005455 | Bacteria | 985 |
| 40 | Ga0070663_100951065 | 3300005455 | Bacteria | 745 |
| 41 | Ga0070662_100031509 | 3300005457 | Bacteria | 3722 |
| 42 | Ga0070681_10061396 | 3300005458 | Bacteria | 3733 |
| 43 | Ga0068867_100255124 | 3300005459 | Bacteria | 1428 |
| 44 | Ga0068867_100764321 | 3300005459 | Bacteria | 859 |
| 45 | Ga0068867_101724778 | 3300005459 | Bacteria | 588 |
| 46 | Ga0070685_10062869 | 3300005466 | Bacteria | 2178 |
| 47 | Ga0070698_101653693 | 3300005471 | Bacteria | 593 |
| 48 | Ga0070679_100020197 | 3300005530 | Bacteria | 6493 |
| 49 | Ga0070679_100679980 | 3300005530 | Bacteria | 972 |
| 50 | Ga0070684_100001851 | 3300005535 | Bacteria | 15491 |
| 51 | Ga0070684_100141023 | 3300005535 | Bacteria | 2180 |
| 52 | Ga0068853_100310344 | 3300005539 | Bacteria | 1460 |
| 53 | Ga0068853_101133260 | 3300005539 | Bacteria | 755 |
| 54 | Ga0070672_100205811 | 3300005543 | Bacteria | 1647 |
| 55 | Ga0070686_100384943 | 3300005544 | Bacteria | 1063 |
| 56 | Ga0070696_100131145 | 3300005546 | Bacteria | 1824 |
| 57 | Ga0070693_100196756 | 3300005547 | Bacteria | 1307 |
| 58 | Ga0070704_100127148 | 3300005549 | Bacteria | 1968 |
| 59 | Ga0068855_101637900 | 3300005563 | Bacteria | 658 |
| 60 | Ga0070664_100092298 | 3300005564 | Bacteria | 2621 |
| 61 | Ga0070664_100739022 | 3300005564 | Bacteria | 918 |
| 62 | Ga0070664_100768970 | 3300005564 | Bacteria | 900 |
| 63 | Ga0068857_100024451 | 3300005577 | Bacteria | 5318 |
| 64 | Ga0068857_101361830 | 3300005577 | Bacteria | 690 |
| 65 | Ga0068854_100234754 | 3300005578 | Bacteria | 1457 |
| 66 | Ga0068856_100066185 | 3300005614 | Bacteria | 3571 |
| 67 | Ga0068856_100309695 | 3300005614 | Bacteria | 1597 |
| 68 | Ga0068856_101863315 | 3300005614 | Bacteria | 613 |
| 69 | Ga0070702_100526707 | 3300005615 | Bacteria | 873 |
| 70 | Ga0070702_100634647 | 3300005615 | Bacteria | 806 |
| 71 | Ga0068852_100021413 | 3300005616 | Bacteria | 5162 |
| 72 | Ga0068852_100081129 | 3300005616 | Bacteria | 2878 |
| 73 | Ga0068864_101643751 | 3300005618 | Bacteria | 647 |
| 74 | Ga0068866_10074974 | 3300005718 | Bacteria | 1800 |
| 75 | Ga0068851_10261910 | 3300005834 | Bacteria | 984 |
| 76 | Ga0068870_10651316 | 3300005840 | Bacteria | 722 |
| 77 | Ga0068863_100579041 | 3300005841 | Bacteria | 1110 |
| 78 | Ga0068863_100898717 | 3300005841 | Bacteria | 886 |
| 79 | Ga0068860_101219579 | 3300005843 | Bacteria | 773 |
| 80 | Ga0068862_100308420 | 3300005844 | Bacteria | 1458 |
| 81 | Ga0081455_10082585 | 3300005937 | Bacteria | 2628 |
| 82 | Ga0081455_10221488 | 3300005937 | Bacteria | 1402 |
| 83 | Ga0081538_10000171 | 3300005981 | Bacteria | 69552 |
| 84 | Ga0081538_10002778 | 3300005981 | Bacteria | 16774 |
| 85 | Ga0081538_10003555 | 3300005981 | Bacteria | 14663 |
| 86 | Ga0081538_10009306 | 3300005981 | Bacteria | 8219 |
| 87 | Ga0081538_10012436 | 3300005981 | Bacteria | 6820 |
| 88 | Ga0081538_10181542 | 3300005981 | Bacteria | 899 |
| 89 | Ga0081538_10203046 | 3300005981 | Bacteria | 811 |
| 90 | Ga0081539_10012516 | 3300005985 | Bacteria | 6527 |
| 91 | Ga0070717_10000204 | 3300006028 | Bacteria | 41488 |
| 92 | Ga0070716_101091069 | 3300006173 | Bacteria | 636 |
| 93 | Ga0070712_100001989 | 3300006175 | Bacteria | 12514 |
| 94 | Ga0068871_101153453 | 3300006358 | Bacteria | 726 |
| 95 | Ga0075428_100044156 | 3300006844 | Bacteria | 4898 |
| 96 | Ga0075428_100882859 | 3300006844 | Bacteria | 949 |
| 97 | Ga0075430_100022193 | 3300006846 | Bacteria | 5397 |
| 98 | Ga0075430_100037116 | 3300006846 | Bacteria | 4131 |
| 99 | Ga0075430_100367473 | 3300006846 | Bacteria | 1188 |
| 100 | Ga0075430_101501543 | 3300006846 | Bacteria | 554 |
| 101 | Ga0075431_100020434 | 3300006847 | Bacteria | 6765 |
| 102 | Ga0075431_100042067 | 3300006847 | Bacteria | 4712 |
| 103 | Ga0075431_101328298 | 3300006847 | Bacteria | 680 |
| 104 | Ga0075429_100008016 | 3300006880 | Bacteria | 9176 |
| 105 | Ga0075429_100022138 | 3300006880 | Bacteria | 5513 |
| 106 | Ga0075429_100669000 | 3300006880 | Bacteria | 910 |
| 107 | Ga0068865_100199222 | 3300006881 | Bacteria | 1554 |
| 108 | Ga0068865_100328964 | 3300006881 | Bacteria | 1232 |
| 109 | Ga0068865_100598333 | 3300006881 | Bacteria | 932 |
| 110 | Ga0105240_10009093 | 3300009093 | Bacteria | 14105 |
| 111 | Ga0105240_10532049 | 3300009093 | Bacteria | 1303 |
| 112 | Ga0105240_11098695 | 3300009093 | Bacteria | 846 |
| 113 | Ga0111539_10773529 | 3300009094 | Bacteria | 1117 |
| 114 | Ga0111539_10781737 | 3300009094 | Bacteria | 1111 |
| 115 | Ga0111539_12601505 | 3300009094 | Bacteria | 587 |
| 116 | Ga0105245_10112556 | 3300009098 | Bacteria | 2533 |
| 117 | Ga0105245_10601039 | 3300009098 | Bacteria | 1126 |
| 118 | Ga0105245_10606399 | 3300009098 | Bacteria | 1122 |
| 119 | Ga0105247_10963184 | 3300009101 | Bacteria | 663 |
| 120 | Ga0114129_10273189 | 3300009147 | Bacteria | 2261 |
| 121 | Ga0114129_10563426 | 3300009147 | Bacteria | 1480 |
| 122 | Ga0114129_10755453 | 3300009147 | Bacteria | 1244 |
| 123 | Ga0114129_11664372 | 3300009147 | Bacteria | 780 |
| 124 | Ga0105243_10115568 | 3300009148 | Bacteria | 2253 |
| 125 | Ga0105243_10524364 | 3300009148 | Bacteria | 1127 |
| 126 | Ga0105243_10569189 | 3300009148 | Bacteria | 1086 |
| 127 | Ga0105241_10928292 | 3300009174 | Bacteria | 810 |
| 128 | Ga0105241_11718317 | 3300009174 | Unclassified | 610 |
| 129 | Ga0105242_10168616 | 3300009176 | Bacteria | 1922 |
| 130 | Ga0105242_10372913 | 3300009176 | Bacteria | 1324 |
| 131 | Ga0105242_11070793 | 3300009176 | Bacteria | 818 |
| 132 | Ga0105242_12131891 | 3300009176 | Bacteria | 605 |
| 133 | Ga0105242_12659523 | 3300009176 | Bacteria | 550 |
| 134 | Ga0105237_10077213 | 3300009545 | Bacteria | 3321 |
| 135 | Ga0105238_10978142 | 3300009551 | Bacteria | 867 |
| 136 | Ga0105249_10386778 | 3300009553 | Bacteria | 1426 |
| 137 | Ga0105249_10593999 | 3300009553 | Bacteria | 1161 |
| 138 | Ga0105249_11273959 | 3300009553 | Bacteria | 806 |
| 139 | Ga0105249_11751375 | 3300009553 | Bacteria | 694 |
| 140 | Ga0105239_10216614 | 3300010375 | Bacteria | 2147 |
| 141 | Ga0105239_11118509 | 3300010375 | Bacteria | 907 |
| 142 | Ga0105246_11406619 | 3300011119 | Bacteria | 651 |
| 143 | Ga0157371_10334907 | 3300013102 | Bacteria | 1100 |
| 144 | Ga0157371_11387609 | 3300013102 | Bacteria | 545 |
| 145 | Ga0157370_10025457 | 3300013104 | Bacteria | 5857 |
| 146 | Ga0157369_10016156 | 3300013105 | Bacteria | 8403 |
| 147 | Ga0157374_10482483 | 3300013296 | Bacteria | 1243 |
| 148 | Ga0157378_10637237 | 3300013297 | Bacteria | 1080 |
| 149 | Ga0163162_10963716 | 3300013306 | Bacteria | 964 |
| 150 | Ga0163162_12337016 | 3300013306 | Bacteria | 614 |
| 151 | Ga0157372_10042061 | 3300013307 | Bacteria | 5052 |
| 152 | Ga0157372_10708461 | 3300013307 | Bacteria | 1171 |
| 153 | Ga0157372_11274509 | 3300013307 | Bacteria | 848 |
| 154 | Ga0157372_12536125 | 3300013307 | Bacteria | 588 |
| 155 | Ga0157375_11541725 | 3300013308 | Bacteria | 785 |
| 156 | Ga0163163_11228628 | 3300014325 | Bacteria | 812 |
| 157 | Ga0157380_10017875 | 3300014326 | Bacteria | 5256 |
| 158 | Ga0157380_10334346 | 3300014326 | Bacteria | 1410 |
| 159 | Ga0157380_10425020 | 3300014326 | Bacteria | 1268 |
| 160 | Ga0157377_10222026 | 3300014745 | Bacteria | 1210 |
| 161 | Ga0157377_10234580 | 3300014745 | Bacteria | 1181 |
| 162 | Ga0157377_10369535 | 3300014745 | Bacteria | 968 |
| 163 | Ga0157379_10536179 | 3300014968 | Bacteria | 1088 |
| 164 | Ga0157376_10057234 | 3300014969 | Bacteria | 3260 |
| 165 | Ga0206356_10524050 | 3300020070 | Bacteria | 1518 |
| 166 | Ga0206354_11624061 | 3300020081 | Bacteria | 883 |
| 167 | Ga0206353_11748275 | 3300020082 | Bacteria | 3944 |
| 168 | Ga0207642_10251870 | 3300025899 | Bacteria | 1003 |
| 169 | Ga0207642_10313072 | 3300025899 | Bacteria | 914 |
| 170 | Ga0207688_10386807 | 3300025901 | Bacteria | 866 |
| 171 | Ga0207645_10209593 | 3300025907 | Bacteria | 1283 |
| 172 | Ga0207643_10089427 | 3300025908 | Bacteria | 1793 |
| 173 | Ga0207705_10074116 | 3300025909 | Bacteria | 2470 |
| 174 | Ga0207707_10076266 | 3300025912 | Bacteria | 2925 |
| 175 | Ga0207707_10357351 | 3300025912 | Bacteria | 1258 |
| 176 | Ga0207695_10007814 | 3300025913 | Bacteria | 13535 |
| 177 | Ga0207695_10359130 | 3300025913 | Bacteria | 1343 |
| 178 | Ga0207671_10042415 | 3300025914 | Bacteria | 3367 |
| 179 | Ga0207693_10003339 | 3300025915 | Bacteria | 13733 |
| 180 | Ga0207657_10027895 | 3300025919 | Bacteria | 5162 |
| 181 | Ga0207649_10067077 | 3300025920 | Bacteria | 2277 |
| 182 | Ga0207649_10429889 | 3300025920 | Bacteria | 993 |
| 183 | Ga0207649_10691770 | 3300025920 | Bacteria | 790 |
| 184 | Ga0207652_10058845 | 3300025921 | Bacteria | 3311 |
| 185 | Ga0207681_10025691 | 3300025923 | Bacteria | 3791 |
| 186 | Ga0207681_10191312 | 3300025923 | Bacteria | 1566 |
| 187 | Ga0207681_11276294 | 3300025923 | Bacteria | 617 |
| 188 | Ga0207659_10649278 | 3300025926 | Bacteria | 902 |
| 189 | Ga0207687_10195610 | 3300025927 | Bacteria | 1577 |
| 190 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 191 | Ga0207664_10070763 | 3300025929 | Bacteria | 2808 |
| 192 | Ga0207664_10148898 | 3300025929 | Bacteria | 1987 |
| 193 | Ga0207690_10038870 | 3300025932 | Bacteria | 3100 |
| 194 | Ga0207706_10011962 | 3300025933 | Bacteria | 7902 |
| 195 | Ga0207706_10685801 | 3300025933 | Bacteria | 876 |
| 196 | Ga0207686_10482741 | 3300025934 | Bacteria | 959 |
| 197 | Ga0207709_10262707 | 3300025935 | Bacteria | 1267 |
| 198 | Ga0207709_10414273 | 3300025935 | Bacteria | 1033 |
| 199 | Ga0207709_10817339 | 3300025935 | Bacteria | 753 |
| 200 | Ga0207670_10207786 | 3300025936 | Bacteria | 1491 |
| 201 | Ga0207669_10114107 | 3300025937 | Bacteria | 1818 |
| 202 | Ga0207669_10165694 | 3300025937 | Bacteria | 1567 |
| 203 | Ga0207669_10166033 | 3300025937 | Bacteria | 1566 |
| 204 | Ga0207669_10757132 | 3300025937 | Bacteria | 802 |
| 205 | Ga0207704_10580412 | 3300025938 | Bacteria | 915 |
| 206 | Ga0207691_10257644 | 3300025940 | Bacteria | 1504 |
| 207 | Ga0207689_10578316 | 3300025942 | Bacteria | 944 |
| 208 | Ga0207661_10002565 | 3300025944 | Bacteria | 12505 |
| 209 | Ga0207661_10246478 | 3300025944 | Bacteria | 1587 |
| 210 | Ga0207661_10371391 | 3300025944 | Bacteria | 1293 |
| 211 | Ga0207661_10959205 | 3300025944 | Bacteria | 788 |
| 212 | Ga0207679_10635493 | 3300025945 | Bacteria | 964 |
| 213 | Ga0207651_10959722 | 3300025960 | Bacteria | 763 |
| 214 | Ga0207651_11541467 | 3300025960 | Bacteria | 599 |
| 215 | Ga0207668_10108887 | 3300025972 | Bacteria | 2075 |
| 216 | Ga0207668_10118812 | 3300025972 | Bacteria | 1998 |
| 217 | Ga0207668_10200957 | 3300025972 | Bacteria | 1587 |
| 218 | Ga0207640_10414098 | 3300025981 | Bacteria | 1101 |
| 219 | Ga0207640_10588998 | 3300025981 | Bacteria | 940 |
| 220 | Ga0207640_11295343 | 3300025981 | Bacteria | 650 |
| 221 | Ga0207677_10035314 | 3300026023 | Bacteria | 3246 |
| 222 | Ga0207677_10756071 | 3300026023 | Unclassified | 867 |
| 223 | Ga0207703_10257945 | 3300026035 | Bacteria | 1575 |
| 224 | Ga0207639_10034935 | 3300026041 | Bacteria | 3718 |
| 225 | Ga0207639_10458057 | 3300026041 | Bacteria | 1159 |
| 226 | Ga0207678_10557394 | 3300026067 | Bacteria | 1002 |
| 227 | Ga0207678_10913378 | 3300026067 | Bacteria | 776 |
| 228 | Ga0207708_10010975 | 3300026075 | Bacteria | 6739 |
| 229 | Ga0207708_10641304 | 3300026075 | Bacteria | 903 |
| 230 | Ga0207708_10729775 | 3300026075 | Bacteria | 849 |
| 231 | Ga0207702_10035724 | 3300026078 | Bacteria | 4154 |
| 232 | Ga0207702_10348246 | 3300026078 | Bacteria | 1417 |
| 233 | Ga0207702_10658118 | 3300026078 | Bacteria | 1030 |
| 234 | Ga0207702_11207009 | 3300026078 | Bacteria | 751 |
| 235 | Ga0207648_10249825 | 3300026089 | Bacteria | 1581 |
| 236 | Ga0207648_10627411 | 3300026089 | Bacteria | 992 |
| 237 | Ga0207676_10311337 | 3300026095 | Bacteria | 1442 |
| 238 | Ga0207674_10060700 | 3300026116 | Bacteria | 3823 |
| 239 | Ga0207674_10544635 | 3300026116 | Bacteria | 1121 |
| 240 | Ga0207683_10287123 | 3300026121 | Bacteria | 1504 |
| 241 | Ga0207698_10279602 | 3300026142 | Bacteria | 1543 |
| 242 | Ga0207698_10799997 | 3300026142 | Bacteria | 945 |
| 243 | Ga0207428_10043062 | 3300027907 | Bacteria | 3648 |
| 244 | Ga0207428_10333256 | 3300027907 | Bacteria | 1119 |
| 245 | Ga0268266_10458140 | 3300028379 | Bacteria | 1213 |
| 246 | Ga0268265_11901811 | 3300028380 | Bacteria | 602 |
| 247 | Ga0265319_1000093 | 3300028563 | Bacteria | 69319 |
| 248 | Ga0265334_10215867 | 3300028573 | Bacteria | 664 |
| 249 | Ga0265322_10085177 | 3300028654 | Bacteria | 897 |
| 250 | Ga0265338_10016147 | 3300028800 | Bacteria | 8146 |
| 251 | Ga0265338_10273271 | 3300028800 | Bacteria | 1238 |
| 252 | Ga0307408_100194265 | 3300031548 | Bacteria | 1638 |
| 253 | Ga0307408_100600062 | 3300031548 | Bacteria | 978 |
| 254 | Ga0307405_10058977 | 3300031731 | Bacteria | 2417 |
| 255 | Ga0307405_10113123 | 3300031731 | Bacteria | 1843 |
| 256 | Ga0307405_10139757 | 3300031731 | Bacteria | 1687 |
| 257 | Ga0307405_10433293 | 3300031731 | Bacteria | 1038 |
| 258 | Ga0307405_10867848 | 3300031731 | Bacteria | 761 |
| 259 | Ga0307413_10170784 | 3300031824 | Bacteria | 1539 |
| 260 | Ga0307413_10281337 | 3300031824 | Bacteria | 1251 |
| 261 | Ga0307410_10234266 | 3300031852 | Bacteria | 1419 |
| 262 | Ga0307410_10952133 | 3300031852 | Bacteria | 738 |
| 263 | Ga0307406_10019215 | 3300031901 | Bacteria | 4007 |
| 264 | Ga0307406_10149981 | 3300031901 | Bacteria | 1662 |
| 265 | Ga0307406_11512038 | 3300031901 | Bacteria | 591 |
| 266 | Ga0307407_10010725 | 3300031903 | Bacteria | 4331 |
| 267 | Ga0307407_10296488 | 3300031903 | Bacteria | 1126 |
| 268 | Ga0307412_10073601 | 3300031911 | Bacteria | 2338 |
| 269 | Ga0307412_10467765 | 3300031911 | Bacteria | 1043 |
| 270 | Ga0307412_10725933 | 3300031911 | Bacteria | 855 |
| 271 | Ga0307412_11576614 | 3300031911 | Bacteria | 599 |
| 272 | Ga0307409_100004644 | 3300031995 | Bacteria | 7759 |
| 273 | Ga0307409_100024015 | 3300031995 | Bacteria | 4241 |
| 274 | Ga0307409_100051528 | 3300031995 | Bacteria | 3150 |
| 275 | Ga0307409_100116564 | 3300031995 | Bacteria | 2252 |
| 276 | Ga0307409_100258278 | 3300031995 | Bacteria | 1597 |
| 277 | Ga0307409_101756298 | 3300031995 | Bacteria | 649 |
| 278 | Ga0307416_100193769 | 3300032002 | Bacteria | 1920 |
| 279 | Ga0307416_100272545 | 3300032002 | Bacteria | 1663 |
| 280 | Ga0307416_100569022 | 3300032002 | Bacteria | 1209 |
| 281 | Ga0307416_101134002 | 3300032002 | Bacteria | 887 |
| 282 | Ga0307414_10033658 | 3300032004 | Bacteria | 3390 |
| 283 | Ga0307414_10619279 | 3300032004 | Bacteria | 973 |
| 284 | Ga0307414_10887539 | 3300032004 | Bacteria | 817 |
| 285 | Ga0307411_10031794 | 3300032005 | Bacteria | 3253 |
| 286 | Ga0307411_10093697 | 3300032005 | Bacteria | 2104 |
| 287 | Ga0307411_10897367 | 3300032005 | Bacteria | 787 |
| 288 | Ga0307415_100002060 | 3300032126 | Bacteria | 9933 |
| 289 | Ga0307415_100008209 | 3300032126 | Bacteria | 5776 |
| 290 | Ga0307415_100219099 | 3300032126 | Bacteria | 1524 |
| 291 | Ga0307415_100419208 | 3300032126 | Bacteria | 1148 |
| 292 | Ga0307415_101249125 | 3300032126 | Unclassified | 702 |
| 293 | Ga0373958_0058167 | 3300034819 | Bacteria | 832 |
| 294 | Ga0373931_0847903 | 3300035691 | Bacteria | 612 |
| 295 | Ga0395899_0473869 | 3300037312 | Bacteria | 816 |
| 296 | Ga0395900_0441974 | 3300037418 | Bacteria | 1258 |
| 297 | Ga0395900_0678806 | 3300037418 | Bacteria | 965 |
| 298 | Ga0395898_0197937 | 3300037466 | Bacteria | 1919 |
| 299 | Ga0395898_0548129 | 3300037466 | Bacteria | 1098 |
| 300 | Ga0395898_1391522 | 3300037466 | Bacteria | 629 |
| 301 | Ga0395898_1562055 | 3300037466 | Bacteria | 585 |
| 302 | Ga0395898_1792351 | 3300037466 | Unclassified | 535 |
| 303 | Ga0395905_0362688 | 3300037471 | Bacteria | 1342 |
| 304 | Ga0395905_0440475 | 3300037471 | Bacteria | 1200 |
| 305 | Ga0395901_0021637 | 3300038443 | Bacteria | 6588 |
| 306 | Ga0395901_0213804 | 3300038443 | Bacteria | 2017 |
| 307 | Ga0395901_0454080 | 3300038443 | Bacteria | 1310 |
| 308 | Ga0395901_0581799 | 3300038443 | Bacteria | 1131 |
| 309 | Ga0395901_0778790 | 3300038443 | Bacteria | 947 |
| 310 | Ga0395901_1890620 | 3300038443 | Bacteria | 545 |
| 311 | Ga0436363_1508741 | 3300039450 | Bacteria | 782 |
| 312 | Ga0451802_1376511 | 3300041460 | Bacteria | 1140 |
| 313 | Ga0451837_0159455 | 3300041494 | Bacteria | 1115 |
| 314 | Ga0451845_0052913 | 3300041501 | Bacteria | 897 |
| 315 | Ga0451849_0132430 | 3300041505 | Bacteria | 945 |
| 316 | Ga0451853_1096073 | 3300041512 | Bacteria | 765 |
| 317 | Ga0439451_129331 | 3300042009 | Bacteria | 516 |
| 318 | Ga0439454_011991 | 3300042011 | Bacteria | 1168 |
| 319 | Ga0439463_090674 | 3300042016 | Bacteria | 787 |
| 320 | Ga0450917_001796 | 3300042120 | Bacteria | 1522 |
| 321 | Ga0439458_0042077 | 3300042157 | Bacteria | 1111 |
| 322 | Ga0439459_0108697 | 3300042438 | Unclassified | 687 |
| 323 | Ga0439459_0166096 | 3300042438 | Bacteria | 585 |
| 324 | Ga0439464_0167416 | 3300042439 | Bacteria | 692 |
| 325 | Ga0439460_0092358 | 3300042461 | Bacteria | 963 |
| 326 | Ga0439460_0165082 | 3300042461 | Bacteria | 744 |
| 327 | Ga0450893_0047756 | 3300042532 | Bacteria | 797 |
| 328 | Ga0466972_0077519 | 3300044658 | Bacteria | 1583 |
| 329 | Ga0466972_0134075 | 3300044658 | Bacteria | 1166 |
| 330 | Ga0466972_0276912 | 3300044658 | Bacteria | 784 |
| 331 | Ga0466972_0343881 | 3300044658 | Bacteria | 698 |
| 332 | Ga0466972_0374617 | 3300044658 | Bacteria | 666 |
| 333 | Ga0466965_0268968 | 3300044683 | Bacteria | 918 |
| 334 | Ga0466965_0336832 | 3300044683 | Bacteria | 824 |
| 335 | Ga0466965_0584452 | 3300044683 | Bacteria | 633 |
| 336 | Ga0466966_0327557 | 3300044684 | Bacteria | 920 |
| 337 | Ga0466966_0435033 | 3300044684 | Unclassified | 789 |
| 338 | Ga0466961_0049561 | 3300044693 | Bacteria | 2684 |
| 339 | Ga0466961_0090881 | 3300044693 | Bacteria | 1928 |
| 340 | Ga0466963_0011641 | 3300044694 | Bacteria | 5358 |
| 341 | Ga0466963_0185117 | 3300044694 | Bacteria | 1454 |
| 342 | Ga0466963_0193996 | 3300044694 | Bacteria | 1419 |
| 343 | Ga0466963_0275453 | 3300044694 | Bacteria | 1182 |
| 344 | Ga0466963_0693714 | 3300044694 | Bacteria | 718 |
| 345 | Ga0466963_0944702 | 3300044694 | Bacteria | 607 |
| 346 | Ga0466964_0879177 | 3300044706 | Bacteria | 511 |
| 347 | Ga0466971_0019707 | 3300044719 | Bacteria | 2997 |
| 348 | Ga0466971_0043933 | 3300044719 | Bacteria | 2007 |
| 349 | Ga0466968_0413519 | 3300044735 | Bacteria | 663 |
| 350 | Ga0466970_0092181 | 3300044765 | Bacteria | 1645 |
| 351 | Ga0466970_0107630 | 3300044765 | Bacteria | 1521 |
| 352 | Ga0466970_0121497 | 3300044765 | Bacteria | 1431 |
| 353 | Ga0466957_0213192 | 3300044842 | Bacteria | 1272 |
| 354 | Ga0466957_0705746 | 3300044842 | Bacteria | 712 |
| 355 | Ga0466960_0008354 | 3300044901 | Bacteria | 4238 |
| 356 | Ga0466960_0113881 | 3300044901 | Bacteria | 1409 |
| 357 | Ga0466959_0318772 | 3300045049 | Bacteria | 1063 |
| 358 | Ga0466958_0446574 | 3300045836 | Bacteria | 837 |
| 359 | Ga0466967_0002244 | 3300045976 | Bacteria | 11904 |
| 360 | Ga0466967_0016429 | 3300045976 | Bacteria | 5837 |
| 361 | Ga0466967_0016543 | 3300045976 | Bacteria | 5821 |
| 362 | Ga0466967_0157440 | 3300045976 | Bacteria | 2129 |
| 363 | Ga0466967_0439326 | 3300045976 | Bacteria | 1274 |
| 364 | Ga0466967_0603365 | 3300045976 | Bacteria | 1083 |
| 365 | Ga0466967_0840514 | 3300045976 | Bacteria | 912 |
| 366 | Ga0466967_0910155 | 3300045976 | Bacteria | 875 |
| 367 | Ga0466967_1535171 | 3300045976 | Bacteria | 663 |
| 368 | Ga0495603_0436353 | 3300046455 | Bacteria | 750 |
| 369 | Ga0495590_0319154 | 3300046457 | Unclassified | 587 |
| 370 | Ga0495641_0005510 | 3300046461 | Bacteria | 8514 |
| 371 | Ga0495641_0261773 | 3300046461 | Bacteria | 778 |
| 372 | Ga0495641_0428191 | 3300046461 | Bacteria | 601 |
| 373 | Ga0495653_0001336 | 3300046463 | Bacteria | 19144 |
| 374 | Ga0495650_0000223 | 3300046471 | Bacteria | 118162 |
| 375 | Ga0495664_0001128 | 3300046477 | Bacteria | 13844 |
| 376 | Ga0495584_0345314 | 3300046491 | Bacteria | 756 |
| 377 | Ga0495596_0155880 | 3300046500 | Bacteria | 887 |
| 378 | Ga0495616_0085415 | 3300046513 | Bacteria | 1503 |
| 379 | Ga0495620_0135985 | 3300046515 | Bacteria | 963 |
| 380 | Ga0495630_0873045 | 3300046517 | Bacteria | 686 |
| 381 | Ga0495643_0250533 | 3300046522 | Bacteria | 827 |
| 382 | Ga0495652_0280897 | 3300046529 | Bacteria | 1219 |
| 383 | Ga0495621_0167519 | 3300046539 | Bacteria | 872 |
| 384 | Ga0495656_0017871 | 3300046615 | Bacteria | 2713 |
| 385 | Ga0495656_0053931 | 3300046615 | Bacteria | 1729 |
| 386 | Ga0495656_0107603 | 3300046615 | Bacteria | 1299 |
| 387 | Ga0495668_0230278 | 3300046616 | Bacteria | 1015 |
| 388 | Ga0495657_0023569 | 3300046675 | Bacteria | 4396 |
| 389 | Ga0495658_0077000 | 3300046683 | Unclassified | 1950 |
| 390 | Ga0495670_0562605 | 3300046691 | Bacteria | 621 |
| 391 | Ga0495649_0455551 | 3300046694 | Bacteria | 639 |
| 392 | Ga0495589_0155531 | 3300046794 | Bacteria | 1091 |
| 393 | Ga0495600_0003671 | 3300046809 | Bacteria | 9066 |
| 394 | Ga0495660_0433460 | 3300046810 | Bacteria | 571 |
| 395 | Ga0495604_0000144 | 3300047317 | Bacteria | 61560 |
| 396 | Ga0495672_0016723 | 3300047320 | Bacteria | 4928 |
| 397 | Ga0495676_0347653 | 3300047321 | Bacteria | 992 |
| 398 | Ga0495677_0267053 | 3300047445 | Unclassified | 670 |
| 399 | Ga0495685_159881 | 3300047447 | Unclassified | 730 |
| 400 | Ga0495673_0050625 | 3300047469 | Bacteria | 1822 |
| 401 | Ga0495686_0044207 | 3300047472 | Bacteria | 2820 |
| 402 | Ga0495686_0307509 | 3300047472 | Bacteria | 873 |
| 403 | Ga0496100_0110824 | 3300048903 | Bacteria | 1906 |
| 404 | Ga0496101_0609580 | 3300048904 | Bacteria | 863 |
| 405 | Ga0496101_0833888 | 3300048904 | Bacteria | 727 |
| 406 | Ga0496102_0000076 | 3300048905 | Bacteria | 142745 |
| 407 | Ga0496102_0059004 | 3300048905 | Bacteria | 3508 |
| 408 | Ga0496102_0235660 | 3300048905 | Bacteria | 1726 |
| 409 | Ga0496102_0555782 | 3300048905 | Bacteria | 1071 |
| 410 | Ga0496102_0969718 | 3300048905 | Bacteria | 771 |
| 411 | Ga0496103_0000367 | 3300048906 | Bacteria | 40593 |
| 412 | Ga0496103_0352140 | 3300048906 | Bacteria | 947 |
| 413 | Ga0496104_0000034 | 3300048907 | Bacteria | 186572 |
| 414 | Ga0496104_0068707 | 3300048907 | Bacteria | 3367 |
| 415 | Ga0496104_0089408 | 3300048907 | Bacteria | 2942 |
| 416 | Ga0496104_0416495 | 3300048907 | Bacteria | 1256 |
| 417 | Ga0496104_0909719 | 3300048907 | Bacteria | 785 |
| 418 | Ga0496105_0013426 | 3300048908 | Bacteria | 6502 |
| 419 | Ga0496105_0196307 | 3300048908 | Bacteria | 1649 |
| 420 | Ga0496106_0239330 | 3300048909 | Bacteria | 1450 |
| 421 | Ga0496106_0500765 | 3300048909 | Bacteria | 976 |
| 422 | Ga0496107_0014072 | 3300048910 | Bacteria | 5601 |
| 423 | Ga0496107_0316736 | 3300048910 | Bacteria | 1161 |
| 424 | Ga0496107_0649349 | 3300048910 | Bacteria | 778 |
| 425 | Ga0496108_0037471 | 3300048911 | Bacteria | 4039 |
| 426 | Ga0496108_0318919 | 3300048911 | Bacteria | 1355 |
| 427 | Ga0496108_0529274 | 3300048911 | Bacteria | 1029 |
| 428 | Ga0496109_0033793 | 3300048912 | Bacteria | 4603 |
| 429 | Ga0496109_0046204 | 3300048912 | Bacteria | 3954 |
| 430 | Ga0496109_0103512 | 3300048912 | Bacteria | 2642 |
| 431 | Ga0496109_1144098 | 3300048912 | Bacteria | 715 |
| 432 | Ga0496110_0002022 | 3300048913 | Bacteria | 15099 |
| 433 | Ga0496110_0750926 | 3300048913 | Bacteria | 879 |
| 434 | Ga0496110_0753822 | 3300048913 | Bacteria | 877 |
| 435 | Ga0496110_0812884 | 3300048913 | Bacteria | 839 |
| 436 | Ga0496110_0975413 | 3300048913 | Bacteria | 755 |
| 437 | Ga0496110_1489966 | 3300048913 | Bacteria | 586 |
| 438 | Ga0496111_0001077 | 3300048914 | Bacteria | 15058 |
| 439 | Ga0496111_0091228 | 3300048914 | Bacteria | 2233 |
| 440 | Ga0496111_0112686 | 3300048914 | Bacteria | 2004 |
| 441 | Ga0496111_0119996 | 3300048914 | Bacteria | 1942 |
| 442 | Ga0496111_1120110 | 3300048914 | Bacteria | 560 |
| 443 | Ga0496112_0000848 | 3300048915 | Bacteria | 21825 |
| 444 | Ga0496112_0048051 | 3300048915 | Bacteria | 4185 |
| 445 | Ga0496112_0065235 | 3300048915 | Bacteria | 3593 |
| 446 | Ga0496112_0105434 | 3300048915 | Bacteria | 2788 |
| 447 | Ga0496112_0120606 | 3300048915 | Bacteria | 2592 |
| 448 | Ga0496112_0190864 | 3300048915 | Bacteria | 2011 |
| 449 | Ga0496112_0192462 | 3300048915 | Bacteria | 2001 |
| 450 | Ga0496112_0355115 | 3300048915 | Bacteria | 1408 |
| 451 | Ga0496113_0006671 | 3300048916 | Bacteria | 7345 |
| 452 | Ga0496113_0032764 | 3300048916 | Bacteria | 3778 |
| 453 | Ga0496113_0037888 | 3300048916 | Bacteria | 3542 |
| 454 | Ga0496113_0528094 | 3300048916 | Bacteria | 947 |
| 455 | Ga0496113_1020532 | 3300048916 | Bacteria | 651 |
| 456 | Ga0496114_0058459 | 3300048917 | Bacteria | 3220 |
| 457 | Ga0496114_0105306 | 3300048917 | Bacteria | 2413 |
| 458 | Ga0496114_0179778 | 3300048917 | Bacteria | 1847 |
| 459 | Ga0496114_1035116 | 3300048917 | Bacteria | 705 |
| 460 | Ga0496114_1270873 | 3300048917 | Unclassified | 623 |
| 461 | Ga0496115_0437547 | 3300048918 | Bacteria | 1058 |
| 462 | Ga0496121_0038003 | 3300048924 | Bacteria | 4270 |
| 463 | Ga0496124_0059124 | 3300048927 | Bacteria | 3221 |
| 464 | Ga0496126_0260656 | 3300048929 | Bacteria | 1442 |
| 465 | Ga0501031_0164255 | 3300049568 | Bacteria | 1451 |
| 466 | Ga0501031_0342457 | 3300049568 | Bacteria | 968 |
| 467 | Ga0501033_0124920 | 3300049570 | Bacteria | 1866 |
| 468 | Ga0501033_0558794 | 3300049570 | Bacteria | 788 |
| 469 | Ga0501034_0033144 | 3300049571 | Bacteria | 5243 |
| 470 | Ga0501036_0064942 | 3300049572 | Bacteria | 3089 |
| 471 | Ga0501036_0551674 | 3300049572 | Bacteria | 957 |
| 472 | Ga0501036_0904852 | 3300049572 | Bacteria | 724 |
| 473 | Ga0501037_0253214 | 3300049573 | Bacteria | 1232 |
| 474 | Ga0501038_0112952 | 3300049574 | Bacteria | 2248 |
| 475 | Ga0501038_0155936 | 3300049574 | Bacteria | 1859 |
| 476 | Ga0501039_0024585 | 3300049575 | Bacteria | 4628 |
| 477 | Ga0501040_0160086 | 3300049576 | Bacteria | 1591 |
| 478 | Ga0501040_0323834 | 3300049576 | Bacteria | 1102 |
| 479 | Ga0501041_0030356 | 3300049577 | Bacteria | 3262 |
| 480 | Ga0501041_0185212 | 3300049577 | Bacteria | 1304 |
| 481 | Ga0501042_0032100 | 3300049578 | Bacteria | 3717 |
| 482 | Ga0501042_0131604 | 3300049578 | Bacteria | 1803 |
| 483 | Ga0501042_0815248 | 3300049578 | Bacteria | 679 |
| 484 | Ga0501043_0127000 | 3300049579 | Bacteria | 2000 |
| 485 | Ga0501047_0268588 | 3300049581 | Bacteria | 1552 |
| 486 | Ga0501048_0464796 | 3300049582 | Bacteria | 906 |
| 487 | Ga0501048_0652745 | 3300049582 | Unclassified | 755 |
| 488 | Ga0501067_0165629 | 3300049583 | Bacteria | 1231 |
| 489 | Ga0501071_0014945 | 3300049587 | Bacteria | 5319 |
| 490 | Ga0501071_0086996 | 3300049587 | Bacteria | 2292 |
| 491 | Ga0501071_0130404 | 3300049587 | Bacteria | 1867 |
| 492 | Ga0501071_0201263 | 3300049587 | Bacteria | 1496 |
| 493 | Ga0501072_0051700 | 3300049588 | Bacteria | 3235 |
| 494 | Ga0501072_0078276 | 3300049588 | Bacteria | 2618 |
| 495 | Ga0501072_0300886 | 3300049588 | Bacteria | 1275 |
| 496 | Ga0501073_0422832 | 3300049589 | Bacteria | 921 |
| 497 | Ga0501074_0134749 | 3300049590 | Bacteria | 1767 |
| 498 | Ga0501074_1165306 | 3300049590 | Unclassified | 541 |
| 499 | Ga0501075_0070001 | 3300049591 | Bacteria | 2652 |
| 500 | Ga0501075_0087016 | 3300049591 | Bacteria | 2368 |
| 501 | Ga0501075_0426025 | 3300049591 | Bacteria | 1012 |
| 502 | Ga0501076_0237771 | 3300049592 | Bacteria | 1490 |
| 503 | Ga0501076_0347763 | 3300049592 | Bacteria | 1217 |
| 504 | Ga0501077_0241477 | 3300049593 | Bacteria | 1148 |
| 505 | Ga0501259_066469 | 3300049688 | Bacteria | 765 |
| 506 | Ga0501079_0084818 | 3300049741 | Bacteria | 2451 |
| 507 | Ga0501079_0162035 | 3300049741 | Bacteria | 1744 |
| 508 | Ga0501079_0263116 | 3300049741 | Bacteria | 1348 |
| 509 | Ga0501079_0717755 | 3300049741 | Bacteria | 787 |
| 510 | Ga0501080_0303149 | 3300049742 | Bacteria | 1448 |
| 511 | Ga0501080_0331173 | 3300049742 | Bacteria | 1377 |
| 512 | Ga0501081_0078034 | 3300049743 | Bacteria | 2315 |
| 513 | Ga0501081_0433816 | 3300049743 | Bacteria | 975 |
| 514 | Ga0501081_0499803 | 3300049743 | Bacteria | 906 |
| 515 | Ga0501083_0389687 | 3300049744 | Bacteria | 906 |
| 516 | Ga0501083_0531376 | 3300049744 | Bacteria | 765 |
| 517 | Ga0501035_0299932 | 3300049822 | Bacteria | 1354 |
| 518 | Ga0501044_0593793 | 3300049823 | Bacteria | 1001 |
| 519 | Ga0501045_0144940 | 3300049824 | Bacteria | 1766 |
| 520 | Ga0501045_0494779 | 3300049824 | Unclassified | 908 |
| 521 | Ga0501045_0839525 | 3300049824 | Bacteria | 676 |
| 522 | nmdc:mga0yw44_1036288_c1 | 3300050492 | Bacteria | 555 |
| 523 | nmdc:mga05p37_324769_c1 | 3300050507 | Bacteria | 1820 |
| 524 | nmdc:mga05p37_382397_c1 | 3300050507 | Bacteria | 1649 |
| 525 | nmdc:mga09592_1365615_c1 | 3300050508 | Bacteria | 580 |
| 526 | nmdc:mga09592_3695_c2 | 3300050508 | Bacteria | 9164 |
| 527 | nmdc:mga09592_40339_c1 | 3300050508 | Bacteria | 3921 |
| 528 | nmdc:mga09592_702483_c1 | 3300050508 | Bacteria | 860 |
| 529 | nmdc:mga09592_706691_c1 | 3300050508 | Bacteria | 857 |
| 530 | nmdc:mga0qj67_32719_c1 | 3300050509 | Bacteria | 4057 |
| 531 | nmdc:mga0qj67_59266_c1 | 3300050509 | Bacteria | 3036 |
| 532 | nmdc:mga06r32_1184375_c1 | 3300050510 | Bacteria | 711 |
| 533 | nmdc:mga06r32_67635_c1 | 3300050510 | Bacteria | 3450 |
| 534 | nmdc:mga06r32_95356_c1 | 3300050510 | Bacteria | 2912 |
| 535 | nmdc:mga08y16_1047938_c1 | 3300050511 | Bacteria | 793 |
| 536 | nmdc:mga08y16_30683_c1 | 3300050511 | Bacteria | 5654 |
| 537 | nmdc:mga08y16_489840_c1 | 3300050511 | Bacteria | 1250 |
| 538 | Ga0495601_0118672 | 3300053077 | Bacteria | 1717 |
| 539 | Ga0495655_0207360 | 3300053083 | Unclassified | 643 |
| 540 | Ga0495619_0502188 | 3300053085 | Bacteria | 834 |
| 541 | Ga0500616_0135402 | 3300053153 | Bacteria | 1158 |
| 542 | Ga0501084_0236975 | 3300054114 | Bacteria | 1540 |
| 543 | Ga0501084_0261448 | 3300054114 | Bacteria | 1461 |
| 544 | Ga0501084_0291071 | 3300054114 | Bacteria | 1379 |
| 545 | Ga0501084_0612899 | 3300054114 | Bacteria | 919 |
| 546 | Ga0501084_1606925 | 3300054114 | Bacteria | 543 |
| 547 | Ga0590071_132498 | 3300059421 | Bacteria | 641 |
| 548 | Ga0590074_048393 | 3300059423 | Bacteria | 775 |
| 549 | Ga0587073_0170482 | 3300059492 | Bacteria | 631 |
| 550 | Ga0587080_045663 | 3300059503 | Bacteria | 812 |
| 551 | Ga0587114_123833 | 3300059655 | Bacteria | 526 |
| 552 | Ga0501082_0102730 | 3300060353 | Bacteria | 2473 |
| 553 | Ga0501082_0198826 | 3300060353 | Bacteria | 1744 |
| 554 | Ga0501082_0332312 | 3300060353 | Bacteria | 1324 |
| 555 | Ga0501082_0684442 | 3300060353 | Bacteria | 898 |
| 556 | Ga0501082_0739386 | 3300060353 | Bacteria | 861 |
| 557 | Ga0501082_0834793 | 3300060353 | Bacteria | 806 |
| 558 | Ga0501082_0971201 | 3300060353 | Bacteria | 743 |
| 559 | Ga0466962_0070727 | 3300061719 | Bacteria | 1667 |
| 560 | Ga0466962_0315777 | 3300061719 | Bacteria | 774 |
| 561 | Ga0466962_0520905 | 3300061719 | Bacteria | 603 |
| 562 | Ga0530510_0016156 | 3300061734 | Bacteria | 5279 |
| 563 | Ga0530510_0100423 | 3300061734 | Bacteria | 2116 |
| 564 | Ga0530510_0182771 | 3300061734 | Bacteria | 1555 |
| 565 | Ga0530510_0971630 | 3300061734 | Unclassified | 650 |
| 566 | Ga0530510_1350088 | 3300061734 | Bacteria | 547 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046513 | Ga0495616_0085415 | Ga0495616_0085415_298_792 | 113 |
| 2 | 3300006880 | Ga0075429_100669000 | Ga0075429_1006690002 | 120 |
| 3 | 3300009176 | Ga0105242_10372913 | Ga0105242_103729132 | 120 |
| 4 | 3300013296 | Ga0157374_10482483 | Ga0157374_104824832 | 120 |
| 5 | 3300014745 | Ga0157377_10234580 | Ga0157377_102345802 | 120 |
| 6 | 3300026089 | Ga0207648_10249825 | Ga0207648_102498252 | 120 |
| 7 | 3300037312 | Ga0395899_0473869 | Ga0395899_0473869_109_549 | 120 |
| 8 | 3300037418 | Ga0395900_0678806 | Ga0395900_0678806_457_897 | 120 |
| 9 | 3300037466 | Ga0395898_0197937 | Ga0395898_0197937_138_578 | 120 |
| 10 | 3300037466 | Ga0395898_0548129 | Ga0395898_0548129_341_781 | 120 |
| 11 | 3300037471 | Ga0395905_0440475 | Ga0395905_0440475_662_1102 | 120 |
| 12 | 3300038443 | Ga0395901_0021637 | Ga0395901_0021637_3665_4105 | 120 |
| 13 | 3300048912 | Ga0496109_0033793 | Ga0496109_0033793_926_1366 | 120 |
| 14 | 3300048913 | Ga0496110_1489966 | Ga0496110_1489966_34_474 | 120 |
| 15 | 3300048915 | Ga0496112_0120606 | Ga0496112_0120606_2002_2442 | 120 |
| 16 | 3300053085 | Ga0495619_0502188 | Ga0495619_0502188_180_614 | 120 |
| 17 | 3300005328 | Ga0070676_10249135 | Ga0070676_102491352 | 121 |
| 18 | 3300005331 | Ga0070670_100996850 | Ga0070670_1009968502 | 121 |
| 19 | 3300005345 | Ga0070692_10140470 | Ga0070692_101404702 | 121 |
| 20 | 3300005347 | Ga0070668_100288096 | Ga0070668_1002880962 | 121 |
| 21 | 3300005356 | Ga0070674_100320375 | Ga0070674_1003203752 | 121 |
| 22 | 3300005441 | Ga0070700_100047515 | Ga0070700_1000475155 | 121 |
| 23 | 3300005459 | Ga0068867_100764321 | Ga0068867_1007643212 | 121 |
| 24 | 3300005543 | Ga0070672_100205811 | Ga0070672_1002058112 | 121 |
| 25 | 3300005618 | Ga0068864_101643751 | Ga0068864_1016437512 | 121 |
| 26 | 3300005840 | Ga0068870_10651316 | Ga0068870_106513161 | 121 |
| 27 | 3300006846 | Ga0075430_100022193 | Ga0075430_1000221934 | 121 |
| 28 | 3300006847 | Ga0075431_100020434 | Ga0075431_1000204348 | 121 |
| 29 | 3300006880 | Ga0075429_100022138 | Ga0075429_1000221386 | 121 |
| 30 | 3300006881 | Ga0068865_100328964 | Ga0068865_1003289642 | 121 |
| 31 | 3300009094 | Ga0111539_10773529 | Ga0111539_107735291 | 121 |
| 32 | 3300009094 | Ga0111539_12601505 | Ga0111539_126015052 | 121 |
| 33 | 3300009147 | Ga0114129_10273189 | Ga0114129_102731894 | 121 |
| 34 | 3300009147 | Ga0114129_10755453 | Ga0114129_107554532 | 121 |
| 35 | 3300009174 | Ga0105241_10928292 | Ga0105241_109282922 | 121 |
| 36 | 3300011119 | Ga0105246_11406619 | Ga0105246_114066191 | 121 |
| 37 | 3300014326 | Ga0157380_10017875 | Ga0157380_100178752 | 121 |
| 38 | 3300014969 | Ga0157376_10057234 | Ga0157376_100572342 | 121 |
| 39 | 3300025907 | Ga0207645_10209593 | Ga0207645_102095932 | 121 |
| 40 | 3300025926 | Ga0207659_10649278 | Ga0207659_106492782 | 121 |
| 41 | 3300025937 | Ga0207669_10114107 | Ga0207669_101141072 | 121 |
| 42 | 3300025940 | Ga0207691_10257644 | Ga0207691_102576442 | 121 |
| 43 | 3300025960 | Ga0207651_11541467 | Ga0207651_115414671 | 121 |
| 44 | 3300025972 | Ga0207668_10108887 | Ga0207668_101088872 | 121 |
| 45 | 3300025981 | Ga0207640_11295343 | Ga0207640_112953432 | 121 |
| 46 | 3300026075 | Ga0207708_10010975 | Ga0207708_100109753 | 121 |
| 47 | 3300026078 | Ga0207702_10348246 | Ga0207702_103482462 | 121 |
| 48 | 3300046491 | Ga0495584_0345314 | Ga0495584_0345314_35_424 | 121 |
| 49 | 3300049688 | Ga0501259_066469 | Ga0501259_066469_211_660 | 121 |
| 50 | 3300050507 | nmdc:mga05p37_324769_c1 | nmdc:mga05p37_324769_c1_431_874 | 121 |
| 51 | 3300050508 | nmdc:mga09592_40339_c1 | nmdc:mga09592_40339_c1_1894_2337 | 121 |
| 52 | 3300050509 | nmdc:mga0qj67_59266_c1 | nmdc:mga0qj67_59266_c1_699_1142 | 121 |
| 53 | 3300050510 | nmdc:mga06r32_95356_c1 | nmdc:mga06r32_95356_c1_1434_1877 | 121 |
| 54 | 3300005343 | Ga0070687_100364368 | Ga0070687_1003643682 | 122 |
| 55 | 3300005344 | Ga0070661_101112438 | Ga0070661_1011124381 | 122 |
| 56 | 3300005364 | Ga0070673_100841533 | Ga0070673_1008415332 | 122 |
| 57 | 3300005435 | Ga0070714_100001858 | Ga0070714_10000185813 | 122 |
| 58 | 3300005539 | Ga0068853_101133260 | Ga0068853_1011332601 | 122 |
| 59 | 3300005563 | Ga0068855_101637900 | Ga0068855_1016379002 | 122 |
| 60 | 3300005564 | Ga0070664_100768970 | Ga0070664_1007689702 | 122 |
| 61 | 3300005614 | Ga0068856_100309695 | Ga0068856_1003096952 | 122 |
| 62 | 3300005615 | Ga0070702_100526707 | Ga0070702_1005267072 | 122 |
| 63 | 3300006846 | Ga0075430_100367473 | Ga0075430_1003674732 | 122 |
| 64 | 3300006847 | Ga0075431_101328298 | Ga0075431_1013282981 | 122 |
| 65 | 3300009176 | Ga0105242_12131891 | Ga0105242_121318911 | 122 |
| 66 | 3300013306 | Ga0163162_12337016 | Ga0163162_123370161 | 122 |
| 67 | 3300025913 | Ga0207695_10007814 | Ga0207695_100078145 | 122 |
| 68 | 3300025920 | Ga0207649_10691770 | Ga0207649_106917701 | 122 |
| 69 | 3300025929 | Ga0207664_10000006 | Ga0207664_10000006412 | 122 |
| 70 | 3300026067 | Ga0207678_10557394 | Ga0207678_105573942 | 122 |
| 71 | 3300026078 | Ga0207702_10658118 | Ga0207702_106581182 | 122 |
| 72 | 3300031731 | Ga0307405_10867848 | Ga0307405_108678482 | 122 |
| 73 | 3300035691 | Ga0373931_0847903 | Ga0373931_0847903_30_473 | 122 |
| 74 | 3300038443 | Ga0395901_0454080 | Ga0395901_0454080_102_536 | 122 |
| 75 | 3300038443 | Ga0395901_0581799 | Ga0395901_0581799_599_1036 | 122 |
| 76 | 3300044658 | Ga0466972_0077519 | Ga0466972_0077519_715_1155 | 122 |
| 77 | 3300044658 | Ga0466972_0276912 | Ga0466972_0276912_246_692 | 122 |
| 78 | 3300044658 | Ga0466972_0343881 | Ga0466972_0343881_16_447 | 122 |
| 79 | 3300044683 | Ga0466965_0268968 | Ga0466965_0268968_68_499 | 122 |
| 80 | 3300044694 | Ga0466963_0185117 | Ga0466963_0185117_58_492 | 122 |
| 81 | 3300044694 | Ga0466963_0693714 | Ga0466963_0693714_185_625 | 122 |
| 82 | 3300044765 | Ga0466970_0121497 | Ga0466970_0121497_344_775 | 122 |
| 83 | 3300044901 | Ga0466960_0008354 | Ga0466960_0008354_2232_2690 | 122 |
| 84 | 3300045976 | Ga0466967_0002244 | Ga0466967_0002244_4349_4789 | 122 |
| 85 | 3300045976 | Ga0466967_0016543 | Ga0466967_0016543_1002_1442 | 122 |
| 86 | 3300045976 | Ga0466967_0840514 | Ga0466967_0840514_462_887 | 122 |
| 87 | 3300046515 | Ga0495620_0135985 | Ga0495620_0135985_303_788 | 122 |
| 88 | 3300046539 | Ga0495621_0167519 | Ga0495621_0167519_361_846 | 122 |
| 89 | 3300046810 | Ga0495660_0433460 | Ga0495660_0433460_59_544 | 122 |
| 90 | 3300047472 | Ga0495686_0044207 | Ga0495686_0044207_592_1077 | 122 |
| 91 | 3300048907 | Ga0496104_0416495 | Ga0496104_0416495_696_1136 | 122 |
| 92 | 3300048910 | Ga0496107_0649349 | Ga0496107_0649349_121_561 | 122 |
| 93 | 3300048911 | Ga0496108_0529274 | Ga0496108_0529274_373_813 | 122 |
| 94 | 3300048912 | Ga0496109_1144098 | Ga0496109_1144098_168_608 | 122 |
| 95 | 3300048914 | Ga0496111_0119996 | Ga0496111_0119996_1313_1753 | 122 |
| 96 | 3300048915 | Ga0496112_0190864 | Ga0496112_0190864_892_1332 | 122 |
| 97 | 3300049571 | Ga0501034_0033144 | Ga0501034_0033144_3508_3966 | 122 |
| 98 | 3300049583 | Ga0501067_0165629 | Ga0501067_0165629_344_802 | 122 |
| 99 | 3300049743 | Ga0501081_0433816 | Ga0501081_0433816_355_792 | 122 |
| 100 | 3300050508 | nmdc:mga09592_706691_c1 | nmdc:mga09592_706691_c1_48_494 | 122 |
| 101 | 3300061734 | Ga0530510_1350088 | Ga0530510_1350088_89_529 | 122 |
| 102 | 3300003373 | JGI25407J50210_10031613 | JGI25407J50210_100316131 | 123 |
| 103 | 3300005337 | Ga0070682_100746146 | Ga0070682_1007461462 | 123 |
| 104 | 3300005338 | Ga0068868_100289784 | Ga0068868_1002897842 | 123 |
| 105 | 3300005343 | Ga0070687_100168391 | Ga0070687_1001683912 | 123 |
| 106 | 3300005345 | Ga0070692_10287064 | Ga0070692_102870642 | 123 |
| 107 | 3300005345 | Ga0070692_10979564 | Ga0070692_109795642 | 123 |
| 108 | 3300005435 | Ga0070714_100056010 | Ga0070714_1000560103 | 123 |
| 109 | 3300005530 | Ga0070679_100679980 | Ga0070679_1006799802 | 123 |
| 110 | 3300005547 | Ga0070693_100196756 | Ga0070693_1001967561 | 123 |
| 111 | 3300005564 | Ga0070664_100092298 | Ga0070664_1000922983 | 123 |
| 112 | 3300005841 | Ga0068863_100579041 | Ga0068863_1005790412 | 123 |
| 113 | 3300005841 | Ga0068863_100898717 | Ga0068863_1008987172 | 123 |
| 114 | 3300005843 | Ga0068860_101219579 | Ga0068860_1012195792 | 123 |
| 115 | 3300005981 | Ga0081538_10003555 | Ga0081538_100035554 | 123 |
| 116 | 3300006844 | Ga0075428_100882859 | Ga0075428_1008828592 | 123 |
| 117 | 3300006846 | Ga0075430_101501543 | Ga0075430_1015015431 | 123 |
| 118 | 3300009093 | Ga0105240_11098695 | Ga0105240_110986952 | 123 |
| 119 | 3300009098 | Ga0105245_10601039 | Ga0105245_106010392 | 123 |
| 120 | 3300009101 | Ga0105247_10963184 | Ga0105247_109631841 | 123 |
| 121 | 3300009148 | Ga0105243_10524364 | Ga0105243_105243642 | 123 |
| 122 | 3300009176 | Ga0105242_10168616 | Ga0105242_101686162 | 123 |
| 123 | 3300009553 | Ga0105249_11273959 | Ga0105249_112739592 | 123 |
| 124 | 3300009553 | Ga0105249_11751375 | Ga0105249_117513751 | 123 |
| 125 | 3300010375 | Ga0105239_11118509 | Ga0105239_111185092 | 123 |
| 126 | 3300013306 | Ga0163162_10963716 | Ga0163162_109637162 | 123 |
| 127 | 3300013307 | Ga0157372_11274509 | Ga0157372_112745092 | 123 |
| 128 | 3300014326 | Ga0157380_10334346 | Ga0157380_103343463 | 123 |
| 129 | 3300014326 | Ga0157380_10425020 | Ga0157380_104250202 | 123 |
| 130 | 3300014968 | Ga0157379_10536179 | Ga0157379_105361792 | 123 |
| 131 | 3300025912 | Ga0207707_10357351 | Ga0207707_103573512 | 123 |
| 132 | 3300025927 | Ga0207687_10195610 | Ga0207687_101956102 | 123 |
| 133 | 3300025929 | Ga0207664_10070763 | Ga0207664_100707632 | 123 |
| 134 | 3300025933 | Ga0207706_10685801 | Ga0207706_106858012 | 123 |
| 135 | 3300025934 | Ga0207686_10482741 | Ga0207686_104827412 | 123 |
| 136 | 3300025937 | Ga0207669_10166033 | Ga0207669_101660332 | 123 |
| 137 | 3300026023 | Ga0207677_10035314 | Ga0207677_100353144 | 123 |
| 138 | 3300026035 | Ga0207703_10257945 | Ga0207703_102579452 | 123 |
| 139 | 3300026089 | Ga0207648_10627411 | Ga0207648_106274111 | 123 |
| 140 | 3300026095 | Ga0207676_10311337 | Ga0207676_103113372 | 123 |
| 141 | 3300026121 | Ga0207683_10287123 | Ga0207683_102871232 | 123 |
| 142 | 3300026142 | Ga0207698_10799997 | Ga0207698_107999972 | 123 |
| 143 | 3300027907 | Ga0207428_10333256 | Ga0207428_103332562 | 123 |
| 144 | 3300028380 | Ga0268265_11901811 | Ga0268265_119018111 | 123 |
| 145 | 3300031548 | Ga0307408_100600062 | Ga0307408_1006000622 | 123 |
| 146 | 3300031731 | Ga0307405_10113123 | Ga0307405_101131233 | 123 |
| 147 | 3300031731 | Ga0307405_10139757 | Ga0307405_101397572 | 123 |
| 148 | 3300031911 | Ga0307412_10467765 | Ga0307412_104677652 | 123 |
| 149 | 3300031995 | Ga0307409_101756298 | Ga0307409_1017562982 | 123 |
| 150 | 3300032126 | Ga0307415_100002060 | Ga0307415_10000206010 | 123 |
| 151 | 3300037466 | Ga0395898_1562055 | Ga0395898_1562055_44_481 | 123 |
| 152 | 3300037466 | Ga0395898_1792351 | Ga0395898_1792351_23_463 | 123 |
| 153 | 3300042438 | Ga0439459_0108697 | Ga0439459_0108697_93_527 | 123 |
| 154 | 3300044683 | Ga0466965_0584452 | Ga0466965_0584452_74_511 | 123 |
| 155 | 3300044694 | Ga0466963_0011641 | Ga0466963_0011641_1616_2047 | 123 |
| 156 | 3300044706 | Ga0466964_0879177 | Ga0466964_0879177_57_491 | 123 |
| 157 | 3300044719 | Ga0466971_0019707 | Ga0466971_0019707_1533_1964 | 123 |
| 158 | 3300044735 | Ga0466968_0413519 | Ga0466968_0413519_180_641 | 123 |
| 159 | 3300044842 | Ga0466957_0213192 | Ga0466957_0213192_689_1135 | 123 |
| 160 | 3300045049 | Ga0466959_0318772 | Ga0466959_0318772_488_919 | 123 |
| 161 | 3300045976 | Ga0466967_0016429 | Ga0466967_0016429_3546_3983 | 123 |
| 162 | 3300045976 | Ga0466967_0439326 | Ga0466967_0439326_145_585 | 123 |
| 163 | 3300045976 | Ga0466967_1535171 | Ga0466967_1535171_119_556 | 123 |
| 164 | 3300046461 | Ga0495641_0005510 | Ga0495641_0005510_2296_2781 | 123 |
| 165 | 3300046461 | Ga0495641_0428191 | Ga0495641_0428191_131_571 | 123 |
| 166 | 3300046471 | Ga0495650_0000223 | Ga0495650_0000223_43620_44087 | 123 |
| 167 | 3300046615 | Ga0495656_0017871 | Ga0495656_0017871_54_626 | 123 |
| 168 | 3300047469 | Ga0495673_0050625 | Ga0495673_0050625_1209_1781 | 123 |
| 169 | 3300048904 | Ga0496101_0609580 | Ga0496101_0609580_70_513 | 123 |
| 170 | 3300048905 | Ga0496102_0235660 | Ga0496102_0235660_352_795 | 123 |
| 171 | 3300048905 | Ga0496102_0555782 | Ga0496102_0555782_164_595 | 123 |
| 172 | 3300048909 | Ga0496106_0239330 | Ga0496106_0239330_474_917 | 123 |
| 173 | 3300048909 | Ga0496106_0500765 | Ga0496106_0500765_321_761 | 123 |
| 174 | 3300048910 | Ga0496107_0316736 | Ga0496107_0316736_258_701 | 123 |
| 175 | 3300048911 | Ga0496108_0037471 | Ga0496108_0037471_2475_2918 | 123 |
| 176 | 3300048912 | Ga0496109_0046204 | Ga0496109_0046204_2519_2971 | 123 |
| 177 | 3300048912 | Ga0496109_0103512 | Ga0496109_0103512_119_562 | 123 |
| 178 | 3300048913 | Ga0496110_0753822 | Ga0496110_0753822_11_454 | 123 |
| 179 | 3300048913 | Ga0496110_0812884 | Ga0496110_0812884_187_639 | 123 |
| 180 | 3300048913 | Ga0496110_0975413 | Ga0496110_0975413_17_451 | 123 |
| 181 | 3300048914 | Ga0496111_0112686 | Ga0496111_0112686_125_568 | 123 |
| 182 | 3300048914 | Ga0496111_1120110 | Ga0496111_1120110_96_548 | 123 |
| 183 | 3300048915 | Ga0496112_0105434 | Ga0496112_0105434_2031_2483 | 123 |
| 184 | 3300048915 | Ga0496112_0192462 | Ga0496112_0192462_962_1399 | 123 |
| 185 | 3300048916 | Ga0496113_0006671 | Ga0496113_0006671_5169_5612 | 123 |
| 186 | 3300048916 | Ga0496113_0032764 | Ga0496113_0032764_2269_2721 | 123 |
| 187 | 3300048917 | Ga0496114_0105306 | Ga0496114_0105306_1849_2289 | 123 |
| 188 | 3300048917 | Ga0496114_0179778 | Ga0496114_0179778_89_532 | 123 |
| 189 | 3300049591 | Ga0501075_0426025 | Ga0501075_0426025_385_834 | 123 |
| 190 | 3300053153 | Ga0500616_0135402 | Ga0500616_0135402_86_517 | 123 |
| 191 | 3300059492 | Ga0587073_0170482 | Ga0587073_0170482_48_488 | 123 |
| 192 | 3300059503 | Ga0587080_045663 | Ga0587080_045663_43_480 | 123 |
| 193 | 3300059655 | Ga0587114_123833 | Ga0587114_123833_39_479 | 123 |
| 194 | 3300061719 | Ga0466962_0315777 | Ga0466962_0315777_229_660 | 123 |
| 195 | 3300000549 | LJQas_1030268 | LJQas_10302682 | 124 |
| 196 | 3300005329 | Ga0070683_100424399 | Ga0070683_1004243992 | 124 |
| 197 | 3300005337 | Ga0070682_100742291 | Ga0070682_1007422912 | 124 |
| 198 | 3300005339 | Ga0070660_100771662 | Ga0070660_1007716622 | 124 |
| 199 | 3300005344 | Ga0070661_100300793 | Ga0070661_1003007932 | 124 |
| 200 | 3300005347 | Ga0070668_100152622 | Ga0070668_1001526223 | 124 |
| 201 | 3300005356 | Ga0070674_100322733 | Ga0070674_1003227332 | 124 |
| 202 | 3300005435 | Ga0070714_100192946 | Ga0070714_1001929461 | 124 |
| 203 | 3300005457 | Ga0070662_100031509 | Ga0070662_1000315092 | 124 |
| 204 | 3300005459 | Ga0068867_101724778 | Ga0068867_1017247782 | 124 |
| 205 | 3300005471 | Ga0070698_101653693 | Ga0070698_1016536932 | 124 |
| 206 | 3300005546 | Ga0070696_100131145 | Ga0070696_1001311452 | 124 |
| 207 | 3300005549 | Ga0070704_100127148 | Ga0070704_1001271483 | 124 |
| 208 | 3300005577 | Ga0068857_101361830 | Ga0068857_1013618302 | 124 |
| 209 | 3300005614 | Ga0068856_101863315 | Ga0068856_1018633151 | 124 |
| 210 | 3300005844 | Ga0068862_100308420 | Ga0068862_1003084202 | 124 |
| 211 | 3300005937 | Ga0081455_10082585 | Ga0081455_100825852 | 124 |
| 212 | 3300005937 | Ga0081455_10221488 | Ga0081455_102214882 | 124 |
| 213 | 3300005985 | Ga0081539_10012516 | Ga0081539_100125164 | 124 |
| 214 | 3300009094 | Ga0111539_10781737 | Ga0111539_107817372 | 124 |
| 215 | 3300009098 | Ga0105245_10112556 | Ga0105245_101125564 | 124 |
| 216 | 3300009098 | Ga0105245_10606399 | Ga0105245_106063992 | 124 |
| 217 | 3300009148 | Ga0105243_10115568 | Ga0105243_101155683 | 124 |
| 218 | 3300009148 | Ga0105243_10569189 | Ga0105243_105691892 | 124 |
| 219 | 3300009176 | Ga0105242_11070793 | Ga0105242_110707932 | 124 |
| 220 | 3300009551 | Ga0105238_10978142 | Ga0105238_109781422 | 124 |
| 221 | 3300009553 | Ga0105249_10386778 | Ga0105249_103867782 | 124 |
| 222 | 3300009553 | Ga0105249_10593999 | Ga0105249_105939992 | 124 |
| 223 | 3300013297 | Ga0157378_10637237 | Ga0157378_106372372 | 124 |
| 224 | 3300013307 | Ga0157372_12536125 | Ga0157372_125361252 | 124 |
| 225 | 3300013308 | Ga0157375_11541725 | Ga0157375_115417252 | 124 |
| 226 | 3300014745 | Ga0157377_10369535 | Ga0157377_103695352 | 124 |
| 227 | 3300025923 | Ga0207681_11276294 | Ga0207681_112762941 | 124 |
| 228 | 3300025929 | Ga0207664_10148898 | Ga0207664_101488982 | 124 |
| 229 | 3300025933 | Ga0207706_10011962 | Ga0207706_100119628 | 124 |
| 230 | 3300025935 | Ga0207709_10262707 | Ga0207709_102627072 | 124 |
| 231 | 3300025935 | Ga0207709_10414273 | Ga0207709_104142732 | 124 |
| 232 | 3300025935 | Ga0207709_10817339 | Ga0207709_108173392 | 124 |
| 233 | 3300025937 | Ga0207669_10165694 | Ga0207669_101656942 | 124 |
| 234 | 3300025938 | Ga0207704_10580412 | Ga0207704_105804122 | 124 |
| 235 | 3300025944 | Ga0207661_10246478 | Ga0207661_102464782 | 124 |
| 236 | 3300025960 | Ga0207651_10959722 | Ga0207651_109597222 | 124 |
| 237 | 3300025972 | Ga0207668_10118812 | Ga0207668_101188122 | 124 |
| 238 | 3300026041 | Ga0207639_10458057 | Ga0207639_104580572 | 124 |
| 239 | 3300026075 | Ga0207708_10729775 | Ga0207708_107297752 | 124 |
| 240 | 3300026078 | Ga0207702_11207009 | Ga0207702_112070091 | 124 |
| 241 | 3300026116 | Ga0207674_10544635 | Ga0207674_105446352 | 124 |
| 242 | 3300027907 | Ga0207428_10043062 | Ga0207428_100430625 | 124 |
| 243 | 3300031548 | Ga0307408_100194265 | Ga0307408_1001942651 | 124 |
| 244 | 3300031731 | Ga0307405_10058977 | Ga0307405_100589771 | 124 |
| 245 | 3300031731 | Ga0307405_10433293 | Ga0307405_104332931 | 124 |
| 246 | 3300031824 | Ga0307413_10281337 | Ga0307413_102813372 | 124 |
| 247 | 3300031852 | Ga0307410_10234266 | Ga0307410_102342662 | 124 |
| 248 | 3300031901 | Ga0307406_10019215 | Ga0307406_100192153 | 124 |
| 249 | 3300031903 | Ga0307407_10010725 | Ga0307407_100107254 | 124 |
| 250 | 3300031911 | Ga0307412_10073601 | Ga0307412_100736012 | 124 |
| 251 | 3300031911 | Ga0307412_10725933 | Ga0307412_107259331 | 124 |
| 252 | 3300031911 | Ga0307412_11576614 | Ga0307412_115766141 | 124 |
| 253 | 3300031995 | Ga0307409_100004644 | Ga0307409_1000046443 | 124 |
| 254 | 3300031995 | Ga0307409_100051528 | Ga0307409_1000515283 | 124 |
| 255 | 3300032002 | Ga0307416_100272545 | Ga0307416_1002725452 | 124 |
| 256 | 3300032004 | Ga0307414_10033658 | Ga0307414_100336582 | 124 |
| 257 | 3300032004 | Ga0307414_10887539 | Ga0307414_108875392 | 124 |
| 258 | 3300032005 | Ga0307411_10031794 | Ga0307411_100317943 | 124 |
| 259 | 3300032005 | Ga0307411_10093697 | Ga0307411_100936973 | 124 |
| 260 | 3300032005 | Ga0307411_10897367 | Ga0307411_108973671 | 124 |
| 261 | 3300032126 | Ga0307415_100008209 | Ga0307415_1000082094 | 124 |
| 262 | 3300032126 | Ga0307415_100419208 | Ga0307415_1004192082 | 124 |
| 263 | 3300041460 | Ga0451802_1376511 | Ga0451802_1376511_191_649 | 124 |
| 264 | 3300041494 | Ga0451837_0159455 | Ga0451837_0159455_430_891 | 124 |
| 265 | 3300041501 | Ga0451845_0052913 | Ga0451845_0052913_283_717 | 124 |
| 266 | 3300041505 | Ga0451849_0132430 | Ga0451849_0132430_66_524 | 124 |
| 267 | 3300041512 | Ga0451853_1096073 | Ga0451853_1096073_242_694 | 124 |
| 268 | 3300042016 | Ga0439463_090674 | Ga0439463_090674_65_502 | 124 |
| 269 | 3300044658 | Ga0466972_0374617 | Ga0466972_0374617_68_502 | 124 |
| 270 | 3300044683 | Ga0466965_0336832 | Ga0466965_0336832_373_813 | 124 |
| 271 | 3300044684 | Ga0466966_0435033 | Ga0466966_0435033_147_599 | 124 |
| 272 | 3300044694 | Ga0466963_0193996 | Ga0466963_0193996_957_1397 | 124 |
| 273 | 3300044694 | Ga0466963_0944702 | Ga0466963_0944702_66_506 | 124 |
| 274 | 3300044842 | Ga0466957_0705746 | Ga0466957_0705746_177_617 | 124 |
| 275 | 3300044901 | Ga0466960_0113881 | Ga0466960_0113881_217_663 | 124 |
| 276 | 3300045836 | Ga0466958_0446574 | Ga0466958_0446574_171_611 | 124 |
| 277 | 3300045976 | Ga0466967_0603365 | Ga0466967_0603365_509_949 | 124 |
| 278 | 3300045976 | Ga0466967_0910155 | Ga0466967_0910155_216_662 | 124 |
| 279 | 3300046463 | Ga0495653_0001336 | Ga0495653_0001336_12297_12761 | 124 |
| 280 | 3300046517 | Ga0495630_0873045 | Ga0495630_0873045_141_572 | 124 |
| 281 | 3300046616 | Ga0495668_0230278 | Ga0495668_0230278_287_865 | 124 |
| 282 | 3300046675 | Ga0495657_0023569 | Ga0495657_0023569_3287_3769 | 124 |
| 283 | 3300046683 | Ga0495658_0077000 | Ga0495658_0077000_1048_1533 | 124 |
| 284 | 3300047320 | Ga0495672_0016723 | Ga0495672_0016723_3589_4026 | 124 |
| 285 | 3300047447 | Ga0495685_159881 | Ga0495685_159881_109_552 | 124 |
| 286 | 3300048903 | Ga0496100_0110824 | Ga0496100_0110824_413_859 | 124 |
| 287 | 3300048904 | Ga0496101_0833888 | Ga0496101_0833888_118_564 | 124 |
| 288 | 3300048905 | Ga0496102_0059004 | Ga0496102_0059004_2940_3386 | 124 |
| 289 | 3300048905 | Ga0496102_0969718 | Ga0496102_0969718_46_462 | 124 |
| 290 | 3300048907 | Ga0496104_0068707 | Ga0496104_0068707_725_1168 | 124 |
| 291 | 3300048907 | Ga0496104_0089408 | Ga0496104_0089408_1692_2135 | 124 |
| 292 | 3300048908 | Ga0496105_0013426 | Ga0496105_0013426_5395_5838 | 124 |
| 293 | 3300048908 | Ga0496105_0196307 | Ga0496105_0196307_1013_1456 | 124 |
| 294 | 3300048910 | Ga0496107_0014072 | Ga0496107_0014072_2383_2829 | 124 |
| 295 | 3300048914 | Ga0496111_0091228 | Ga0496111_0091228_898_1338 | 124 |
| 296 | 3300048915 | Ga0496112_0000848 | Ga0496112_0000848_13206_13652 | 124 |
| 297 | 3300048915 | Ga0496112_0048051 | Ga0496112_0048051_1300_1743 | 124 |
| 298 | 3300048915 | Ga0496112_0355115 | Ga0496112_0355115_582_1022 | 124 |
| 299 | 3300048916 | Ga0496113_1020532 | Ga0496113_1020532_171_614 | 124 |
| 300 | 3300048918 | Ga0496115_0437547 | Ga0496115_0437547_284_727 | 124 |
| 301 | 3300049572 | Ga0501036_0904852 | Ga0501036_0904852_230_670 | 124 |
| 302 | 3300049581 | Ga0501047_0268588 | Ga0501047_0268588_669_1109 | 124 |
| 303 | 3300049741 | Ga0501079_0717755 | Ga0501079_0717755_316_717 | 124 |
| 304 | 3300049824 | Ga0501045_0839525 | Ga0501045_0839525_107_508 | 124 |
| 305 | 3300050510 | nmdc:mga06r32_1184375_c1 | nmdc:mga06r32_1184375_c1_180_620 | 124 |
| 306 | 3300050511 | nmdc:mga08y16_1047938_c1 | nmdc:mga08y16_1047938_c1_15_455 | 124 |
| 307 | 3300050511 | nmdc:mga08y16_30683_c1 | nmdc:mga08y16_30683_c1_1926_2366 | 124 |
| 308 | 3300060353 | Ga0501082_0971201 | Ga0501082_0971201_208_642 | 124 |
| 309 | 3300061719 | Ga0466962_0520905 | Ga0466962_0520905_109_549 | 124 |
| 310 | 3300005327 | Ga0070658_10106507 | Ga0070658_101065072 | 125 |
| 311 | 3300005329 | Ga0070683_100089868 | Ga0070683_1000898682 | 125 |
| 312 | 3300005336 | Ga0070680_100011130 | Ga0070680_1000111304 | 125 |
| 313 | 3300005337 | Ga0070682_100036178 | Ga0070682_1000361782 | 125 |
| 314 | 3300005341 | Ga0070691_10195647 | Ga0070691_101956472 | 125 |
| 315 | 3300005344 | Ga0070661_100003576 | Ga0070661_1000035762 | 125 |
| 316 | 3300005356 | Ga0070674_100062221 | Ga0070674_1000622212 | 125 |
| 317 | 3300005366 | Ga0070659_100042892 | Ga0070659_1000428923 | 125 |
| 318 | 3300005441 | Ga0070700_100097517 | Ga0070700_1000975173 | 125 |
| 319 | 3300005455 | Ga0070663_100526355 | Ga0070663_1005263552 | 125 |
| 320 | 3300005458 | Ga0070681_10061396 | Ga0070681_100613963 | 125 |
| 321 | 3300005459 | Ga0068867_100255124 | Ga0068867_1002551242 | 125 |
| 322 | 3300005530 | Ga0070679_100020197 | Ga0070679_1000201977 | 125 |
| 323 | 3300005535 | Ga0070684_100001851 | Ga0070684_10000185111 | 125 |
| 324 | 3300005539 | Ga0068853_100310344 | Ga0068853_1003103442 | 125 |
| 325 | 3300005564 | Ga0070664_100739022 | Ga0070664_1007390222 | 125 |
| 326 | 3300005577 | Ga0068857_100024451 | Ga0068857_1000244514 | 125 |
| 327 | 3300005614 | Ga0068856_100066185 | Ga0068856_1000661854 | 125 |
| 328 | 3300005616 | Ga0068852_100021413 | Ga0068852_1000214136 | 125 |
| 329 | 3300006028 | Ga0070717_10000204 | Ga0070717_1000020431 | 125 |
| 330 | 3300006358 | Ga0068871_101153453 | Ga0068871_1011534532 | 125 |
| 331 | 3300006844 | Ga0075428_100044156 | Ga0075428_1000441564 | 125 |
| 332 | 3300006846 | Ga0075430_100037116 | Ga0075430_1000371162 | 125 |
| 333 | 3300006847 | Ga0075431_100042067 | Ga0075431_1000420674 | 125 |
| 334 | 3300006880 | Ga0075429_100008016 | Ga0075429_1000080166 | 125 |
| 335 | 3300009147 | Ga0114129_10563426 | Ga0114129_105634262 | 125 |
| 336 | 3300009147 | Ga0114129_11664372 | Ga0114129_116643722 | 125 |
| 337 | 3300009176 | Ga0105242_12659523 | Ga0105242_126595231 | 125 |
| 338 | 3300009545 | Ga0105237_10077213 | Ga0105237_100772134 | 125 |
| 339 | 3300010375 | Ga0105239_10216614 | Ga0105239_102166142 | 125 |
| 340 | 3300013102 | Ga0157371_10334907 | Ga0157371_103349072 | 125 |
| 341 | 3300013102 | Ga0157371_11387609 | Ga0157371_113876091 | 125 |
| 342 | 3300013104 | Ga0157370_10025457 | Ga0157370_100254573 | 125 |
| 343 | 3300013105 | Ga0157369_10016156 | Ga0157369_100161562 | 125 |
| 344 | 3300013307 | Ga0157372_10042061 | Ga0157372_100420613 | 125 |
| 345 | 3300020070 | Ga0206356_10524050 | Ga0206356_105240502 | 125 |
| 346 | 3300020081 | Ga0206354_11624061 | Ga0206354_116240612 | 125 |
| 347 | 3300020082 | Ga0206353_11748275 | Ga0206353_117482753 | 125 |
| 348 | 3300025899 | Ga0207642_10251870 | Ga0207642_102518701 | 125 |
| 349 | 3300025901 | Ga0207688_10386807 | Ga0207688_103868072 | 125 |
| 350 | 3300025909 | Ga0207705_10074116 | Ga0207705_100741163 | 125 |
| 351 | 3300025912 | Ga0207707_10076266 | Ga0207707_100762664 | 125 |
| 352 | 3300025913 | Ga0207695_10359130 | Ga0207695_103591301 | 125 |
| 353 | 3300025914 | Ga0207671_10042415 | Ga0207671_100424155 | 125 |
| 354 | 3300025919 | Ga0207657_10027895 | Ga0207657_100278953 | 125 |
| 355 | 3300025920 | Ga0207649_10067077 | Ga0207649_100670772 | 125 |
| 356 | 3300025920 | Ga0207649_10429889 | Ga0207649_104298892 | 125 |
| 357 | 3300025921 | Ga0207652_10058845 | Ga0207652_100588453 | 125 |
| 358 | 3300025932 | Ga0207690_10038870 | Ga0207690_100388702 | 125 |
| 359 | 3300025937 | Ga0207669_10757132 | Ga0207669_107571322 | 125 |
| 360 | 3300025944 | Ga0207661_10002565 | Ga0207661_100025657 | 125 |
| 361 | 3300025945 | Ga0207679_10635493 | Ga0207679_106354931 | 125 |
| 362 | 3300025972 | Ga0207668_10200957 | Ga0207668_102009572 | 125 |
| 363 | 3300026023 | Ga0207677_10756071 | Ga0207677_107560712 | 125 |
| 364 | 3300026041 | Ga0207639_10034935 | Ga0207639_100349353 | 125 |
| 365 | 3300026067 | Ga0207678_10913378 | Ga0207678_109133781 | 125 |
| 366 | 3300026075 | Ga0207708_10641304 | Ga0207708_106413042 | 125 |
| 367 | 3300026078 | Ga0207702_10035724 | Ga0207702_100357242 | 125 |
| 368 | 3300026116 | Ga0207674_10060700 | Ga0207674_100607003 | 125 |
| 369 | 3300026142 | Ga0207698_10279602 | Ga0207698_102796022 | 125 |
| 370 | 3300028379 | Ga0268266_10458140 | Ga0268266_104581402 | 125 |
| 371 | 3300031824 | Ga0307413_10170784 | Ga0307413_101707842 | 125 |
| 372 | 3300031852 | Ga0307410_10952133 | Ga0307410_109521332 | 125 |
| 373 | 3300031901 | Ga0307406_11512038 | Ga0307406_115120381 | 125 |
| 374 | 3300031903 | Ga0307407_10296488 | Ga0307407_102964882 | 125 |
| 375 | 3300031995 | Ga0307409_100024015 | Ga0307409_1000240153 | 125 |
| 376 | 3300031995 | Ga0307409_100116564 | Ga0307409_1001165643 | 125 |
| 377 | 3300031995 | Ga0307409_100258278 | Ga0307409_1002582783 | 125 |
| 378 | 3300032002 | Ga0307416_100193769 | Ga0307416_1001937692 | 125 |
| 379 | 3300032002 | Ga0307416_100569022 | Ga0307416_1005690222 | 125 |
| 380 | 3300032002 | Ga0307416_101134002 | Ga0307416_1011340022 | 125 |
| 381 | 3300032004 | Ga0307414_10619279 | Ga0307414_106192792 | 125 |
| 382 | 3300032126 | Ga0307415_100219099 | Ga0307415_1002190992 | 125 |
| 383 | 3300032126 | Ga0307415_101249125 | Ga0307415_1012491251 | 125 |
| 384 | 3300037466 | Ga0395898_1391522 | Ga0395898_1391522_84_527 | 125 |
| 385 | 3300038443 | Ga0395901_1890620 | Ga0395901_1890620_60_503 | 125 |
| 386 | 3300042532 | Ga0450893_0047756 | Ga0450893_0047756_221_661 | 125 |
| 387 | 3300044693 | Ga0466961_0090881 | Ga0466961_0090881_856_1299 | 125 |
| 388 | 3300044694 | Ga0466963_0275453 | Ga0466963_0275453_672_1112 | 125 |
| 389 | 3300044719 | Ga0466971_0043933 | Ga0466971_0043933_433_861 | 125 |
| 390 | 3300044765 | Ga0466970_0092181 | Ga0466970_0092181_637_1089 | 125 |
| 391 | 3300044765 | Ga0466970_0107630 | Ga0466970_0107630_591_1034 | 125 |
| 392 | 3300045976 | Ga0466967_0157440 | Ga0466967_0157440_1487_1921 | 125 |
| 393 | 3300046455 | Ga0495603_0436353 | Ga0495603_0436353_194_637 | 125 |
| 394 | 3300048924 | Ga0496121_0038003 | Ga0496121_0038003_1066_1530 | 125 |
| 395 | 3300049568 | Ga0501031_0164255 | Ga0501031_0164255_543_974 | 125 |
| 396 | 3300049568 | Ga0501031_0342457 | Ga0501031_0342457_116_529 | 125 |
| 397 | 3300049570 | Ga0501033_0124920 | Ga0501033_0124920_396_833 | 125 |
| 398 | 3300049570 | Ga0501033_0558794 | Ga0501033_0558794_221_658 | 125 |
| 399 | 3300049572 | Ga0501036_0064942 | Ga0501036_0064942_1808_2239 | 125 |
| 400 | 3300049572 | Ga0501036_0551674 | Ga0501036_0551674_457_894 | 125 |
| 401 | 3300049573 | Ga0501037_0253214 | Ga0501037_0253214_574_1005 | 125 |
| 402 | 3300049574 | Ga0501038_0112952 | Ga0501038_0112952_778_1215 | 125 |
| 403 | 3300049574 | Ga0501038_0155936 | Ga0501038_0155936_56_493 | 125 |
| 404 | 3300049575 | Ga0501039_0024585 | Ga0501039_0024585_3161_3592 | 125 |
| 405 | 3300049576 | Ga0501040_0323834 | Ga0501040_0323834_10_441 | 125 |
| 406 | 3300049577 | Ga0501041_0030356 | Ga0501041_0030356_2166_2597 | 125 |
| 407 | 3300049578 | Ga0501042_0032100 | Ga0501042_0032100_837_1274 | 125 |
| 408 | 3300049578 | Ga0501042_0131604 | Ga0501042_0131604_756_1187 | 125 |
| 409 | 3300049578 | Ga0501042_0815248 | Ga0501042_0815248_86_499 | 125 |
| 410 | 3300049579 | Ga0501043_0127000 | Ga0501043_0127000_1097_1534 | 125 |
| 411 | 3300049582 | Ga0501048_0464796 | Ga0501048_0464796_391_828 | 125 |
| 412 | 3300049582 | Ga0501048_0652745 | Ga0501048_0652745_238_651 | 125 |
| 413 | 3300049587 | Ga0501071_0014945 | Ga0501071_0014945_4046_4483 | 125 |
| 414 | 3300049587 | Ga0501071_0086996 | Ga0501071_0086996_964_1401 | 125 |
| 415 | 3300049587 | Ga0501071_0130404 | Ga0501071_0130404_201_614 | 125 |
| 416 | 3300049588 | Ga0501072_0051700 | Ga0501072_0051700_1977_2408 | 125 |
| 417 | 3300049588 | Ga0501072_0300886 | Ga0501072_0300886_587_1000 | 125 |
| 418 | 3300049589 | Ga0501073_0422832 | Ga0501073_0422832_45_482 | 125 |
| 419 | 3300049590 | Ga0501074_0134749 | Ga0501074_0134749_724_1155 | 125 |
| 420 | 3300049591 | Ga0501075_0070001 | Ga0501075_0070001_860_1273 | 125 |
| 421 | 3300049592 | Ga0501076_0237771 | Ga0501076_0237771_220_657 | 125 |
| 422 | 3300049592 | Ga0501076_0347763 | Ga0501076_0347763_79_516 | 125 |
| 423 | 3300049593 | Ga0501077_0241477 | Ga0501077_0241477_697_1134 | 125 |
| 424 | 3300049741 | Ga0501079_0084818 | Ga0501079_0084818_1662_2093 | 125 |
| 425 | 3300049741 | Ga0501079_0162035 | Ga0501079_0162035_1058_1495 | 125 |
| 426 | 3300049742 | Ga0501080_0303149 | Ga0501080_0303149_258_695 | 125 |
| 427 | 3300049742 | Ga0501080_0331173 | Ga0501080_0331173_839_1276 | 125 |
| 428 | 3300049743 | Ga0501081_0499803 | Ga0501081_0499803_195_608 | 125 |
| 429 | 3300049744 | Ga0501083_0389687 | Ga0501083_0389687_105_542 | 125 |
| 430 | 3300049744 | Ga0501083_0531376 | Ga0501083_0531376_28_465 | 125 |
| 431 | 3300049822 | Ga0501035_0299932 | Ga0501035_0299932_415_852 | 125 |
| 432 | 3300049823 | Ga0501044_0593793 | Ga0501044_0593793_319_756 | 125 |
| 433 | 3300049824 | Ga0501045_0144940 | Ga0501045_0144940_308_745 | 125 |
| 434 | 3300049824 | Ga0501045_0494779 | Ga0501045_0494779_45_458 | 125 |
| 435 | 3300050507 | nmdc:mga05p37_382397_c1 | nmdc:mga05p37_382397_c1_647_1060 | 125 |
| 436 | 3300050508 | nmdc:mga09592_3695_c2 | nmdc:mga09592_3695_c2_8390_8803 | 125 |
| 437 | 3300050509 | nmdc:mga0qj67_32719_c1 | nmdc:mga0qj67_32719_c1_1804_2217 | 125 |
| 438 | 3300050510 | nmdc:mga06r32_67635_c1 | nmdc:mga06r32_67635_c1_2626_3039 | 125 |
| 439 | 3300054114 | Ga0501084_0261448 | Ga0501084_0261448_812_1243 | 125 |
| 440 | 3300054114 | Ga0501084_0291071 | Ga0501084_0291071_165_602 | 125 |
| 441 | 3300054114 | Ga0501084_0612899 | Ga0501084_0612899_117_554 | 125 |
| 442 | 3300054114 | Ga0501084_1606925 | Ga0501084_1606925_51_488 | 125 |
| 443 | 3300059423 | Ga0590074_048393 | Ga0590074_048393_154_588 | 125 |
| 444 | 3300060353 | Ga0501082_0198826 | Ga0501082_0198826_332_745 | 125 |
| 445 | 3300060353 | Ga0501082_0332312 | Ga0501082_0332312_632_1069 | 125 |
| 446 | 3300060353 | Ga0501082_0684442 | Ga0501082_0684442_85_522 | 125 |
| 447 | 3300060353 | Ga0501082_0739386 | Ga0501082_0739386_157_588 | 125 |
| 448 | 3300060353 | Ga0501082_0834793 | Ga0501082_0834793_61_498 | 125 |
| 449 | 3300061719 | Ga0466962_0070727 | Ga0466962_0070727_810_1238 | 125 |
| 450 | 3300061734 | Ga0530510_0016156 | Ga0530510_0016156_29_466 | 125 |
| 451 | 3300061734 | Ga0530510_0100423 | Ga0530510_0100423_73_504 | 125 |
| 452 | 3300061734 | Ga0530510_0182771 | Ga0530510_0182771_1076_1513 | 125 |
| 453 | 3300061734 | Ga0530510_0971630 | Ga0530510_0971630_116_529 | 125 |
| 454 | 3300005345 | Ga0070692_10960997 | Ga0070692_109609971 | 126 |
| 455 | 3300005366 | Ga0070659_100272044 | Ga0070659_1002720442 | 126 |
| 456 | 3300005455 | Ga0070663_100951065 | Ga0070663_1009510652 | 126 |
| 457 | 3300005466 | Ga0070685_10062869 | Ga0070685_100628692 | 126 |
| 458 | 3300005535 | Ga0070684_100141023 | Ga0070684_1001410233 | 126 |
| 459 | 3300005544 | Ga0070686_100384943 | Ga0070686_1003849432 | 126 |
| 460 | 3300005578 | Ga0068854_100234754 | Ga0068854_1002347542 | 126 |
| 461 | 3300005615 | Ga0070702_100634647 | Ga0070702_1006346471 | 126 |
| 462 | 3300005616 | Ga0068852_100081129 | Ga0068852_1000811295 | 126 |
| 463 | 3300005718 | Ga0068866_10074974 | Ga0068866_100749742 | 126 |
| 464 | 3300005834 | Ga0068851_10261910 | Ga0068851_102619102 | 126 |
| 465 | 3300005981 | Ga0081538_10203046 | Ga0081538_102030462 | 126 |
| 466 | 3300006881 | Ga0068865_100199222 | Ga0068865_1001992222 | 126 |
| 467 | 3300006881 | Ga0068865_100598333 | Ga0068865_1005983332 | 126 |
| 468 | 3300009174 | Ga0105241_11718317 | Ga0105241_117183171 | 126 |
| 469 | 3300013307 | Ga0157372_10708461 | Ga0157372_107084612 | 126 |
| 470 | 3300014325 | Ga0163163_11228628 | Ga0163163_112286282 | 126 |
| 471 | 3300014745 | Ga0157377_10222026 | Ga0157377_102220261 | 126 |
| 472 | 3300025899 | Ga0207642_10313072 | Ga0207642_103130722 | 126 |
| 473 | 3300025908 | Ga0207643_10089427 | Ga0207643_100894273 | 126 |
| 474 | 3300025923 | Ga0207681_10191312 | Ga0207681_101913122 | 126 |
| 475 | 3300025942 | Ga0207689_10578316 | Ga0207689_105783162 | 126 |
| 476 | 3300025944 | Ga0207661_10959205 | Ga0207661_109592052 | 126 |
| 477 | 3300025981 | Ga0207640_10588998 | Ga0207640_105889982 | 126 |
| 478 | 3300034819 | Ga0373958_0058167 | Ga0373958_0058167_31_471 | 126 |
| 479 | 3300042009 | Ga0439451_129331 | Ga0439451_129331_25_471 | 126 |
| 480 | 3300042011 | Ga0439454_011991 | Ga0439454_011991_317_763 | 126 |
| 481 | 3300042120 | Ga0450917_001796 | Ga0450917_001796_457_906 | 126 |
| 482 | 3300042157 | Ga0439458_0042077 | Ga0439458_0042077_83_532 | 126 |
| 483 | 3300042439 | Ga0439464_0167416 | Ga0439464_0167416_98_547 | 126 |
| 484 | 3300042461 | Ga0439460_0092358 | Ga0439460_0092358_101_550 | 126 |
| 485 | 3300046457 | Ga0495590_0319154 | Ga0495590_0319154_91_528 | 126 |
| 486 | 3300046500 | Ga0495596_0155880 | Ga0495596_0155880_262_702 | 126 |
| 487 | 3300046522 | Ga0495643_0250533 | Ga0495643_0250533_259_699 | 126 |
| 488 | 3300046615 | Ga0495656_0053931 | Ga0495656_0053931_685_1125 | 126 |
| 489 | 3300046694 | Ga0495649_0455551 | Ga0495649_0455551_92_532 | 126 |
| 490 | 3300046794 | Ga0495589_0155531 | Ga0495589_0155531_505_945 | 126 |
| 491 | 3300047445 | Ga0495677_0267053 | Ga0495677_0267053_186_626 | 126 |
| 492 | 3300047472 | Ga0495686_0307509 | Ga0495686_0307509_59_526 | 126 |
| 493 | 3300048906 | Ga0496103_0352140 | Ga0496103_0352140_198_641 | 126 |
| 494 | 3300048907 | Ga0496104_0909719 | Ga0496104_0909719_257_709 | 126 |
| 495 | 3300048915 | Ga0496112_0065235 | Ga0496112_0065235_2632_3099 | 126 |
| 496 | 3300048916 | Ga0496113_0037888 | Ga0496113_0037888_1633_2100 | 126 |
| 497 | 3300048917 | Ga0496114_1270873 | Ga0496114_1270873_128_568 | 126 |
| 498 | 3300048927 | Ga0496124_0059124 | Ga0496124_0059124_2516_2968 | 126 |
| 499 | 3300048929 | Ga0496126_0260656 | Ga0496126_0260656_309_740 | 126 |
| 500 | 3300049590 | Ga0501074_1165306 | Ga0501074_1165306_83_529 | 126 |
| 501 | 3300050508 | nmdc:mga09592_1365615_c1 | nmdc:mga09592_1365615_c1_129_563 | 126 |
| 502 | 3300050508 | nmdc:mga09592_702483_c1 | nmdc:mga09592_702483_c1_304_744 | 126 |
| 503 | 3300050511 | nmdc:mga08y16_489840_c1 | nmdc:mga08y16_489840_c1_425_865 | 126 |
| 504 | 3300053083 | Ga0495655_0207360 | Ga0495655_0207360_163_606 | 126 |
| 505 | 3300006173 | Ga0070716_101091069 | Ga0070716_1010910691 | 127 |
| 506 | 3300006175 | Ga0070712_100001989 | Ga0070712_1000019895 | 127 |
| 507 | 3300025915 | Ga0207693_10003339 | Ga0207693_1000333912 | 127 |
| 508 | 3300025936 | Ga0207670_10207786 | Ga0207670_102077862 | 127 |
| 509 | 3300025944 | Ga0207661_10371391 | Ga0207661_103713912 | 127 |
| 510 | 3300025981 | Ga0207640_10414098 | Ga0207640_104140982 | 127 |
| 511 | 3300028654 | Ga0265322_10085177 | Ga0265322_100851772 | 127 |
| 512 | 3300028800 | Ga0265338_10016147 | Ga0265338_100161477 | 127 |
| 513 | 3300031901 | Ga0307406_10149981 | Ga0307406_101499812 | 127 |
| 514 | 3300037418 | Ga0395900_0441974 | Ga0395900_0441974_11_475 | 127 |
| 515 | 3300037471 | Ga0395905_0362688 | Ga0395905_0362688_611_1078 | 127 |
| 516 | 3300038443 | Ga0395901_0213804 | Ga0395901_0213804_943_1407 | 127 |
| 517 | 3300044658 | Ga0466972_0134075 | Ga0466972_0134075_168_620 | 127 |
| 518 | 3300044684 | Ga0466966_0327557 | Ga0466966_0327557_197_646 | 127 |
| 519 | 3300044693 | Ga0466961_0049561 | Ga0466961_0049561_1601_2050 | 127 |
| 520 | 3300046477 | Ga0495664_0001128 | Ga0495664_0001128_4836_5327 | 127 |
| 521 | 3300046529 | Ga0495652_0280897 | Ga0495652_0280897_561_1052 | 127 |
| 522 | 3300046615 | Ga0495656_0107603 | Ga0495656_0107603_405_854 | 127 |
| 523 | 3300046809 | Ga0495600_0003671 | Ga0495600_0003671_2965_3456 | 127 |
| 524 | 3300047317 | Ga0495604_0000144 | Ga0495604_0000144_1503_2018 | 127 |
| 525 | 3300048905 | Ga0496102_0000076 | Ga0496102_0000076_58564_59055 | 127 |
| 526 | 3300048906 | Ga0496103_0000367 | Ga0496103_0000367_282_773 | 127 |
| 527 | 3300048913 | Ga0496110_0750926 | Ga0496110_0750926_311_772 | 127 |
| 528 | 3300048917 | Ga0496114_0058459 | Ga0496114_0058459_1315_1743 | 127 |
| 529 | 3300049577 | Ga0501041_0185212 | Ga0501041_0185212_501_920 | 127 |
| 530 | 3300050492 | nmdc:mga0yw44_1036288_c1 | nmdc:mga0yw44_1036288_c1_81_506 | 127 |
| 531 | 3300053077 | Ga0495601_0118672 | Ga0495601_0118672_86_577 | 127 |
| 532 | 3300005981 | Ga0081538_10009306 | Ga0081538_100093064 | 128 |
| 533 | 3300005981 | Ga0081538_10012436 | Ga0081538_100124365 | 128 |
| 534 | 3300009093 | Ga0105240_10532049 | Ga0105240_105320492 | 128 |
| 535 | 3300025923 | Ga0207681_10025691 | Ga0207681_100256915 | 128 |
| 536 | 3300028573 | Ga0265334_10215867 | Ga0265334_102158672 | 128 |
| 537 | 3300028800 | Ga0265338_10273271 | Ga0265338_102732712 | 128 |
| 538 | 3300039450 | Ga0436363_1508741 | Ga0436363_1508741_160_591 | 128 |
| 539 | 3300042438 | Ga0439459_0166096 | Ga0439459_0166096_31_471 | 128 |
| 540 | 3300042461 | Ga0439460_0165082 | Ga0439460_0165082_209_649 | 128 |
| 541 | 3300046691 | Ga0495670_0562605 | Ga0495670_0562605_145_597 | 128 |
| 542 | 3300048911 | Ga0496108_0318919 | Ga0496108_0318919_313_762 | 128 |
| 543 | 3300048916 | Ga0496113_0528094 | Ga0496113_0528094_149_598 | 128 |
| 544 | 3300059421 | Ga0590071_132498 | Ga0590071_132498_161_595 | 128 |
| 545 | 3300005981 | Ga0081538_10181542 | Ga0081538_101815422 | 129 |
| 546 | 3300046461 | Ga0495641_0261773 | Ga0495641_0261773_346_765 | 129 |
| 547 | 3300047321 | Ga0495676_0347653 | Ga0495676_0347653_253_672 | 129 |
| 548 | 3300009093 | Ga0105240_10009093 | Ga0105240_100090935 | 130 |
| 549 | 3300048907 | Ga0496104_0000034 | Ga0496104_0000034_125321_125830 | 130 |
| 550 | 3300048913 | Ga0496110_0002022 | Ga0496110_0002022_1577_2086 | 130 |
| 551 | 3300048914 | Ga0496111_0001077 | Ga0496111_0001077_1581_2090 | 130 |
| 552 | 3300005981 | Ga0081538_10002778 | Ga0081538_1000277817 | 131 |
| 553 | 3300038443 | Ga0395901_0778790 | Ga0395901_0778790_231_698 | 131 |
| 554 | 3300003373 | JGI25407J50210_10003360 | JGI25407J50210_100033606 | 132 |
| 555 | 3300005981 | Ga0081538_10000171 | Ga0081538_1000017134 | 132 |
| 556 | 3300028563 | Ga0265319_1000093 | Ga0265319_100009324 | 132 |
| 557 | 3300048917 | Ga0496114_1035116 | Ga0496114_1035116_73_528 | 132 |
| 558 | 3300049576 | Ga0501040_0160086 | Ga0501040_0160086_717_1157 | 132 |
| 559 | 3300049587 | Ga0501071_0201263 | Ga0501071_0201263_299_739 | 132 |
| 560 | 3300049588 | Ga0501072_0078276 | Ga0501072_0078276_1521_1961 | 132 |
| 561 | 3300049591 | Ga0501075_0087016 | Ga0501075_0087016_860_1300 | 132 |
| 562 | 3300049741 | Ga0501079_0263116 | Ga0501079_0263116_440_880 | 132 |
| 563 | 3300049743 | Ga0501081_0078034 | Ga0501081_0078034_1187_1627 | 132 |
| 564 | 3300054114 | Ga0501084_0236975 | Ga0501084_0236975_1074_1514 | 132 |
| 565 | 3300060353 | Ga0501082_0102730 | Ga0501082_0102730_1397_1837 | 132 |
| 566 | 3300000549 | LJQas_1008877 | LJQas_10088772 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sql-assembly2.cif.gz_L | crystal structure of 7,8-dihydroneopterin aldolase in complex with guanine | 0.8595 | 18 | 133 |
| 3o1k-assembly1.cif.gz_B | crystal structure of putative dihydroneopterin aldolase (folb) from vibrio cholerae o1 biovar el tor str. n16961 | 0.8547 | 18 | 133 |
| 5f3m-assembly1.cif.gz_A | crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . | 0.8535 | 18 | 133 |
| 7su6-assembly1.cif.gz_C | dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin | 0.8505 | 18 | 133 |
| 7su6-assembly1.cif.gz_A-2 | dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin | 0.85 | 18 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0J0C6_26_148_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8616 | 18 | 132 | 3.30.1130.10 |
| 2nm2B00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8571 | 16 | 132 | 3.30.1130.10 |
| 2cg8A01 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8464 | 18 | 133 | 3.30.1130.10 |
| 5farH00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8451 | 18 | 133 | 3.30.1130.10 |
| 2o9mC00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8369 | 18 | 132 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3BJ33-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.8975 | 18 | 133 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A7V9RII7-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.8968 | 18 | 132 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A1Q7X116-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.894 | 18 | 133 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-S9ZS14-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.892 | 18 | 133 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A7M2YX50-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.8916 | 18 | 133 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar