F464436

General Info

Members Datasets Scaffolds Average Seq Length
566 282 566 133

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0230278|Ga0495668_0230278_287_865
Length 159
Sequence LERVNLRDRLHRPNLSIAEGLGGEYAGENMSDEKPELPADDQRPETGLSVYTHHGVTAAEREIGQRLVLDVRFDVGEPDALITDRVEDTIDYGEVCQVIALIAQQRSYKTLERLCAVIADRLATQFGAESVTVKAAKPEPPIPLPVEEVSVEVWREERP

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
164 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
165 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
166 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 10.6
Rhizosphere 87.63
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1008877 3300000549 Bacteria 1216
2 LJQas_1030268 3300000549 Bacteria 633
3 JGI25407J50210_10003360 3300003373 Bacteria 3819
4 JGI25407J50210_10031613 3300003373 Bacteria 1370
5 Ga0070658_10106507 3300005327 Bacteria 2320
6 Ga0070676_10249135 3300005328 Bacteria 1185
7 Ga0070683_100089868 3300005329 Bacteria 2883
8 Ga0070683_100424399 3300005329 Bacteria 1269
9 Ga0070670_100996850 3300005331 Bacteria 762
10 Ga0070680_100011130 3300005336 Bacteria 6955
11 Ga0070682_100036178 3300005337 Bacteria 3017
12 Ga0070682_100742291 3300005337 Bacteria 792
13 Ga0070682_100746146 3300005337 Bacteria 790
14 Ga0068868_100289784 3300005338 Bacteria 1388
15 Ga0070660_100771662 3300005339 Bacteria 808
16 Ga0070691_10195647 3300005341 Bacteria 1060
17 Ga0070687_100168391 3300005343 Bacteria 1302
18 Ga0070687_100364368 3300005343 Bacteria 937
19 Ga0070661_100003576 3300005344 Bacteria 10695
20 Ga0070661_100300793 3300005344 Bacteria 1249
21 Ga0070661_101112438 3300005344 Bacteria 658
22 Ga0070692_10140470 3300005345 Bacteria 1366
23 Ga0070692_10287064 3300005345 Bacteria 1000
24 Ga0070692_10960997 3300005345 Bacteria 595
25 Ga0070692_10979564 3300005345 Bacteria 590
26 Ga0070668_100152622 3300005347 Bacteria 1869
27 Ga0070668_100288096 3300005347 Bacteria 1374
28 Ga0070674_100062221 3300005356 Bacteria 2608
29 Ga0070674_100320375 3300005356 Bacteria 1243
30 Ga0070674_100322733 3300005356 Bacteria 1238
31 Ga0070673_100841533 3300005364 Bacteria 849
32 Ga0070659_100042892 3300005366 Bacteria 3537
33 Ga0070659_100272044 3300005366 Bacteria 1408
34 Ga0070714_100001858 3300005435 Bacteria 15374
35 Ga0070714_100056010 3300005435 Bacteria 3371
36 Ga0070714_100192946 3300005435 Bacteria 1860
37 Ga0070700_100047515 3300005441 Bacteria 2656
38 Ga0070700_100097517 3300005441 Bacteria 1931
39 Ga0070663_100526355 3300005455 Bacteria 985
40 Ga0070663_100951065 3300005455 Bacteria 745
41 Ga0070662_100031509 3300005457 Bacteria 3722
42 Ga0070681_10061396 3300005458 Bacteria 3733
43 Ga0068867_100255124 3300005459 Bacteria 1428
44 Ga0068867_100764321 3300005459 Bacteria 859
45 Ga0068867_101724778 3300005459 Bacteria 588
46 Ga0070685_10062869 3300005466 Bacteria 2178
47 Ga0070698_101653693 3300005471 Bacteria 593
48 Ga0070679_100020197 3300005530 Bacteria 6493
49 Ga0070679_100679980 3300005530 Bacteria 972
50 Ga0070684_100001851 3300005535 Bacteria 15491
51 Ga0070684_100141023 3300005535 Bacteria 2180
52 Ga0068853_100310344 3300005539 Bacteria 1460
53 Ga0068853_101133260 3300005539 Bacteria 755
54 Ga0070672_100205811 3300005543 Bacteria 1647
55 Ga0070686_100384943 3300005544 Bacteria 1063
56 Ga0070696_100131145 3300005546 Bacteria 1824
57 Ga0070693_100196756 3300005547 Bacteria 1307
58 Ga0070704_100127148 3300005549 Bacteria 1968
59 Ga0068855_101637900 3300005563 Bacteria 658
60 Ga0070664_100092298 3300005564 Bacteria 2621
61 Ga0070664_100739022 3300005564 Bacteria 918
62 Ga0070664_100768970 3300005564 Bacteria 900
63 Ga0068857_100024451 3300005577 Bacteria 5318
64 Ga0068857_101361830 3300005577 Bacteria 690
65 Ga0068854_100234754 3300005578 Bacteria 1457
66 Ga0068856_100066185 3300005614 Bacteria 3571
67 Ga0068856_100309695 3300005614 Bacteria 1597
68 Ga0068856_101863315 3300005614 Bacteria 613
69 Ga0070702_100526707 3300005615 Bacteria 873
70 Ga0070702_100634647 3300005615 Bacteria 806
71 Ga0068852_100021413 3300005616 Bacteria 5162
72 Ga0068852_100081129 3300005616 Bacteria 2878
73 Ga0068864_101643751 3300005618 Bacteria 647
74 Ga0068866_10074974 3300005718 Bacteria 1800
75 Ga0068851_10261910 3300005834 Bacteria 984
76 Ga0068870_10651316 3300005840 Bacteria 722
77 Ga0068863_100579041 3300005841 Bacteria 1110
78 Ga0068863_100898717 3300005841 Bacteria 886
79 Ga0068860_101219579 3300005843 Bacteria 773
80 Ga0068862_100308420 3300005844 Bacteria 1458
81 Ga0081455_10082585 3300005937 Bacteria 2628
82 Ga0081455_10221488 3300005937 Bacteria 1402
83 Ga0081538_10000171 3300005981 Bacteria 69552
84 Ga0081538_10002778 3300005981 Bacteria 16774
85 Ga0081538_10003555 3300005981 Bacteria 14663
86 Ga0081538_10009306 3300005981 Bacteria 8219
87 Ga0081538_10012436 3300005981 Bacteria 6820
88 Ga0081538_10181542 3300005981 Bacteria 899
89 Ga0081538_10203046 3300005981 Bacteria 811
90 Ga0081539_10012516 3300005985 Bacteria 6527
91 Ga0070717_10000204 3300006028 Bacteria 41488
92 Ga0070716_101091069 3300006173 Bacteria 636
93 Ga0070712_100001989 3300006175 Bacteria 12514
94 Ga0068871_101153453 3300006358 Bacteria 726
95 Ga0075428_100044156 3300006844 Bacteria 4898
96 Ga0075428_100882859 3300006844 Bacteria 949
97 Ga0075430_100022193 3300006846 Bacteria 5397
98 Ga0075430_100037116 3300006846 Bacteria 4131
99 Ga0075430_100367473 3300006846 Bacteria 1188
100 Ga0075430_101501543 3300006846 Bacteria 554
101 Ga0075431_100020434 3300006847 Bacteria 6765
102 Ga0075431_100042067 3300006847 Bacteria 4712
103 Ga0075431_101328298 3300006847 Bacteria 680
104 Ga0075429_100008016 3300006880 Bacteria 9176
105 Ga0075429_100022138 3300006880 Bacteria 5513
106 Ga0075429_100669000 3300006880 Bacteria 910
107 Ga0068865_100199222 3300006881 Bacteria 1554
108 Ga0068865_100328964 3300006881 Bacteria 1232
109 Ga0068865_100598333 3300006881 Bacteria 932
110 Ga0105240_10009093 3300009093 Bacteria 14105
111 Ga0105240_10532049 3300009093 Bacteria 1303
112 Ga0105240_11098695 3300009093 Bacteria 846
113 Ga0111539_10773529 3300009094 Bacteria 1117
114 Ga0111539_10781737 3300009094 Bacteria 1111
115 Ga0111539_12601505 3300009094 Bacteria 587
116 Ga0105245_10112556 3300009098 Bacteria 2533
117 Ga0105245_10601039 3300009098 Bacteria 1126
118 Ga0105245_10606399 3300009098 Bacteria 1122
119 Ga0105247_10963184 3300009101 Bacteria 663
120 Ga0114129_10273189 3300009147 Bacteria 2261
121 Ga0114129_10563426 3300009147 Bacteria 1480
122 Ga0114129_10755453 3300009147 Bacteria 1244
123 Ga0114129_11664372 3300009147 Bacteria 780
124 Ga0105243_10115568 3300009148 Bacteria 2253
125 Ga0105243_10524364 3300009148 Bacteria 1127
126 Ga0105243_10569189 3300009148 Bacteria 1086
127 Ga0105241_10928292 3300009174 Bacteria 810
128 Ga0105241_11718317 3300009174 Unclassified 610
129 Ga0105242_10168616 3300009176 Bacteria 1922
130 Ga0105242_10372913 3300009176 Bacteria 1324
131 Ga0105242_11070793 3300009176 Bacteria 818
132 Ga0105242_12131891 3300009176 Bacteria 605
133 Ga0105242_12659523 3300009176 Bacteria 550
134 Ga0105237_10077213 3300009545 Bacteria 3321
135 Ga0105238_10978142 3300009551 Bacteria 867
136 Ga0105249_10386778 3300009553 Bacteria 1426
137 Ga0105249_10593999 3300009553 Bacteria 1161
138 Ga0105249_11273959 3300009553 Bacteria 806
139 Ga0105249_11751375 3300009553 Bacteria 694
140 Ga0105239_10216614 3300010375 Bacteria 2147
141 Ga0105239_11118509 3300010375 Bacteria 907
142 Ga0105246_11406619 3300011119 Bacteria 651
143 Ga0157371_10334907 3300013102 Bacteria 1100
144 Ga0157371_11387609 3300013102 Bacteria 545
145 Ga0157370_10025457 3300013104 Bacteria 5857
146 Ga0157369_10016156 3300013105 Bacteria 8403
147 Ga0157374_10482483 3300013296 Bacteria 1243
148 Ga0157378_10637237 3300013297 Bacteria 1080
149 Ga0163162_10963716 3300013306 Bacteria 964
150 Ga0163162_12337016 3300013306 Bacteria 614
151 Ga0157372_10042061 3300013307 Bacteria 5052
152 Ga0157372_10708461 3300013307 Bacteria 1171
153 Ga0157372_11274509 3300013307 Bacteria 848
154 Ga0157372_12536125 3300013307 Bacteria 588
155 Ga0157375_11541725 3300013308 Bacteria 785
156 Ga0163163_11228628 3300014325 Bacteria 812
157 Ga0157380_10017875 3300014326 Bacteria 5256
158 Ga0157380_10334346 3300014326 Bacteria 1410
159 Ga0157380_10425020 3300014326 Bacteria 1268
160 Ga0157377_10222026 3300014745 Bacteria 1210
161 Ga0157377_10234580 3300014745 Bacteria 1181
162 Ga0157377_10369535 3300014745 Bacteria 968
163 Ga0157379_10536179 3300014968 Bacteria 1088
164 Ga0157376_10057234 3300014969 Bacteria 3260
165 Ga0206356_10524050 3300020070 Bacteria 1518
166 Ga0206354_11624061 3300020081 Bacteria 883
167 Ga0206353_11748275 3300020082 Bacteria 3944
168 Ga0207642_10251870 3300025899 Bacteria 1003
169 Ga0207642_10313072 3300025899 Bacteria 914
170 Ga0207688_10386807 3300025901 Bacteria 866
171 Ga0207645_10209593 3300025907 Bacteria 1283
172 Ga0207643_10089427 3300025908 Bacteria 1793
173 Ga0207705_10074116 3300025909 Bacteria 2470
174 Ga0207707_10076266 3300025912 Bacteria 2925
175 Ga0207707_10357351 3300025912 Bacteria 1258
176 Ga0207695_10007814 3300025913 Bacteria 13535
177 Ga0207695_10359130 3300025913 Bacteria 1343
178 Ga0207671_10042415 3300025914 Bacteria 3367
179 Ga0207693_10003339 3300025915 Bacteria 13733
180 Ga0207657_10027895 3300025919 Bacteria 5162
181 Ga0207649_10067077 3300025920 Bacteria 2277
182 Ga0207649_10429889 3300025920 Bacteria 993
183 Ga0207649_10691770 3300025920 Bacteria 790
184 Ga0207652_10058845 3300025921 Bacteria 3311
185 Ga0207681_10025691 3300025923 Bacteria 3791
186 Ga0207681_10191312 3300025923 Bacteria 1566
187 Ga0207681_11276294 3300025923 Bacteria 617
188 Ga0207659_10649278 3300025926 Bacteria 902
189 Ga0207687_10195610 3300025927 Bacteria 1577
190 Ga0207664_10000006 3300025929 Bacteria 408702
191 Ga0207664_10070763 3300025929 Bacteria 2808
192 Ga0207664_10148898 3300025929 Bacteria 1987
193 Ga0207690_10038870 3300025932 Bacteria 3100
194 Ga0207706_10011962 3300025933 Bacteria 7902
195 Ga0207706_10685801 3300025933 Bacteria 876
196 Ga0207686_10482741 3300025934 Bacteria 959
197 Ga0207709_10262707 3300025935 Bacteria 1267
198 Ga0207709_10414273 3300025935 Bacteria 1033
199 Ga0207709_10817339 3300025935 Bacteria 753
200 Ga0207670_10207786 3300025936 Bacteria 1491
201 Ga0207669_10114107 3300025937 Bacteria 1818
202 Ga0207669_10165694 3300025937 Bacteria 1567
203 Ga0207669_10166033 3300025937 Bacteria 1566
204 Ga0207669_10757132 3300025937 Bacteria 802
205 Ga0207704_10580412 3300025938 Bacteria 915
206 Ga0207691_10257644 3300025940 Bacteria 1504
207 Ga0207689_10578316 3300025942 Bacteria 944
208 Ga0207661_10002565 3300025944 Bacteria 12505
209 Ga0207661_10246478 3300025944 Bacteria 1587
210 Ga0207661_10371391 3300025944 Bacteria 1293
211 Ga0207661_10959205 3300025944 Bacteria 788
212 Ga0207679_10635493 3300025945 Bacteria 964
213 Ga0207651_10959722 3300025960 Bacteria 763
214 Ga0207651_11541467 3300025960 Bacteria 599
215 Ga0207668_10108887 3300025972 Bacteria 2075
216 Ga0207668_10118812 3300025972 Bacteria 1998
217 Ga0207668_10200957 3300025972 Bacteria 1587
218 Ga0207640_10414098 3300025981 Bacteria 1101
219 Ga0207640_10588998 3300025981 Bacteria 940
220 Ga0207640_11295343 3300025981 Bacteria 650
221 Ga0207677_10035314 3300026023 Bacteria 3246
222 Ga0207677_10756071 3300026023 Unclassified 867
223 Ga0207703_10257945 3300026035 Bacteria 1575
224 Ga0207639_10034935 3300026041 Bacteria 3718
225 Ga0207639_10458057 3300026041 Bacteria 1159
226 Ga0207678_10557394 3300026067 Bacteria 1002
227 Ga0207678_10913378 3300026067 Bacteria 776
228 Ga0207708_10010975 3300026075 Bacteria 6739
229 Ga0207708_10641304 3300026075 Bacteria 903
230 Ga0207708_10729775 3300026075 Bacteria 849
231 Ga0207702_10035724 3300026078 Bacteria 4154
232 Ga0207702_10348246 3300026078 Bacteria 1417
233 Ga0207702_10658118 3300026078 Bacteria 1030
234 Ga0207702_11207009 3300026078 Bacteria 751
235 Ga0207648_10249825 3300026089 Bacteria 1581
236 Ga0207648_10627411 3300026089 Bacteria 992
237 Ga0207676_10311337 3300026095 Bacteria 1442
238 Ga0207674_10060700 3300026116 Bacteria 3823
239 Ga0207674_10544635 3300026116 Bacteria 1121
240 Ga0207683_10287123 3300026121 Bacteria 1504
241 Ga0207698_10279602 3300026142 Bacteria 1543
242 Ga0207698_10799997 3300026142 Bacteria 945
243 Ga0207428_10043062 3300027907 Bacteria 3648
244 Ga0207428_10333256 3300027907 Bacteria 1119
245 Ga0268266_10458140 3300028379 Bacteria 1213
246 Ga0268265_11901811 3300028380 Bacteria 602
247 Ga0265319_1000093 3300028563 Bacteria 69319
248 Ga0265334_10215867 3300028573 Bacteria 664
249 Ga0265322_10085177 3300028654 Bacteria 897
250 Ga0265338_10016147 3300028800 Bacteria 8146
251 Ga0265338_10273271 3300028800 Bacteria 1238
252 Ga0307408_100194265 3300031548 Bacteria 1638
253 Ga0307408_100600062 3300031548 Bacteria 978
254 Ga0307405_10058977 3300031731 Bacteria 2417
255 Ga0307405_10113123 3300031731 Bacteria 1843
256 Ga0307405_10139757 3300031731 Bacteria 1687
257 Ga0307405_10433293 3300031731 Bacteria 1038
258 Ga0307405_10867848 3300031731 Bacteria 761
259 Ga0307413_10170784 3300031824 Bacteria 1539
260 Ga0307413_10281337 3300031824 Bacteria 1251
261 Ga0307410_10234266 3300031852 Bacteria 1419
262 Ga0307410_10952133 3300031852 Bacteria 738
263 Ga0307406_10019215 3300031901 Bacteria 4007
264 Ga0307406_10149981 3300031901 Bacteria 1662
265 Ga0307406_11512038 3300031901 Bacteria 591
266 Ga0307407_10010725 3300031903 Bacteria 4331
267 Ga0307407_10296488 3300031903 Bacteria 1126
268 Ga0307412_10073601 3300031911 Bacteria 2338
269 Ga0307412_10467765 3300031911 Bacteria 1043
270 Ga0307412_10725933 3300031911 Bacteria 855
271 Ga0307412_11576614 3300031911 Bacteria 599
272 Ga0307409_100004644 3300031995 Bacteria 7759
273 Ga0307409_100024015 3300031995 Bacteria 4241
274 Ga0307409_100051528 3300031995 Bacteria 3150
275 Ga0307409_100116564 3300031995 Bacteria 2252
276 Ga0307409_100258278 3300031995 Bacteria 1597
277 Ga0307409_101756298 3300031995 Bacteria 649
278 Ga0307416_100193769 3300032002 Bacteria 1920
279 Ga0307416_100272545 3300032002 Bacteria 1663
280 Ga0307416_100569022 3300032002 Bacteria 1209
281 Ga0307416_101134002 3300032002 Bacteria 887
282 Ga0307414_10033658 3300032004 Bacteria 3390
283 Ga0307414_10619279 3300032004 Bacteria 973
284 Ga0307414_10887539 3300032004 Bacteria 817
285 Ga0307411_10031794 3300032005 Bacteria 3253
286 Ga0307411_10093697 3300032005 Bacteria 2104
287 Ga0307411_10897367 3300032005 Bacteria 787
288 Ga0307415_100002060 3300032126 Bacteria 9933
289 Ga0307415_100008209 3300032126 Bacteria 5776
290 Ga0307415_100219099 3300032126 Bacteria 1524
291 Ga0307415_100419208 3300032126 Bacteria 1148
292 Ga0307415_101249125 3300032126 Unclassified 702
293 Ga0373958_0058167 3300034819 Bacteria 832
294 Ga0373931_0847903 3300035691 Bacteria 612
295 Ga0395899_0473869 3300037312 Bacteria 816
296 Ga0395900_0441974 3300037418 Bacteria 1258
297 Ga0395900_0678806 3300037418 Bacteria 965
298 Ga0395898_0197937 3300037466 Bacteria 1919
299 Ga0395898_0548129 3300037466 Bacteria 1098
300 Ga0395898_1391522 3300037466 Bacteria 629
301 Ga0395898_1562055 3300037466 Bacteria 585
302 Ga0395898_1792351 3300037466 Unclassified 535
303 Ga0395905_0362688 3300037471 Bacteria 1342
304 Ga0395905_0440475 3300037471 Bacteria 1200
305 Ga0395901_0021637 3300038443 Bacteria 6588
306 Ga0395901_0213804 3300038443 Bacteria 2017
307 Ga0395901_0454080 3300038443 Bacteria 1310
308 Ga0395901_0581799 3300038443 Bacteria 1131
309 Ga0395901_0778790 3300038443 Bacteria 947
310 Ga0395901_1890620 3300038443 Bacteria 545
311 Ga0436363_1508741 3300039450 Bacteria 782
312 Ga0451802_1376511 3300041460 Bacteria 1140
313 Ga0451837_0159455 3300041494 Bacteria 1115
314 Ga0451845_0052913 3300041501 Bacteria 897
315 Ga0451849_0132430 3300041505 Bacteria 945
316 Ga0451853_1096073 3300041512 Bacteria 765
317 Ga0439451_129331 3300042009 Bacteria 516
318 Ga0439454_011991 3300042011 Bacteria 1168
319 Ga0439463_090674 3300042016 Bacteria 787
320 Ga0450917_001796 3300042120 Bacteria 1522
321 Ga0439458_0042077 3300042157 Bacteria 1111
322 Ga0439459_0108697 3300042438 Unclassified 687
323 Ga0439459_0166096 3300042438 Bacteria 585
324 Ga0439464_0167416 3300042439 Bacteria 692
325 Ga0439460_0092358 3300042461 Bacteria 963
326 Ga0439460_0165082 3300042461 Bacteria 744
327 Ga0450893_0047756 3300042532 Bacteria 797
328 Ga0466972_0077519 3300044658 Bacteria 1583
329 Ga0466972_0134075 3300044658 Bacteria 1166
330 Ga0466972_0276912 3300044658 Bacteria 784
331 Ga0466972_0343881 3300044658 Bacteria 698
332 Ga0466972_0374617 3300044658 Bacteria 666
333 Ga0466965_0268968 3300044683 Bacteria 918
334 Ga0466965_0336832 3300044683 Bacteria 824
335 Ga0466965_0584452 3300044683 Bacteria 633
336 Ga0466966_0327557 3300044684 Bacteria 920
337 Ga0466966_0435033 3300044684 Unclassified 789
338 Ga0466961_0049561 3300044693 Bacteria 2684
339 Ga0466961_0090881 3300044693 Bacteria 1928
340 Ga0466963_0011641 3300044694 Bacteria 5358
341 Ga0466963_0185117 3300044694 Bacteria 1454
342 Ga0466963_0193996 3300044694 Bacteria 1419
343 Ga0466963_0275453 3300044694 Bacteria 1182
344 Ga0466963_0693714 3300044694 Bacteria 718
345 Ga0466963_0944702 3300044694 Bacteria 607
346 Ga0466964_0879177 3300044706 Bacteria 511
347 Ga0466971_0019707 3300044719 Bacteria 2997
348 Ga0466971_0043933 3300044719 Bacteria 2007
349 Ga0466968_0413519 3300044735 Bacteria 663
350 Ga0466970_0092181 3300044765 Bacteria 1645
351 Ga0466970_0107630 3300044765 Bacteria 1521
352 Ga0466970_0121497 3300044765 Bacteria 1431
353 Ga0466957_0213192 3300044842 Bacteria 1272
354 Ga0466957_0705746 3300044842 Bacteria 712
355 Ga0466960_0008354 3300044901 Bacteria 4238
356 Ga0466960_0113881 3300044901 Bacteria 1409
357 Ga0466959_0318772 3300045049 Bacteria 1063
358 Ga0466958_0446574 3300045836 Bacteria 837
359 Ga0466967_0002244 3300045976 Bacteria 11904
360 Ga0466967_0016429 3300045976 Bacteria 5837
361 Ga0466967_0016543 3300045976 Bacteria 5821
362 Ga0466967_0157440 3300045976 Bacteria 2129
363 Ga0466967_0439326 3300045976 Bacteria 1274
364 Ga0466967_0603365 3300045976 Bacteria 1083
365 Ga0466967_0840514 3300045976 Bacteria 912
366 Ga0466967_0910155 3300045976 Bacteria 875
367 Ga0466967_1535171 3300045976 Bacteria 663
368 Ga0495603_0436353 3300046455 Bacteria 750
369 Ga0495590_0319154 3300046457 Unclassified 587
370 Ga0495641_0005510 3300046461 Bacteria 8514
371 Ga0495641_0261773 3300046461 Bacteria 778
372 Ga0495641_0428191 3300046461 Bacteria 601
373 Ga0495653_0001336 3300046463 Bacteria 19144
374 Ga0495650_0000223 3300046471 Bacteria 118162
375 Ga0495664_0001128 3300046477 Bacteria 13844
376 Ga0495584_0345314 3300046491 Bacteria 756
377 Ga0495596_0155880 3300046500 Bacteria 887
378 Ga0495616_0085415 3300046513 Bacteria 1503
379 Ga0495620_0135985 3300046515 Bacteria 963
380 Ga0495630_0873045 3300046517 Bacteria 686
381 Ga0495643_0250533 3300046522 Bacteria 827
382 Ga0495652_0280897 3300046529 Bacteria 1219
383 Ga0495621_0167519 3300046539 Bacteria 872
384 Ga0495656_0017871 3300046615 Bacteria 2713
385 Ga0495656_0053931 3300046615 Bacteria 1729
386 Ga0495656_0107603 3300046615 Bacteria 1299
387 Ga0495668_0230278 3300046616 Bacteria 1015
388 Ga0495657_0023569 3300046675 Bacteria 4396
389 Ga0495658_0077000 3300046683 Unclassified 1950
390 Ga0495670_0562605 3300046691 Bacteria 621
391 Ga0495649_0455551 3300046694 Bacteria 639
392 Ga0495589_0155531 3300046794 Bacteria 1091
393 Ga0495600_0003671 3300046809 Bacteria 9066
394 Ga0495660_0433460 3300046810 Bacteria 571
395 Ga0495604_0000144 3300047317 Bacteria 61560
396 Ga0495672_0016723 3300047320 Bacteria 4928
397 Ga0495676_0347653 3300047321 Bacteria 992
398 Ga0495677_0267053 3300047445 Unclassified 670
399 Ga0495685_159881 3300047447 Unclassified 730
400 Ga0495673_0050625 3300047469 Bacteria 1822
401 Ga0495686_0044207 3300047472 Bacteria 2820
402 Ga0495686_0307509 3300047472 Bacteria 873
403 Ga0496100_0110824 3300048903 Bacteria 1906
404 Ga0496101_0609580 3300048904 Bacteria 863
405 Ga0496101_0833888 3300048904 Bacteria 727
406 Ga0496102_0000076 3300048905 Bacteria 142745
407 Ga0496102_0059004 3300048905 Bacteria 3508
408 Ga0496102_0235660 3300048905 Bacteria 1726
409 Ga0496102_0555782 3300048905 Bacteria 1071
410 Ga0496102_0969718 3300048905 Bacteria 771
411 Ga0496103_0000367 3300048906 Bacteria 40593
412 Ga0496103_0352140 3300048906 Bacteria 947
413 Ga0496104_0000034 3300048907 Bacteria 186572
414 Ga0496104_0068707 3300048907 Bacteria 3367
415 Ga0496104_0089408 3300048907 Bacteria 2942
416 Ga0496104_0416495 3300048907 Bacteria 1256
417 Ga0496104_0909719 3300048907 Bacteria 785
418 Ga0496105_0013426 3300048908 Bacteria 6502
419 Ga0496105_0196307 3300048908 Bacteria 1649
420 Ga0496106_0239330 3300048909 Bacteria 1450
421 Ga0496106_0500765 3300048909 Bacteria 976
422 Ga0496107_0014072 3300048910 Bacteria 5601
423 Ga0496107_0316736 3300048910 Bacteria 1161
424 Ga0496107_0649349 3300048910 Bacteria 778
425 Ga0496108_0037471 3300048911 Bacteria 4039
426 Ga0496108_0318919 3300048911 Bacteria 1355
427 Ga0496108_0529274 3300048911 Bacteria 1029
428 Ga0496109_0033793 3300048912 Bacteria 4603
429 Ga0496109_0046204 3300048912 Bacteria 3954
430 Ga0496109_0103512 3300048912 Bacteria 2642
431 Ga0496109_1144098 3300048912 Bacteria 715
432 Ga0496110_0002022 3300048913 Bacteria 15099
433 Ga0496110_0750926 3300048913 Bacteria 879
434 Ga0496110_0753822 3300048913 Bacteria 877
435 Ga0496110_0812884 3300048913 Bacteria 839
436 Ga0496110_0975413 3300048913 Bacteria 755
437 Ga0496110_1489966 3300048913 Bacteria 586
438 Ga0496111_0001077 3300048914 Bacteria 15058
439 Ga0496111_0091228 3300048914 Bacteria 2233
440 Ga0496111_0112686 3300048914 Bacteria 2004
441 Ga0496111_0119996 3300048914 Bacteria 1942
442 Ga0496111_1120110 3300048914 Bacteria 560
443 Ga0496112_0000848 3300048915 Bacteria 21825
444 Ga0496112_0048051 3300048915 Bacteria 4185
445 Ga0496112_0065235 3300048915 Bacteria 3593
446 Ga0496112_0105434 3300048915 Bacteria 2788
447 Ga0496112_0120606 3300048915 Bacteria 2592
448 Ga0496112_0190864 3300048915 Bacteria 2011
449 Ga0496112_0192462 3300048915 Bacteria 2001
450 Ga0496112_0355115 3300048915 Bacteria 1408
451 Ga0496113_0006671 3300048916 Bacteria 7345
452 Ga0496113_0032764 3300048916 Bacteria 3778
453 Ga0496113_0037888 3300048916 Bacteria 3542
454 Ga0496113_0528094 3300048916 Bacteria 947
455 Ga0496113_1020532 3300048916 Bacteria 651
456 Ga0496114_0058459 3300048917 Bacteria 3220
457 Ga0496114_0105306 3300048917 Bacteria 2413
458 Ga0496114_0179778 3300048917 Bacteria 1847
459 Ga0496114_1035116 3300048917 Bacteria 705
460 Ga0496114_1270873 3300048917 Unclassified 623
461 Ga0496115_0437547 3300048918 Bacteria 1058
462 Ga0496121_0038003 3300048924 Bacteria 4270
463 Ga0496124_0059124 3300048927 Bacteria 3221
464 Ga0496126_0260656 3300048929 Bacteria 1442
465 Ga0501031_0164255 3300049568 Bacteria 1451
466 Ga0501031_0342457 3300049568 Bacteria 968
467 Ga0501033_0124920 3300049570 Bacteria 1866
468 Ga0501033_0558794 3300049570 Bacteria 788
469 Ga0501034_0033144 3300049571 Bacteria 5243
470 Ga0501036_0064942 3300049572 Bacteria 3089
471 Ga0501036_0551674 3300049572 Bacteria 957
472 Ga0501036_0904852 3300049572 Bacteria 724
473 Ga0501037_0253214 3300049573 Bacteria 1232
474 Ga0501038_0112952 3300049574 Bacteria 2248
475 Ga0501038_0155936 3300049574 Bacteria 1859
476 Ga0501039_0024585 3300049575 Bacteria 4628
477 Ga0501040_0160086 3300049576 Bacteria 1591
478 Ga0501040_0323834 3300049576 Bacteria 1102
479 Ga0501041_0030356 3300049577 Bacteria 3262
480 Ga0501041_0185212 3300049577 Bacteria 1304
481 Ga0501042_0032100 3300049578 Bacteria 3717
482 Ga0501042_0131604 3300049578 Bacteria 1803
483 Ga0501042_0815248 3300049578 Bacteria 679
484 Ga0501043_0127000 3300049579 Bacteria 2000
485 Ga0501047_0268588 3300049581 Bacteria 1552
486 Ga0501048_0464796 3300049582 Bacteria 906
487 Ga0501048_0652745 3300049582 Unclassified 755
488 Ga0501067_0165629 3300049583 Bacteria 1231
489 Ga0501071_0014945 3300049587 Bacteria 5319
490 Ga0501071_0086996 3300049587 Bacteria 2292
491 Ga0501071_0130404 3300049587 Bacteria 1867
492 Ga0501071_0201263 3300049587 Bacteria 1496
493 Ga0501072_0051700 3300049588 Bacteria 3235
494 Ga0501072_0078276 3300049588 Bacteria 2618
495 Ga0501072_0300886 3300049588 Bacteria 1275
496 Ga0501073_0422832 3300049589 Bacteria 921
497 Ga0501074_0134749 3300049590 Bacteria 1767
498 Ga0501074_1165306 3300049590 Unclassified 541
499 Ga0501075_0070001 3300049591 Bacteria 2652
500 Ga0501075_0087016 3300049591 Bacteria 2368
501 Ga0501075_0426025 3300049591 Bacteria 1012
502 Ga0501076_0237771 3300049592 Bacteria 1490
503 Ga0501076_0347763 3300049592 Bacteria 1217
504 Ga0501077_0241477 3300049593 Bacteria 1148
505 Ga0501259_066469 3300049688 Bacteria 765
506 Ga0501079_0084818 3300049741 Bacteria 2451
507 Ga0501079_0162035 3300049741 Bacteria 1744
508 Ga0501079_0263116 3300049741 Bacteria 1348
509 Ga0501079_0717755 3300049741 Bacteria 787
510 Ga0501080_0303149 3300049742 Bacteria 1448
511 Ga0501080_0331173 3300049742 Bacteria 1377
512 Ga0501081_0078034 3300049743 Bacteria 2315
513 Ga0501081_0433816 3300049743 Bacteria 975
514 Ga0501081_0499803 3300049743 Bacteria 906
515 Ga0501083_0389687 3300049744 Bacteria 906
516 Ga0501083_0531376 3300049744 Bacteria 765
517 Ga0501035_0299932 3300049822 Bacteria 1354
518 Ga0501044_0593793 3300049823 Bacteria 1001
519 Ga0501045_0144940 3300049824 Bacteria 1766
520 Ga0501045_0494779 3300049824 Unclassified 908
521 Ga0501045_0839525 3300049824 Bacteria 676
522 nmdc:mga0yw44_1036288_c1 3300050492 Bacteria 555
523 nmdc:mga05p37_324769_c1 3300050507 Bacteria 1820
524 nmdc:mga05p37_382397_c1 3300050507 Bacteria 1649
525 nmdc:mga09592_1365615_c1 3300050508 Bacteria 580
526 nmdc:mga09592_3695_c2 3300050508 Bacteria 9164
527 nmdc:mga09592_40339_c1 3300050508 Bacteria 3921
528 nmdc:mga09592_702483_c1 3300050508 Bacteria 860
529 nmdc:mga09592_706691_c1 3300050508 Bacteria 857
530 nmdc:mga0qj67_32719_c1 3300050509 Bacteria 4057
531 nmdc:mga0qj67_59266_c1 3300050509 Bacteria 3036
532 nmdc:mga06r32_1184375_c1 3300050510 Bacteria 711
533 nmdc:mga06r32_67635_c1 3300050510 Bacteria 3450
534 nmdc:mga06r32_95356_c1 3300050510 Bacteria 2912
535 nmdc:mga08y16_1047938_c1 3300050511 Bacteria 793
536 nmdc:mga08y16_30683_c1 3300050511 Bacteria 5654
537 nmdc:mga08y16_489840_c1 3300050511 Bacteria 1250
538 Ga0495601_0118672 3300053077 Bacteria 1717
539 Ga0495655_0207360 3300053083 Unclassified 643
540 Ga0495619_0502188 3300053085 Bacteria 834
541 Ga0500616_0135402 3300053153 Bacteria 1158
542 Ga0501084_0236975 3300054114 Bacteria 1540
543 Ga0501084_0261448 3300054114 Bacteria 1461
544 Ga0501084_0291071 3300054114 Bacteria 1379
545 Ga0501084_0612899 3300054114 Bacteria 919
546 Ga0501084_1606925 3300054114 Bacteria 543
547 Ga0590071_132498 3300059421 Bacteria 641
548 Ga0590074_048393 3300059423 Bacteria 775
549 Ga0587073_0170482 3300059492 Bacteria 631
550 Ga0587080_045663 3300059503 Bacteria 812
551 Ga0587114_123833 3300059655 Bacteria 526
552 Ga0501082_0102730 3300060353 Bacteria 2473
553 Ga0501082_0198826 3300060353 Bacteria 1744
554 Ga0501082_0332312 3300060353 Bacteria 1324
555 Ga0501082_0684442 3300060353 Bacteria 898
556 Ga0501082_0739386 3300060353 Bacteria 861
557 Ga0501082_0834793 3300060353 Bacteria 806
558 Ga0501082_0971201 3300060353 Bacteria 743
559 Ga0466962_0070727 3300061719 Bacteria 1667
560 Ga0466962_0315777 3300061719 Bacteria 774
561 Ga0466962_0520905 3300061719 Bacteria 603
562 Ga0530510_0016156 3300061734 Bacteria 5279
563 Ga0530510_0100423 3300061734 Bacteria 2116
564 Ga0530510_0182771 3300061734 Bacteria 1555
565 Ga0530510_0971630 3300061734 Unclassified 650
566 Ga0530510_1350088 3300061734 Bacteria 547

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0085415 Ga0495616_0085415_298_792 113
2 3300006880 Ga0075429_100669000 Ga0075429_1006690002 120
3 3300009176 Ga0105242_10372913 Ga0105242_103729132 120
4 3300013296 Ga0157374_10482483 Ga0157374_104824832 120
5 3300014745 Ga0157377_10234580 Ga0157377_102345802 120
6 3300026089 Ga0207648_10249825 Ga0207648_102498252 120
7 3300037312 Ga0395899_0473869 Ga0395899_0473869_109_549 120
8 3300037418 Ga0395900_0678806 Ga0395900_0678806_457_897 120
9 3300037466 Ga0395898_0197937 Ga0395898_0197937_138_578 120
10 3300037466 Ga0395898_0548129 Ga0395898_0548129_341_781 120
11 3300037471 Ga0395905_0440475 Ga0395905_0440475_662_1102 120
12 3300038443 Ga0395901_0021637 Ga0395901_0021637_3665_4105 120
13 3300048912 Ga0496109_0033793 Ga0496109_0033793_926_1366 120
14 3300048913 Ga0496110_1489966 Ga0496110_1489966_34_474 120
15 3300048915 Ga0496112_0120606 Ga0496112_0120606_2002_2442 120
16 3300053085 Ga0495619_0502188 Ga0495619_0502188_180_614 120
17 3300005328 Ga0070676_10249135 Ga0070676_102491352 121
18 3300005331 Ga0070670_100996850 Ga0070670_1009968502 121
19 3300005345 Ga0070692_10140470 Ga0070692_101404702 121
20 3300005347 Ga0070668_100288096 Ga0070668_1002880962 121
21 3300005356 Ga0070674_100320375 Ga0070674_1003203752 121
22 3300005441 Ga0070700_100047515 Ga0070700_1000475155 121
23 3300005459 Ga0068867_100764321 Ga0068867_1007643212 121
24 3300005543 Ga0070672_100205811 Ga0070672_1002058112 121
25 3300005618 Ga0068864_101643751 Ga0068864_1016437512 121
26 3300005840 Ga0068870_10651316 Ga0068870_106513161 121
27 3300006846 Ga0075430_100022193 Ga0075430_1000221934 121
28 3300006847 Ga0075431_100020434 Ga0075431_1000204348 121
29 3300006880 Ga0075429_100022138 Ga0075429_1000221386 121
30 3300006881 Ga0068865_100328964 Ga0068865_1003289642 121
31 3300009094 Ga0111539_10773529 Ga0111539_107735291 121
32 3300009094 Ga0111539_12601505 Ga0111539_126015052 121
33 3300009147 Ga0114129_10273189 Ga0114129_102731894 121
34 3300009147 Ga0114129_10755453 Ga0114129_107554532 121
35 3300009174 Ga0105241_10928292 Ga0105241_109282922 121
36 3300011119 Ga0105246_11406619 Ga0105246_114066191 121
37 3300014326 Ga0157380_10017875 Ga0157380_100178752 121
38 3300014969 Ga0157376_10057234 Ga0157376_100572342 121
39 3300025907 Ga0207645_10209593 Ga0207645_102095932 121
40 3300025926 Ga0207659_10649278 Ga0207659_106492782 121
41 3300025937 Ga0207669_10114107 Ga0207669_101141072 121
42 3300025940 Ga0207691_10257644 Ga0207691_102576442 121
43 3300025960 Ga0207651_11541467 Ga0207651_115414671 121
44 3300025972 Ga0207668_10108887 Ga0207668_101088872 121
45 3300025981 Ga0207640_11295343 Ga0207640_112953432 121
46 3300026075 Ga0207708_10010975 Ga0207708_100109753 121
47 3300026078 Ga0207702_10348246 Ga0207702_103482462 121
48 3300046491 Ga0495584_0345314 Ga0495584_0345314_35_424 121
49 3300049688 Ga0501259_066469 Ga0501259_066469_211_660 121
50 3300050507 nmdc:mga05p37_324769_c1 nmdc:mga05p37_324769_c1_431_874 121
51 3300050508 nmdc:mga09592_40339_c1 nmdc:mga09592_40339_c1_1894_2337 121
52 3300050509 nmdc:mga0qj67_59266_c1 nmdc:mga0qj67_59266_c1_699_1142 121
53 3300050510 nmdc:mga06r32_95356_c1 nmdc:mga06r32_95356_c1_1434_1877 121
54 3300005343 Ga0070687_100364368 Ga0070687_1003643682 122
55 3300005344 Ga0070661_101112438 Ga0070661_1011124381 122
56 3300005364 Ga0070673_100841533 Ga0070673_1008415332 122
57 3300005435 Ga0070714_100001858 Ga0070714_10000185813 122
58 3300005539 Ga0068853_101133260 Ga0068853_1011332601 122
59 3300005563 Ga0068855_101637900 Ga0068855_1016379002 122
60 3300005564 Ga0070664_100768970 Ga0070664_1007689702 122
61 3300005614 Ga0068856_100309695 Ga0068856_1003096952 122
62 3300005615 Ga0070702_100526707 Ga0070702_1005267072 122
63 3300006846 Ga0075430_100367473 Ga0075430_1003674732 122
64 3300006847 Ga0075431_101328298 Ga0075431_1013282981 122
65 3300009176 Ga0105242_12131891 Ga0105242_121318911 122
66 3300013306 Ga0163162_12337016 Ga0163162_123370161 122
67 3300025913 Ga0207695_10007814 Ga0207695_100078145 122
68 3300025920 Ga0207649_10691770 Ga0207649_106917701 122
69 3300025929 Ga0207664_10000006 Ga0207664_10000006412 122
70 3300026067 Ga0207678_10557394 Ga0207678_105573942 122
71 3300026078 Ga0207702_10658118 Ga0207702_106581182 122
72 3300031731 Ga0307405_10867848 Ga0307405_108678482 122
73 3300035691 Ga0373931_0847903 Ga0373931_0847903_30_473 122
74 3300038443 Ga0395901_0454080 Ga0395901_0454080_102_536 122
75 3300038443 Ga0395901_0581799 Ga0395901_0581799_599_1036 122
76 3300044658 Ga0466972_0077519 Ga0466972_0077519_715_1155 122
77 3300044658 Ga0466972_0276912 Ga0466972_0276912_246_692 122
78 3300044658 Ga0466972_0343881 Ga0466972_0343881_16_447 122
79 3300044683 Ga0466965_0268968 Ga0466965_0268968_68_499 122
80 3300044694 Ga0466963_0185117 Ga0466963_0185117_58_492 122
81 3300044694 Ga0466963_0693714 Ga0466963_0693714_185_625 122
82 3300044765 Ga0466970_0121497 Ga0466970_0121497_344_775 122
83 3300044901 Ga0466960_0008354 Ga0466960_0008354_2232_2690 122
84 3300045976 Ga0466967_0002244 Ga0466967_0002244_4349_4789 122
85 3300045976 Ga0466967_0016543 Ga0466967_0016543_1002_1442 122
86 3300045976 Ga0466967_0840514 Ga0466967_0840514_462_887 122
87 3300046515 Ga0495620_0135985 Ga0495620_0135985_303_788 122
88 3300046539 Ga0495621_0167519 Ga0495621_0167519_361_846 122
89 3300046810 Ga0495660_0433460 Ga0495660_0433460_59_544 122
90 3300047472 Ga0495686_0044207 Ga0495686_0044207_592_1077 122
91 3300048907 Ga0496104_0416495 Ga0496104_0416495_696_1136 122
92 3300048910 Ga0496107_0649349 Ga0496107_0649349_121_561 122
93 3300048911 Ga0496108_0529274 Ga0496108_0529274_373_813 122
94 3300048912 Ga0496109_1144098 Ga0496109_1144098_168_608 122
95 3300048914 Ga0496111_0119996 Ga0496111_0119996_1313_1753 122
96 3300048915 Ga0496112_0190864 Ga0496112_0190864_892_1332 122
97 3300049571 Ga0501034_0033144 Ga0501034_0033144_3508_3966 122
98 3300049583 Ga0501067_0165629 Ga0501067_0165629_344_802 122
99 3300049743 Ga0501081_0433816 Ga0501081_0433816_355_792 122
100 3300050508 nmdc:mga09592_706691_c1 nmdc:mga09592_706691_c1_48_494 122
101 3300061734 Ga0530510_1350088 Ga0530510_1350088_89_529 122
102 3300003373 JGI25407J50210_10031613 JGI25407J50210_100316131 123
103 3300005337 Ga0070682_100746146 Ga0070682_1007461462 123
104 3300005338 Ga0068868_100289784 Ga0068868_1002897842 123
105 3300005343 Ga0070687_100168391 Ga0070687_1001683912 123
106 3300005345 Ga0070692_10287064 Ga0070692_102870642 123
107 3300005345 Ga0070692_10979564 Ga0070692_109795642 123
108 3300005435 Ga0070714_100056010 Ga0070714_1000560103 123
109 3300005530 Ga0070679_100679980 Ga0070679_1006799802 123
110 3300005547 Ga0070693_100196756 Ga0070693_1001967561 123
111 3300005564 Ga0070664_100092298 Ga0070664_1000922983 123
112 3300005841 Ga0068863_100579041 Ga0068863_1005790412 123
113 3300005841 Ga0068863_100898717 Ga0068863_1008987172 123
114 3300005843 Ga0068860_101219579 Ga0068860_1012195792 123
115 3300005981 Ga0081538_10003555 Ga0081538_100035554 123
116 3300006844 Ga0075428_100882859 Ga0075428_1008828592 123
117 3300006846 Ga0075430_101501543 Ga0075430_1015015431 123
118 3300009093 Ga0105240_11098695 Ga0105240_110986952 123
119 3300009098 Ga0105245_10601039 Ga0105245_106010392 123
120 3300009101 Ga0105247_10963184 Ga0105247_109631841 123
121 3300009148 Ga0105243_10524364 Ga0105243_105243642 123
122 3300009176 Ga0105242_10168616 Ga0105242_101686162 123
123 3300009553 Ga0105249_11273959 Ga0105249_112739592 123
124 3300009553 Ga0105249_11751375 Ga0105249_117513751 123
125 3300010375 Ga0105239_11118509 Ga0105239_111185092 123
126 3300013306 Ga0163162_10963716 Ga0163162_109637162 123
127 3300013307 Ga0157372_11274509 Ga0157372_112745092 123
128 3300014326 Ga0157380_10334346 Ga0157380_103343463 123
129 3300014326 Ga0157380_10425020 Ga0157380_104250202 123
130 3300014968 Ga0157379_10536179 Ga0157379_105361792 123
131 3300025912 Ga0207707_10357351 Ga0207707_103573512 123
132 3300025927 Ga0207687_10195610 Ga0207687_101956102 123
133 3300025929 Ga0207664_10070763 Ga0207664_100707632 123
134 3300025933 Ga0207706_10685801 Ga0207706_106858012 123
135 3300025934 Ga0207686_10482741 Ga0207686_104827412 123
136 3300025937 Ga0207669_10166033 Ga0207669_101660332 123
137 3300026023 Ga0207677_10035314 Ga0207677_100353144 123
138 3300026035 Ga0207703_10257945 Ga0207703_102579452 123
139 3300026089 Ga0207648_10627411 Ga0207648_106274111 123
140 3300026095 Ga0207676_10311337 Ga0207676_103113372 123
141 3300026121 Ga0207683_10287123 Ga0207683_102871232 123
142 3300026142 Ga0207698_10799997 Ga0207698_107999972 123
143 3300027907 Ga0207428_10333256 Ga0207428_103332562 123
144 3300028380 Ga0268265_11901811 Ga0268265_119018111 123
145 3300031548 Ga0307408_100600062 Ga0307408_1006000622 123
146 3300031731 Ga0307405_10113123 Ga0307405_101131233 123
147 3300031731 Ga0307405_10139757 Ga0307405_101397572 123
148 3300031911 Ga0307412_10467765 Ga0307412_104677652 123
149 3300031995 Ga0307409_101756298 Ga0307409_1017562982 123
150 3300032126 Ga0307415_100002060 Ga0307415_10000206010 123
151 3300037466 Ga0395898_1562055 Ga0395898_1562055_44_481 123
152 3300037466 Ga0395898_1792351 Ga0395898_1792351_23_463 123
153 3300042438 Ga0439459_0108697 Ga0439459_0108697_93_527 123
154 3300044683 Ga0466965_0584452 Ga0466965_0584452_74_511 123
155 3300044694 Ga0466963_0011641 Ga0466963_0011641_1616_2047 123
156 3300044706 Ga0466964_0879177 Ga0466964_0879177_57_491 123
157 3300044719 Ga0466971_0019707 Ga0466971_0019707_1533_1964 123
158 3300044735 Ga0466968_0413519 Ga0466968_0413519_180_641 123
159 3300044842 Ga0466957_0213192 Ga0466957_0213192_689_1135 123
160 3300045049 Ga0466959_0318772 Ga0466959_0318772_488_919 123
161 3300045976 Ga0466967_0016429 Ga0466967_0016429_3546_3983 123
162 3300045976 Ga0466967_0439326 Ga0466967_0439326_145_585 123
163 3300045976 Ga0466967_1535171 Ga0466967_1535171_119_556 123
164 3300046461 Ga0495641_0005510 Ga0495641_0005510_2296_2781 123
165 3300046461 Ga0495641_0428191 Ga0495641_0428191_131_571 123
166 3300046471 Ga0495650_0000223 Ga0495650_0000223_43620_44087 123
167 3300046615 Ga0495656_0017871 Ga0495656_0017871_54_626 123
168 3300047469 Ga0495673_0050625 Ga0495673_0050625_1209_1781 123
169 3300048904 Ga0496101_0609580 Ga0496101_0609580_70_513 123
170 3300048905 Ga0496102_0235660 Ga0496102_0235660_352_795 123
171 3300048905 Ga0496102_0555782 Ga0496102_0555782_164_595 123
172 3300048909 Ga0496106_0239330 Ga0496106_0239330_474_917 123
173 3300048909 Ga0496106_0500765 Ga0496106_0500765_321_761 123
174 3300048910 Ga0496107_0316736 Ga0496107_0316736_258_701 123
175 3300048911 Ga0496108_0037471 Ga0496108_0037471_2475_2918 123
176 3300048912 Ga0496109_0046204 Ga0496109_0046204_2519_2971 123
177 3300048912 Ga0496109_0103512 Ga0496109_0103512_119_562 123
178 3300048913 Ga0496110_0753822 Ga0496110_0753822_11_454 123
179 3300048913 Ga0496110_0812884 Ga0496110_0812884_187_639 123
180 3300048913 Ga0496110_0975413 Ga0496110_0975413_17_451 123
181 3300048914 Ga0496111_0112686 Ga0496111_0112686_125_568 123
182 3300048914 Ga0496111_1120110 Ga0496111_1120110_96_548 123
183 3300048915 Ga0496112_0105434 Ga0496112_0105434_2031_2483 123
184 3300048915 Ga0496112_0192462 Ga0496112_0192462_962_1399 123
185 3300048916 Ga0496113_0006671 Ga0496113_0006671_5169_5612 123
186 3300048916 Ga0496113_0032764 Ga0496113_0032764_2269_2721 123
187 3300048917 Ga0496114_0105306 Ga0496114_0105306_1849_2289 123
188 3300048917 Ga0496114_0179778 Ga0496114_0179778_89_532 123
189 3300049591 Ga0501075_0426025 Ga0501075_0426025_385_834 123
190 3300053153 Ga0500616_0135402 Ga0500616_0135402_86_517 123
191 3300059492 Ga0587073_0170482 Ga0587073_0170482_48_488 123
192 3300059503 Ga0587080_045663 Ga0587080_045663_43_480 123
193 3300059655 Ga0587114_123833 Ga0587114_123833_39_479 123
194 3300061719 Ga0466962_0315777 Ga0466962_0315777_229_660 123
195 3300000549 LJQas_1030268 LJQas_10302682 124
196 3300005329 Ga0070683_100424399 Ga0070683_1004243992 124
197 3300005337 Ga0070682_100742291 Ga0070682_1007422912 124
198 3300005339 Ga0070660_100771662 Ga0070660_1007716622 124
199 3300005344 Ga0070661_100300793 Ga0070661_1003007932 124
200 3300005347 Ga0070668_100152622 Ga0070668_1001526223 124
201 3300005356 Ga0070674_100322733 Ga0070674_1003227332 124
202 3300005435 Ga0070714_100192946 Ga0070714_1001929461 124
203 3300005457 Ga0070662_100031509 Ga0070662_1000315092 124
204 3300005459 Ga0068867_101724778 Ga0068867_1017247782 124
205 3300005471 Ga0070698_101653693 Ga0070698_1016536932 124
206 3300005546 Ga0070696_100131145 Ga0070696_1001311452 124
207 3300005549 Ga0070704_100127148 Ga0070704_1001271483 124
208 3300005577 Ga0068857_101361830 Ga0068857_1013618302 124
209 3300005614 Ga0068856_101863315 Ga0068856_1018633151 124
210 3300005844 Ga0068862_100308420 Ga0068862_1003084202 124
211 3300005937 Ga0081455_10082585 Ga0081455_100825852 124
212 3300005937 Ga0081455_10221488 Ga0081455_102214882 124
213 3300005985 Ga0081539_10012516 Ga0081539_100125164 124
214 3300009094 Ga0111539_10781737 Ga0111539_107817372 124
215 3300009098 Ga0105245_10112556 Ga0105245_101125564 124
216 3300009098 Ga0105245_10606399 Ga0105245_106063992 124
217 3300009148 Ga0105243_10115568 Ga0105243_101155683 124
218 3300009148 Ga0105243_10569189 Ga0105243_105691892 124
219 3300009176 Ga0105242_11070793 Ga0105242_110707932 124
220 3300009551 Ga0105238_10978142 Ga0105238_109781422 124
221 3300009553 Ga0105249_10386778 Ga0105249_103867782 124
222 3300009553 Ga0105249_10593999 Ga0105249_105939992 124
223 3300013297 Ga0157378_10637237 Ga0157378_106372372 124
224 3300013307 Ga0157372_12536125 Ga0157372_125361252 124
225 3300013308 Ga0157375_11541725 Ga0157375_115417252 124
226 3300014745 Ga0157377_10369535 Ga0157377_103695352 124
227 3300025923 Ga0207681_11276294 Ga0207681_112762941 124
228 3300025929 Ga0207664_10148898 Ga0207664_101488982 124
229 3300025933 Ga0207706_10011962 Ga0207706_100119628 124
230 3300025935 Ga0207709_10262707 Ga0207709_102627072 124
231 3300025935 Ga0207709_10414273 Ga0207709_104142732 124
232 3300025935 Ga0207709_10817339 Ga0207709_108173392 124
233 3300025937 Ga0207669_10165694 Ga0207669_101656942 124
234 3300025938 Ga0207704_10580412 Ga0207704_105804122 124
235 3300025944 Ga0207661_10246478 Ga0207661_102464782 124
236 3300025960 Ga0207651_10959722 Ga0207651_109597222 124
237 3300025972 Ga0207668_10118812 Ga0207668_101188122 124
238 3300026041 Ga0207639_10458057 Ga0207639_104580572 124
239 3300026075 Ga0207708_10729775 Ga0207708_107297752 124
240 3300026078 Ga0207702_11207009 Ga0207702_112070091 124
241 3300026116 Ga0207674_10544635 Ga0207674_105446352 124
242 3300027907 Ga0207428_10043062 Ga0207428_100430625 124
243 3300031548 Ga0307408_100194265 Ga0307408_1001942651 124
244 3300031731 Ga0307405_10058977 Ga0307405_100589771 124
245 3300031731 Ga0307405_10433293 Ga0307405_104332931 124
246 3300031824 Ga0307413_10281337 Ga0307413_102813372 124
247 3300031852 Ga0307410_10234266 Ga0307410_102342662 124
248 3300031901 Ga0307406_10019215 Ga0307406_100192153 124
249 3300031903 Ga0307407_10010725 Ga0307407_100107254 124
250 3300031911 Ga0307412_10073601 Ga0307412_100736012 124
251 3300031911 Ga0307412_10725933 Ga0307412_107259331 124
252 3300031911 Ga0307412_11576614 Ga0307412_115766141 124
253 3300031995 Ga0307409_100004644 Ga0307409_1000046443 124
254 3300031995 Ga0307409_100051528 Ga0307409_1000515283 124
255 3300032002 Ga0307416_100272545 Ga0307416_1002725452 124
256 3300032004 Ga0307414_10033658 Ga0307414_100336582 124
257 3300032004 Ga0307414_10887539 Ga0307414_108875392 124
258 3300032005 Ga0307411_10031794 Ga0307411_100317943 124
259 3300032005 Ga0307411_10093697 Ga0307411_100936973 124
260 3300032005 Ga0307411_10897367 Ga0307411_108973671 124
261 3300032126 Ga0307415_100008209 Ga0307415_1000082094 124
262 3300032126 Ga0307415_100419208 Ga0307415_1004192082 124
263 3300041460 Ga0451802_1376511 Ga0451802_1376511_191_649 124
264 3300041494 Ga0451837_0159455 Ga0451837_0159455_430_891 124
265 3300041501 Ga0451845_0052913 Ga0451845_0052913_283_717 124
266 3300041505 Ga0451849_0132430 Ga0451849_0132430_66_524 124
267 3300041512 Ga0451853_1096073 Ga0451853_1096073_242_694 124
268 3300042016 Ga0439463_090674 Ga0439463_090674_65_502 124
269 3300044658 Ga0466972_0374617 Ga0466972_0374617_68_502 124
270 3300044683 Ga0466965_0336832 Ga0466965_0336832_373_813 124
271 3300044684 Ga0466966_0435033 Ga0466966_0435033_147_599 124
272 3300044694 Ga0466963_0193996 Ga0466963_0193996_957_1397 124
273 3300044694 Ga0466963_0944702 Ga0466963_0944702_66_506 124
274 3300044842 Ga0466957_0705746 Ga0466957_0705746_177_617 124
275 3300044901 Ga0466960_0113881 Ga0466960_0113881_217_663 124
276 3300045836 Ga0466958_0446574 Ga0466958_0446574_171_611 124
277 3300045976 Ga0466967_0603365 Ga0466967_0603365_509_949 124
278 3300045976 Ga0466967_0910155 Ga0466967_0910155_216_662 124
279 3300046463 Ga0495653_0001336 Ga0495653_0001336_12297_12761 124
280 3300046517 Ga0495630_0873045 Ga0495630_0873045_141_572 124
281 3300046616 Ga0495668_0230278 Ga0495668_0230278_287_865 124
282 3300046675 Ga0495657_0023569 Ga0495657_0023569_3287_3769 124
283 3300046683 Ga0495658_0077000 Ga0495658_0077000_1048_1533 124
284 3300047320 Ga0495672_0016723 Ga0495672_0016723_3589_4026 124
285 3300047447 Ga0495685_159881 Ga0495685_159881_109_552 124
286 3300048903 Ga0496100_0110824 Ga0496100_0110824_413_859 124
287 3300048904 Ga0496101_0833888 Ga0496101_0833888_118_564 124
288 3300048905 Ga0496102_0059004 Ga0496102_0059004_2940_3386 124
289 3300048905 Ga0496102_0969718 Ga0496102_0969718_46_462 124
290 3300048907 Ga0496104_0068707 Ga0496104_0068707_725_1168 124
291 3300048907 Ga0496104_0089408 Ga0496104_0089408_1692_2135 124
292 3300048908 Ga0496105_0013426 Ga0496105_0013426_5395_5838 124
293 3300048908 Ga0496105_0196307 Ga0496105_0196307_1013_1456 124
294 3300048910 Ga0496107_0014072 Ga0496107_0014072_2383_2829 124
295 3300048914 Ga0496111_0091228 Ga0496111_0091228_898_1338 124
296 3300048915 Ga0496112_0000848 Ga0496112_0000848_13206_13652 124
297 3300048915 Ga0496112_0048051 Ga0496112_0048051_1300_1743 124
298 3300048915 Ga0496112_0355115 Ga0496112_0355115_582_1022 124
299 3300048916 Ga0496113_1020532 Ga0496113_1020532_171_614 124
300 3300048918 Ga0496115_0437547 Ga0496115_0437547_284_727 124
301 3300049572 Ga0501036_0904852 Ga0501036_0904852_230_670 124
302 3300049581 Ga0501047_0268588 Ga0501047_0268588_669_1109 124
303 3300049741 Ga0501079_0717755 Ga0501079_0717755_316_717 124
304 3300049824 Ga0501045_0839525 Ga0501045_0839525_107_508 124
305 3300050510 nmdc:mga06r32_1184375_c1 nmdc:mga06r32_1184375_c1_180_620 124
306 3300050511 nmdc:mga08y16_1047938_c1 nmdc:mga08y16_1047938_c1_15_455 124
307 3300050511 nmdc:mga08y16_30683_c1 nmdc:mga08y16_30683_c1_1926_2366 124
308 3300060353 Ga0501082_0971201 Ga0501082_0971201_208_642 124
309 3300061719 Ga0466962_0520905 Ga0466962_0520905_109_549 124
310 3300005327 Ga0070658_10106507 Ga0070658_101065072 125
311 3300005329 Ga0070683_100089868 Ga0070683_1000898682 125
312 3300005336 Ga0070680_100011130 Ga0070680_1000111304 125
313 3300005337 Ga0070682_100036178 Ga0070682_1000361782 125
314 3300005341 Ga0070691_10195647 Ga0070691_101956472 125
315 3300005344 Ga0070661_100003576 Ga0070661_1000035762 125
316 3300005356 Ga0070674_100062221 Ga0070674_1000622212 125
317 3300005366 Ga0070659_100042892 Ga0070659_1000428923 125
318 3300005441 Ga0070700_100097517 Ga0070700_1000975173 125
319 3300005455 Ga0070663_100526355 Ga0070663_1005263552 125
320 3300005458 Ga0070681_10061396 Ga0070681_100613963 125
321 3300005459 Ga0068867_100255124 Ga0068867_1002551242 125
322 3300005530 Ga0070679_100020197 Ga0070679_1000201977 125
323 3300005535 Ga0070684_100001851 Ga0070684_10000185111 125
324 3300005539 Ga0068853_100310344 Ga0068853_1003103442 125
325 3300005564 Ga0070664_100739022 Ga0070664_1007390222 125
326 3300005577 Ga0068857_100024451 Ga0068857_1000244514 125
327 3300005614 Ga0068856_100066185 Ga0068856_1000661854 125
328 3300005616 Ga0068852_100021413 Ga0068852_1000214136 125
329 3300006028 Ga0070717_10000204 Ga0070717_1000020431 125
330 3300006358 Ga0068871_101153453 Ga0068871_1011534532 125
331 3300006844 Ga0075428_100044156 Ga0075428_1000441564 125
332 3300006846 Ga0075430_100037116 Ga0075430_1000371162 125
333 3300006847 Ga0075431_100042067 Ga0075431_1000420674 125
334 3300006880 Ga0075429_100008016 Ga0075429_1000080166 125
335 3300009147 Ga0114129_10563426 Ga0114129_105634262 125
336 3300009147 Ga0114129_11664372 Ga0114129_116643722 125
337 3300009176 Ga0105242_12659523 Ga0105242_126595231 125
338 3300009545 Ga0105237_10077213 Ga0105237_100772134 125
339 3300010375 Ga0105239_10216614 Ga0105239_102166142 125
340 3300013102 Ga0157371_10334907 Ga0157371_103349072 125
341 3300013102 Ga0157371_11387609 Ga0157371_113876091 125
342 3300013104 Ga0157370_10025457 Ga0157370_100254573 125
343 3300013105 Ga0157369_10016156 Ga0157369_100161562 125
344 3300013307 Ga0157372_10042061 Ga0157372_100420613 125
345 3300020070 Ga0206356_10524050 Ga0206356_105240502 125
346 3300020081 Ga0206354_11624061 Ga0206354_116240612 125
347 3300020082 Ga0206353_11748275 Ga0206353_117482753 125
348 3300025899 Ga0207642_10251870 Ga0207642_102518701 125
349 3300025901 Ga0207688_10386807 Ga0207688_103868072 125
350 3300025909 Ga0207705_10074116 Ga0207705_100741163 125
351 3300025912 Ga0207707_10076266 Ga0207707_100762664 125
352 3300025913 Ga0207695_10359130 Ga0207695_103591301 125
353 3300025914 Ga0207671_10042415 Ga0207671_100424155 125
354 3300025919 Ga0207657_10027895 Ga0207657_100278953 125
355 3300025920 Ga0207649_10067077 Ga0207649_100670772 125
356 3300025920 Ga0207649_10429889 Ga0207649_104298892 125
357 3300025921 Ga0207652_10058845 Ga0207652_100588453 125
358 3300025932 Ga0207690_10038870 Ga0207690_100388702 125
359 3300025937 Ga0207669_10757132 Ga0207669_107571322 125
360 3300025944 Ga0207661_10002565 Ga0207661_100025657 125
361 3300025945 Ga0207679_10635493 Ga0207679_106354931 125
362 3300025972 Ga0207668_10200957 Ga0207668_102009572 125
363 3300026023 Ga0207677_10756071 Ga0207677_107560712 125
364 3300026041 Ga0207639_10034935 Ga0207639_100349353 125
365 3300026067 Ga0207678_10913378 Ga0207678_109133781 125
366 3300026075 Ga0207708_10641304 Ga0207708_106413042 125
367 3300026078 Ga0207702_10035724 Ga0207702_100357242 125
368 3300026116 Ga0207674_10060700 Ga0207674_100607003 125
369 3300026142 Ga0207698_10279602 Ga0207698_102796022 125
370 3300028379 Ga0268266_10458140 Ga0268266_104581402 125
371 3300031824 Ga0307413_10170784 Ga0307413_101707842 125
372 3300031852 Ga0307410_10952133 Ga0307410_109521332 125
373 3300031901 Ga0307406_11512038 Ga0307406_115120381 125
374 3300031903 Ga0307407_10296488 Ga0307407_102964882 125
375 3300031995 Ga0307409_100024015 Ga0307409_1000240153 125
376 3300031995 Ga0307409_100116564 Ga0307409_1001165643 125
377 3300031995 Ga0307409_100258278 Ga0307409_1002582783 125
378 3300032002 Ga0307416_100193769 Ga0307416_1001937692 125
379 3300032002 Ga0307416_100569022 Ga0307416_1005690222 125
380 3300032002 Ga0307416_101134002 Ga0307416_1011340022 125
381 3300032004 Ga0307414_10619279 Ga0307414_106192792 125
382 3300032126 Ga0307415_100219099 Ga0307415_1002190992 125
383 3300032126 Ga0307415_101249125 Ga0307415_1012491251 125
384 3300037466 Ga0395898_1391522 Ga0395898_1391522_84_527 125
385 3300038443 Ga0395901_1890620 Ga0395901_1890620_60_503 125
386 3300042532 Ga0450893_0047756 Ga0450893_0047756_221_661 125
387 3300044693 Ga0466961_0090881 Ga0466961_0090881_856_1299 125
388 3300044694 Ga0466963_0275453 Ga0466963_0275453_672_1112 125
389 3300044719 Ga0466971_0043933 Ga0466971_0043933_433_861 125
390 3300044765 Ga0466970_0092181 Ga0466970_0092181_637_1089 125
391 3300044765 Ga0466970_0107630 Ga0466970_0107630_591_1034 125
392 3300045976 Ga0466967_0157440 Ga0466967_0157440_1487_1921 125
393 3300046455 Ga0495603_0436353 Ga0495603_0436353_194_637 125
394 3300048924 Ga0496121_0038003 Ga0496121_0038003_1066_1530 125
395 3300049568 Ga0501031_0164255 Ga0501031_0164255_543_974 125
396 3300049568 Ga0501031_0342457 Ga0501031_0342457_116_529 125
397 3300049570 Ga0501033_0124920 Ga0501033_0124920_396_833 125
398 3300049570 Ga0501033_0558794 Ga0501033_0558794_221_658 125
399 3300049572 Ga0501036_0064942 Ga0501036_0064942_1808_2239 125
400 3300049572 Ga0501036_0551674 Ga0501036_0551674_457_894 125
401 3300049573 Ga0501037_0253214 Ga0501037_0253214_574_1005 125
402 3300049574 Ga0501038_0112952 Ga0501038_0112952_778_1215 125
403 3300049574 Ga0501038_0155936 Ga0501038_0155936_56_493 125
404 3300049575 Ga0501039_0024585 Ga0501039_0024585_3161_3592 125
405 3300049576 Ga0501040_0323834 Ga0501040_0323834_10_441 125
406 3300049577 Ga0501041_0030356 Ga0501041_0030356_2166_2597 125
407 3300049578 Ga0501042_0032100 Ga0501042_0032100_837_1274 125
408 3300049578 Ga0501042_0131604 Ga0501042_0131604_756_1187 125
409 3300049578 Ga0501042_0815248 Ga0501042_0815248_86_499 125
410 3300049579 Ga0501043_0127000 Ga0501043_0127000_1097_1534 125
411 3300049582 Ga0501048_0464796 Ga0501048_0464796_391_828 125
412 3300049582 Ga0501048_0652745 Ga0501048_0652745_238_651 125
413 3300049587 Ga0501071_0014945 Ga0501071_0014945_4046_4483 125
414 3300049587 Ga0501071_0086996 Ga0501071_0086996_964_1401 125
415 3300049587 Ga0501071_0130404 Ga0501071_0130404_201_614 125
416 3300049588 Ga0501072_0051700 Ga0501072_0051700_1977_2408 125
417 3300049588 Ga0501072_0300886 Ga0501072_0300886_587_1000 125
418 3300049589 Ga0501073_0422832 Ga0501073_0422832_45_482 125
419 3300049590 Ga0501074_0134749 Ga0501074_0134749_724_1155 125
420 3300049591 Ga0501075_0070001 Ga0501075_0070001_860_1273 125
421 3300049592 Ga0501076_0237771 Ga0501076_0237771_220_657 125
422 3300049592 Ga0501076_0347763 Ga0501076_0347763_79_516 125
423 3300049593 Ga0501077_0241477 Ga0501077_0241477_697_1134 125
424 3300049741 Ga0501079_0084818 Ga0501079_0084818_1662_2093 125
425 3300049741 Ga0501079_0162035 Ga0501079_0162035_1058_1495 125
426 3300049742 Ga0501080_0303149 Ga0501080_0303149_258_695 125
427 3300049742 Ga0501080_0331173 Ga0501080_0331173_839_1276 125
428 3300049743 Ga0501081_0499803 Ga0501081_0499803_195_608 125
429 3300049744 Ga0501083_0389687 Ga0501083_0389687_105_542 125
430 3300049744 Ga0501083_0531376 Ga0501083_0531376_28_465 125
431 3300049822 Ga0501035_0299932 Ga0501035_0299932_415_852 125
432 3300049823 Ga0501044_0593793 Ga0501044_0593793_319_756 125
433 3300049824 Ga0501045_0144940 Ga0501045_0144940_308_745 125
434 3300049824 Ga0501045_0494779 Ga0501045_0494779_45_458 125
435 3300050507 nmdc:mga05p37_382397_c1 nmdc:mga05p37_382397_c1_647_1060 125
436 3300050508 nmdc:mga09592_3695_c2 nmdc:mga09592_3695_c2_8390_8803 125
437 3300050509 nmdc:mga0qj67_32719_c1 nmdc:mga0qj67_32719_c1_1804_2217 125
438 3300050510 nmdc:mga06r32_67635_c1 nmdc:mga06r32_67635_c1_2626_3039 125
439 3300054114 Ga0501084_0261448 Ga0501084_0261448_812_1243 125
440 3300054114 Ga0501084_0291071 Ga0501084_0291071_165_602 125
441 3300054114 Ga0501084_0612899 Ga0501084_0612899_117_554 125
442 3300054114 Ga0501084_1606925 Ga0501084_1606925_51_488 125
443 3300059423 Ga0590074_048393 Ga0590074_048393_154_588 125
444 3300060353 Ga0501082_0198826 Ga0501082_0198826_332_745 125
445 3300060353 Ga0501082_0332312 Ga0501082_0332312_632_1069 125
446 3300060353 Ga0501082_0684442 Ga0501082_0684442_85_522 125
447 3300060353 Ga0501082_0739386 Ga0501082_0739386_157_588 125
448 3300060353 Ga0501082_0834793 Ga0501082_0834793_61_498 125
449 3300061719 Ga0466962_0070727 Ga0466962_0070727_810_1238 125
450 3300061734 Ga0530510_0016156 Ga0530510_0016156_29_466 125
451 3300061734 Ga0530510_0100423 Ga0530510_0100423_73_504 125
452 3300061734 Ga0530510_0182771 Ga0530510_0182771_1076_1513 125
453 3300061734 Ga0530510_0971630 Ga0530510_0971630_116_529 125
454 3300005345 Ga0070692_10960997 Ga0070692_109609971 126
455 3300005366 Ga0070659_100272044 Ga0070659_1002720442 126
456 3300005455 Ga0070663_100951065 Ga0070663_1009510652 126
457 3300005466 Ga0070685_10062869 Ga0070685_100628692 126
458 3300005535 Ga0070684_100141023 Ga0070684_1001410233 126
459 3300005544 Ga0070686_100384943 Ga0070686_1003849432 126
460 3300005578 Ga0068854_100234754 Ga0068854_1002347542 126
461 3300005615 Ga0070702_100634647 Ga0070702_1006346471 126
462 3300005616 Ga0068852_100081129 Ga0068852_1000811295 126
463 3300005718 Ga0068866_10074974 Ga0068866_100749742 126
464 3300005834 Ga0068851_10261910 Ga0068851_102619102 126
465 3300005981 Ga0081538_10203046 Ga0081538_102030462 126
466 3300006881 Ga0068865_100199222 Ga0068865_1001992222 126
467 3300006881 Ga0068865_100598333 Ga0068865_1005983332 126
468 3300009174 Ga0105241_11718317 Ga0105241_117183171 126
469 3300013307 Ga0157372_10708461 Ga0157372_107084612 126
470 3300014325 Ga0163163_11228628 Ga0163163_112286282 126
471 3300014745 Ga0157377_10222026 Ga0157377_102220261 126
472 3300025899 Ga0207642_10313072 Ga0207642_103130722 126
473 3300025908 Ga0207643_10089427 Ga0207643_100894273 126
474 3300025923 Ga0207681_10191312 Ga0207681_101913122 126
475 3300025942 Ga0207689_10578316 Ga0207689_105783162 126
476 3300025944 Ga0207661_10959205 Ga0207661_109592052 126
477 3300025981 Ga0207640_10588998 Ga0207640_105889982 126
478 3300034819 Ga0373958_0058167 Ga0373958_0058167_31_471 126
479 3300042009 Ga0439451_129331 Ga0439451_129331_25_471 126
480 3300042011 Ga0439454_011991 Ga0439454_011991_317_763 126
481 3300042120 Ga0450917_001796 Ga0450917_001796_457_906 126
482 3300042157 Ga0439458_0042077 Ga0439458_0042077_83_532 126
483 3300042439 Ga0439464_0167416 Ga0439464_0167416_98_547 126
484 3300042461 Ga0439460_0092358 Ga0439460_0092358_101_550 126
485 3300046457 Ga0495590_0319154 Ga0495590_0319154_91_528 126
486 3300046500 Ga0495596_0155880 Ga0495596_0155880_262_702 126
487 3300046522 Ga0495643_0250533 Ga0495643_0250533_259_699 126
488 3300046615 Ga0495656_0053931 Ga0495656_0053931_685_1125 126
489 3300046694 Ga0495649_0455551 Ga0495649_0455551_92_532 126
490 3300046794 Ga0495589_0155531 Ga0495589_0155531_505_945 126
491 3300047445 Ga0495677_0267053 Ga0495677_0267053_186_626 126
492 3300047472 Ga0495686_0307509 Ga0495686_0307509_59_526 126
493 3300048906 Ga0496103_0352140 Ga0496103_0352140_198_641 126
494 3300048907 Ga0496104_0909719 Ga0496104_0909719_257_709 126
495 3300048915 Ga0496112_0065235 Ga0496112_0065235_2632_3099 126
496 3300048916 Ga0496113_0037888 Ga0496113_0037888_1633_2100 126
497 3300048917 Ga0496114_1270873 Ga0496114_1270873_128_568 126
498 3300048927 Ga0496124_0059124 Ga0496124_0059124_2516_2968 126
499 3300048929 Ga0496126_0260656 Ga0496126_0260656_309_740 126
500 3300049590 Ga0501074_1165306 Ga0501074_1165306_83_529 126
501 3300050508 nmdc:mga09592_1365615_c1 nmdc:mga09592_1365615_c1_129_563 126
502 3300050508 nmdc:mga09592_702483_c1 nmdc:mga09592_702483_c1_304_744 126
503 3300050511 nmdc:mga08y16_489840_c1 nmdc:mga08y16_489840_c1_425_865 126
504 3300053083 Ga0495655_0207360 Ga0495655_0207360_163_606 126
505 3300006173 Ga0070716_101091069 Ga0070716_1010910691 127
506 3300006175 Ga0070712_100001989 Ga0070712_1000019895 127
507 3300025915 Ga0207693_10003339 Ga0207693_1000333912 127
508 3300025936 Ga0207670_10207786 Ga0207670_102077862 127
509 3300025944 Ga0207661_10371391 Ga0207661_103713912 127
510 3300025981 Ga0207640_10414098 Ga0207640_104140982 127
511 3300028654 Ga0265322_10085177 Ga0265322_100851772 127
512 3300028800 Ga0265338_10016147 Ga0265338_100161477 127
513 3300031901 Ga0307406_10149981 Ga0307406_101499812 127
514 3300037418 Ga0395900_0441974 Ga0395900_0441974_11_475 127
515 3300037471 Ga0395905_0362688 Ga0395905_0362688_611_1078 127
516 3300038443 Ga0395901_0213804 Ga0395901_0213804_943_1407 127
517 3300044658 Ga0466972_0134075 Ga0466972_0134075_168_620 127
518 3300044684 Ga0466966_0327557 Ga0466966_0327557_197_646 127
519 3300044693 Ga0466961_0049561 Ga0466961_0049561_1601_2050 127
520 3300046477 Ga0495664_0001128 Ga0495664_0001128_4836_5327 127
521 3300046529 Ga0495652_0280897 Ga0495652_0280897_561_1052 127
522 3300046615 Ga0495656_0107603 Ga0495656_0107603_405_854 127
523 3300046809 Ga0495600_0003671 Ga0495600_0003671_2965_3456 127
524 3300047317 Ga0495604_0000144 Ga0495604_0000144_1503_2018 127
525 3300048905 Ga0496102_0000076 Ga0496102_0000076_58564_59055 127
526 3300048906 Ga0496103_0000367 Ga0496103_0000367_282_773 127
527 3300048913 Ga0496110_0750926 Ga0496110_0750926_311_772 127
528 3300048917 Ga0496114_0058459 Ga0496114_0058459_1315_1743 127
529 3300049577 Ga0501041_0185212 Ga0501041_0185212_501_920 127
530 3300050492 nmdc:mga0yw44_1036288_c1 nmdc:mga0yw44_1036288_c1_81_506 127
531 3300053077 Ga0495601_0118672 Ga0495601_0118672_86_577 127
532 3300005981 Ga0081538_10009306 Ga0081538_100093064 128
533 3300005981 Ga0081538_10012436 Ga0081538_100124365 128
534 3300009093 Ga0105240_10532049 Ga0105240_105320492 128
535 3300025923 Ga0207681_10025691 Ga0207681_100256915 128
536 3300028573 Ga0265334_10215867 Ga0265334_102158672 128
537 3300028800 Ga0265338_10273271 Ga0265338_102732712 128
538 3300039450 Ga0436363_1508741 Ga0436363_1508741_160_591 128
539 3300042438 Ga0439459_0166096 Ga0439459_0166096_31_471 128
540 3300042461 Ga0439460_0165082 Ga0439460_0165082_209_649 128
541 3300046691 Ga0495670_0562605 Ga0495670_0562605_145_597 128
542 3300048911 Ga0496108_0318919 Ga0496108_0318919_313_762 128
543 3300048916 Ga0496113_0528094 Ga0496113_0528094_149_598 128
544 3300059421 Ga0590071_132498 Ga0590071_132498_161_595 128
545 3300005981 Ga0081538_10181542 Ga0081538_101815422 129
546 3300046461 Ga0495641_0261773 Ga0495641_0261773_346_765 129
547 3300047321 Ga0495676_0347653 Ga0495676_0347653_253_672 129
548 3300009093 Ga0105240_10009093 Ga0105240_100090935 130
549 3300048907 Ga0496104_0000034 Ga0496104_0000034_125321_125830 130
550 3300048913 Ga0496110_0002022 Ga0496110_0002022_1577_2086 130
551 3300048914 Ga0496111_0001077 Ga0496111_0001077_1581_2090 130
552 3300005981 Ga0081538_10002778 Ga0081538_1000277817 131
553 3300038443 Ga0395901_0778790 Ga0395901_0778790_231_698 131
554 3300003373 JGI25407J50210_10003360 JGI25407J50210_100033606 132
555 3300005981 Ga0081538_10000171 Ga0081538_1000017134 132
556 3300028563 Ga0265319_1000093 Ga0265319_100009324 132
557 3300048917 Ga0496114_1035116 Ga0496114_1035116_73_528 132
558 3300049576 Ga0501040_0160086 Ga0501040_0160086_717_1157 132
559 3300049587 Ga0501071_0201263 Ga0501071_0201263_299_739 132
560 3300049588 Ga0501072_0078276 Ga0501072_0078276_1521_1961 132
561 3300049591 Ga0501075_0087016 Ga0501075_0087016_860_1300 132
562 3300049741 Ga0501079_0263116 Ga0501079_0263116_440_880 132
563 3300049743 Ga0501081_0078034 Ga0501081_0078034_1187_1627 132
564 3300054114 Ga0501084_0236975 Ga0501084_0236975_1074_1514 132
565 3300060353 Ga0501082_0102730 Ga0501082_0102730_1397_1837 132
566 3300000549 LJQas_1008877 LJQas_10088772 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02152

FolB

Dihydroneopterin aldolase

46

154

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sql-assembly2.cif.gz_L crystal structure of 7,8-dihydroneopterin aldolase in complex with guanine 0.8595 18 133
3o1k-assembly1.cif.gz_B crystal structure of putative dihydroneopterin aldolase (folb) from vibrio cholerae o1 biovar el tor str. n16961 0.8547 18 133
5f3m-assembly1.cif.gz_A crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . 0.8535 18 133
7su6-assembly1.cif.gz_C dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin 0.8505 18 133
7su6-assembly1.cif.gz_A-2 dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin 0.85 18 133
ID Description Score Start End Superfamily
af_A0A0R0J0C6_26_148_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8616 18 132 3.30.1130.10
2nm2B00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8571 16 132 3.30.1130.10
2cg8A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8464 18 133 3.30.1130.10
5farH00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8451 18 133 3.30.1130.10
2o9mC00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8369 18 132 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A1M3BJ33-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8975 18 133 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A7V9RII7-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8968 18 132 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A1Q7X116-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.894 18 133 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-S9ZS14-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.892 18 133 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A7M2YX50-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8916 18 133 GO:0004150
GO:0005737
GO:0046654
GO:0046656

Feature Viewer

pLDDT pTM Quality
73.21 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map