F464442

General Info

Members Datasets Scaffolds Average Seq Length
566 263 1132 304

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0022756|Ga0496123_0022756_945_2129
Length 360
Sequence VAAGFATTGIDATDGPVRGRVLVILPSQYKKLCCEVYWHCTGFVTKHKPMNPNTPALTTHRRLSDETAGMLLGLIGVAIFSLTLPFTRLAVSGGMAGGLSPMFVALGRALTAAILAAGWLYCKRAPLPPRSAVPALAMVAIGCVIGFPWLTSIAMRTLPAAHGAVLVGVLPLATALFAALLGGEKPSQGFWIMAILGSVLVIGFALRQSGGSLHPADLAIFVAVLLAAMGYAAGGRLSQTLGGQQTICWALILAAPPLLPVVGWLAWQDSAQLAHASAAAWTGFAYVSVFSMFIGFFFWYRGMALGGVARVGQVQLVQPFLSVLGATVVLGETLEWPTLAFAIAVIATVAAGRKMQVKRG

Samples

Sample ID Description Type Environment
1 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
208 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
213 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
219 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
220 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
224 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
229 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
230 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
231 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
234 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
235 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
236 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
237 2643221638 Duganella sp. Root336D2 Isolate Unclassified
238 2738541357 Duganella sp. GV053 Isolate Unclassified
239 2738543003 Duganella sp. GV066 Isolate Unclassified
240 2738543018 Massilia sp. GV045 Isolate Unclassified
241 2738543026 Duganella sp. GV089 Isolate Unclassified
242 2738543029 Duganella sp. GV039 Isolate Unclassified
243 2738543030 Massilia sp. GV097 Isolate Unclassified
244 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
245 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
246 2818991436 Collimonas arenae 515 Isolate Unclassified
247 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
248 2821131069 Duganella sp. 1224 Isolate Unclassified
249 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
250 2842711865 Duganella sp. R-73148 Isolate Unclassified
251 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
252 2857553236 Duganella sp. R-74557 Isolate Unclassified
253 2857558681 Duganella sp. R-74565 Isolate Unclassified
254 2857564685 Duganella sp. R-74599 Isolate Unclassified
255 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
256 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
257 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
258 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
259 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
260 2904424332 Duganella sp. 1411 Isolate Rhizosphere
261 2919476304 Duganella sp. 3397 Isolate Unclassified
262 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
263 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 0
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.96
Nodule 1.06
Rhizoplane 2.47
Rhizosphere 62.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496123_0022756 3300048926 Bacteria 4819
2 JGI25155J39150_1000284 3300002704 Bacteria 18276
3 JGI25155J39150_1000359 3300002704 Bacteria 14221
4 JGI25156J39149_1000110 3300002705 Bacteria 59456
5 JGI25162J39368_1000091 3300002737 Bacteria 101521
6 JGI25162J39368_1004743 3300002737 Bacteria 2996
7 JGI25154J39366_1000117 3300002738 Bacteria 65094
8 JGI25154J39366_1000231 3300002738 Bacteria 37387
9 JGI25154J39366_1001222 3300002738 Bacteria 9699
10 JGI25158J39367_1000664 3300002739 Bacteria 6716
11 JGI25157J39369_1000705 3300002741 Bacteria 18005
12 JGI25163J39215_1002784 3300002771 Bacteria 1628
13 JGI25152J39213_1000011 3300002773 Bacteria 130992
14 JGI25150J39212_1000192 3300002774 Bacteria 34489
15 JGI25159J45721_1002888 3300002987 Bacteria 6275
16 JGI25159J45721_1005248 3300002987 Bacteria 4096
17 JGI25165J46597_1000172 3300003214 Bacteria 101521
18 JGI25153J46596_10000177 3300003215 Bacteria 63555
19 JGI25153J46596_10017322 3300003215 Bacteria 2842
20 rootL2_10030296 3300003322 Bacteria 8873
21 JGI25161J50226_1000320 3300003374 Bacteria 26259
22 Ga0055538_1000063 3300003751 Bacteria 101521
23 Ga0055539_1000096 3300003752 Bacteria 101521
24 Ga0055533_1000107 3300003756 Bacteria 101521
25 Ga0055532_1000015 3300003758 Bacteria 340197
26 Ga0055525_1000140 3300003759 Bacteria 101521
27 Ga0055535_1009130 3300003761 Bacteria 1732
28 Ga0055529_1000390 3300003763 Bacteria 47242
29 Ga0055526_1000074 3300003771 Bacteria 92854
30 Ga0055526_1000086 3300003771 Bacteria 86198
31 Ga0055526_1000092 3300003771 Bacteria 82076
32 Ga0055526_1003041 3300003771 Bacteria 10901
33 Ga0055537_1000012 3300003773 Bacteria 133761
34 Ga0055524_1000021 3300003775 Bacteria 227578
35 Ga0055524_1000099 3300003775 Bacteria 107171
36 Ga0055524_1000917 3300003775 Bacteria 19044
37 Ga0055534_1000436 3300003784 Bacteria 24676
38 Ga0055534_1009245 3300003784 Bacteria 2158
39 Ga0055528_1000134 3300003790 Bacteria 60071
40 Ga0055531_10001186 3300003794 Bacteria 20002
41 Ga0055541_1000064 3300003841 Bacteria 101521
42 Ga0055543_1000224 3300004625 Bacteria 45523
43 Ga0055543_1001825 3300004625 Bacteria 7803
44 Ga0055543_1009139 3300004625 Bacteria 2151
45 Ga0065165_1000055 3300005262 Bacteria 187003
46 Ga0065165_1001224 3300005262 Bacteria 29476
47 Ga0065165_1013965 3300005262 Bacteria 3147
48 Ga0065165_1023108 3300005262 Bacteria 2116
49 Ga0065704_10191543 3300005289 Bacteria 1187
50 Ga0070658_10206342 3300005327 Bacteria 1659
51 Ga0068855_100029241 3300005563 Bacteria 6590
52 Ga0068855_100077054 3300005563 Bacteria 3868
53 Ga0068856_100046976 3300005614 Bacteria 4253
54 Ga0068852_100173688 3300005616 Bacteria 2022
55 Ga0068852_100179309 3300005616 Bacteria 1991
56 Ga0068862_100064282 3300005844 Bacteria 3158
57 Ga0070712_100069526 3300006175 Bacteria 2512
58 Ga0075428_100125369 3300006844 Bacteria 2794
59 Ga0068865_100096889 3300006881 Bacteria 2152
60 Ga0079104_1022921 3300006946 Bacteria 1670
61 Ga0099826_10000002 3300006948 Bacteria 1125830
62 Ga0105251_10058809 3300009011 Bacteria 1814
63 Ga0105244_10007123 3300009036 Bacteria 7145
64 Ga0105244_10008840 3300009036 Bacteria 6253
65 Ga0105244_10026932 3300009036 Bacteria 3106
66 Ga0105243_10315853 3300009148 Bacteria 1422
67 Ga0105242_10420895 3300009176 Bacteria 1252
68 Ga0105238_10223668 3300009551 Bacteria 1859
69 Ga0105239_10503697 3300010375 Bacteria 1377
70 Ga0157371_10000078 3300013102 Bacteria 154095
71 Ga0182008_10006868 3300014497 Bacteria 6326
72 Ga0182006_1000026 3300015261 Bacteria 253543
73 Ga0182006_1000097 3300015261 Bacteria 102186
74 Ga0182006_1011001 3300015261 Bacteria 3996
75 Ga0182007_10000227 3300015262 Bacteria 37880
76 Ga0182007_10006048 3300015262 Bacteria 5232
77 Ga0182005_1000007 3300015265 Bacteria 490994
78 Ga0182005_1000038 3300015265 Bacteria 160030
79 Ga0182005_1000505 3300015265 Bacteria 19944
80 Ga0163161_10041925 3300017792 Bacteria 3290
81 Ga0163161_10073546 3300017792 Bacteria 2504
82 Ga0213872_10088621 3300021361 Bacteria 1386
83 Ga0209435_100021 3300025206 Bacteria 223961
84 Ga0209435_100163 3300025206 Bacteria 21322
85 Ga0209436_100144 3300025208 Bacteria 34421
86 Ga0209784_100079 3300025224 Bacteria 136351
87 Ga0209566_100093 3300025225 Bacteria 136351
88 Ga0209674_100115 3300025226 Bacteria 136351
89 Ga0209147_100004 3300025229 Bacteria 1371850
90 Ga0209563_100007 3300025230 Bacteria 1579402
91 Ga0209563_100113 3300025230 Bacteria 136351
92 Ga0209437_100045 3300025233 Bacteria 429809
93 Ga0209437_100176 3300025233 Bacteria 136351
94 Ga0209258_100083 3300025242 Bacteria 246008
95 Ga0207425_1000001 3300025245 Bacteria 2525432
96 Ga0207425_1000059 3300025245 Bacteria 146258
97 Ga0209646_1000010 3300025246 Bacteria 573803
98 Ga0209646_1000020 3300025246 Bacteria 462204
99 Ga0209646_1000074 3300025246 Bacteria 223961
100 Ga0209026_1000058 3300025250 Bacteria 228656
101 Ga0209026_1001283 3300025250 Bacteria 11393
102 Ga0209026_1004032 3300025250 Bacteria 4547
103 Ga0209677_100072 3300025253 Bacteria 136351
104 Ga0209677_103791 3300025253 Bacteria 4694
105 Ga0209759_1000046 3300025256 Bacteria 230149
106 Ga0209759_1000073 3300025256 Bacteria 178048
107 Ga0209129_1000001 3300025258 Bacteria 1452436
108 Ga0209233_1000183 3300025261 Bacteria 136351
109 Ga0209565_1000057 3300025263 Bacteria 196908
110 Ga0209565_1004533 3300025263 Bacteria 4199
111 Ga0209455_1000037 3300025272 Bacteria 464097
112 Ga0209673_1000051 3300025273 Bacteria 282161
113 Ga0209130_1000197 3300025284 Bacteria 82611
114 Ga0209130_1000588 3300025284 Bacteria 35429
115 Ga0209130_1004697 3300025284 Bacteria 5057
116 Ga0209675_1000027 3300025291 Bacteria 282175
117 Ga0209675_1001414 3300025291 Bacteria 13876
118 Ga0209025_1023174 3300025294 Bacteria 3257
119 Ga0209564_1000009 3300025295 Bacteria 950196
120 Ga0209564_1000033 3300025295 Bacteria 446200
121 Ga0209564_1000094 3300025295 Bacteria 243176
122 Ga0209564_1014621 3300025295 Bacteria 3248
123 Ga0209758_1000033 3300025297 Bacteria 469998
124 Ga0209758_1000073 3300025297 Bacteria 276262
125 Ga0209758_1000227 3300025297 Bacteria 120073
126 Ga0209758_1004049 3300025297 Bacteria 12629
127 Ga0209050_1000046 3300025298 Bacteria 386466
128 Ga0209050_1000269 3300025298 Bacteria 111072
129 Ga0209050_1013081 3300025298 Bacteria 3731
130 Ga0209050_1024836 3300025298 Bacteria 2058
131 Ga0209256_1000044 3300025299 Bacteria 337264
132 Ga0209256_1000116 3300025299 Bacteria 169876
133 Ga0209256_1000139 3300025299 Bacteria 155515
134 Ga0209256_1000145 3300025299 Bacteria 150609
135 Ga0207426_1006629 3300025302 Bacteria 4983
136 Ga0207426_1012949 3300025302 Bacteria 3112
137 Ga0207426_1036941 3300025302 Bacteria 1549
138 Ga0209257_1000068 3300025304 Bacteria 341291
139 Ga0209257_1000239 3300025304 Bacteria 128383
140 Ga0209257_1008912 3300025304 Bacteria 5526
141 Ga0209257_1028456 3300025304 Bacteria 1838
142 Ga0207655_1009719 3300025728 Bacteria 5935
143 Ga0207655_1010839 3300025728 Bacteria 5490
144 Ga0207705_10004777 3300025909 Bacteria 10200
145 Ga0207654_10048890 3300025911 Bacteria 2423
146 Ga0207695_10004054 3300025913 Bacteria 20140
147 Ga0207695_10285792 3300025913 Bacteria 1542
148 Ga0207693_10228504 3300025915 Bacteria 1461
149 Ga0207657_10101987 3300025919 Bacteria 2380
150 Ga0207657_10476766 3300025919 Bacteria 978
151 Ga0207694_10092084 3300025924 Bacteria 2393
152 Ga0207694_10145587 3300025924 Bacteria 1907
153 Ga0207706_10115916 3300025933 Bacteria 2356
154 Ga0207704_10050448 3300025938 Bacteria 2510
155 Ga0207667_10016858 3300025949 Bacteria 8240
156 Ga0207667_10049408 3300025949 Bacteria 4442
157 Ga0207667_10176600 3300025949 Bacteria 2194
158 Ga0207702_10030896 3300026078 Bacteria 4464
159 Ga0207698_10244247 3300026142 Bacteria 1638
160 Ga0207698_10404681 3300026142 Bacteria 1305
161 Ga0209282_1000001 3300027666 Bacteria 2450367
162 Ga0268265_10002366 3300028380 Bacteria 14272
163 Ga0307513_10117821 3300031456 Bacteria 2632
164 Ga0307408_100001025 3300031548 Bacteria 21471
165 Ga0307408_100006114 3300031548 Bacteria 8004
166 Ga0307408_100014545 3300031548 Bacteria 5228
167 Ga0395899_0003263 3300037312 Bacteria 12860
168 Ga0395899_0006655 3300037312 Bacteria 8955
169 Ga0395899_0009771 3300037312 Bacteria 7361
170 Ga0395899_0011753 3300037312 Bacteria 6700
171 Ga0395899_0018969 3300037312 Bacteria 5226
172 Ga0395900_0000393 3300037418 Bacteria 63296
173 Ga0395900_0001606 3300037418 Bacteria 26645
174 Ga0395900_0006618 3300037418 Bacteria 12059
175 Ga0395900_0010222 3300037418 Bacteria 9596
176 Ga0395900_0140847 3300037418 Bacteria 2469
177 Ga0395898_0015586 3300037466 Bacteria 7792
178 Ga0395898_0033549 3300037466 Bacteria 5121
179 Ga0395905_0000455 3300037471 Bacteria 57161
180 Ga0395905_0059442 3300037471 Bacteria 3573
181 Ga0395901_0000054 3300038443 Bacteria 160505
182 Ga0395901_0002967 3300038443 Bacteria 17118
183 Ga0395901_0009279 3300038443 Bacteria 9973
184 Ga0395901_0009778 3300038443 Bacteria 9725
185 Ga0395901_0068798 3300038443 Bacteria 3688
186 Ga0439448_0030272 3300042005 Bacteria 1716
187 Ga0439458_0020240 3300042157 Bacteria 1536
188 Ga0466972_0000163 3300044658 Bacteria 53265
189 Ga0466972_0014599 3300044658 Bacteria 3932
190 Ga0466965_0017485 3300044683 Bacteria 3428
191 Ga0466965_0072542 3300044683 Bacteria 1732
192 Ga0466965_0149209 3300044683 Bacteria 1221
193 Ga0466966_0006906 3300044684 Bacteria 7521
194 Ga0466964_0009038 3300044706 Bacteria 3747
195 Ga0466968_0006093 3300044735 Bacteria 4530
196 Ga0466968_0027908 3300044735 Bacteria 2325
197 Ga0466970_0009193 3300044765 Bacteria 4986
198 Ga0466957_0002945 3300044842 Bacteria 9226
199 Ga0466959_0002491 3300045049 Bacteria 11792
200 Ga0466967_0075933 3300045976 Bacteria 3021
201 Ga0495617_000037 3300046452 Bacteria 134553
202 Ga0495617_004402 3300046452 Bacteria 5133
203 Ga0495627_000007 3300046453 Bacteria 575915
204 Ga0495627_011001 3300046453 Bacteria 3261
205 Ga0495627_058164 3300046453 Bacteria 1149
206 Ga0495592_0018741 3300046454 Bacteria 5268
207 Ga0495591_000218 3300046458 Bacteria 57622
208 Ga0495591_013480 3300046458 Bacteria 2988
209 Ga0495638_0000525 3300046460 Bacteria 44714
210 Ga0495638_0039264 3300046460 Bacteria 3005
211 Ga0495638_0041783 3300046460 Bacteria 2899
212 Ga0495638_0050710 3300046460 Bacteria 2591
213 Ga0495638_0199697 3300046460 Bacteria 1130
214 Ga0495651_0001054 3300046462 Bacteria 21337
215 Ga0495651_0196856 3300046462 Bacteria 1413
216 Ga0495653_0000002 3300046463 Bacteria 507262
217 Ga0495650_0000156 3300046471 Bacteria 155338
218 Ga0495650_0000166 3300046471 Bacteria 146047
219 Ga0495650_0008179 3300046471 Bacteria 6148
220 Ga0495650_0030138 3300046471 Bacteria 2461
221 Ga0495605_0000059 3300046474 Bacteria 146371
222 Ga0495605_0003743 3300046474 Bacteria 9029
223 Ga0495605_0007373 3300046474 Bacteria 6245
224 Ga0495605_0022799 3300046474 Bacteria 3300
225 Ga0495605_0114990 3300046474 Bacteria 1224
226 Ga0495584_0000842 3300046491 Bacteria 19886
227 Ga0495584_0002208 3300046491 Bacteria 11100
228 Ga0495584_0022494 3300046491 Bacteria 3198
229 Ga0495584_0090359 3300046491 Bacteria 1544
230 Ga0495585_0000282 3300046492 Bacteria 50936
231 Ga0495585_0001540 3300046492 Bacteria 17908
232 Ga0495585_0002719 3300046492 Bacteria 12362
233 Ga0495585_0009970 3300046492 Bacteria 5677
234 Ga0495585_0012419 3300046492 Bacteria 5018
235 Ga0495585_0030062 3300046492 Bacteria 3090
236 Ga0495585_0043491 3300046492 Bacteria 2512
237 Ga0495585_0085496 3300046492 Bacteria 1704
238 Ga0495585_0087344 3300046492 Bacteria 1683
239 Ga0495585_0124215 3300046492 Bacteria 1363
240 Ga0495596_0000236 3300046500 Bacteria 37630
241 Ga0495596_0026206 3300046500 Bacteria 2350
242 Ga0495596_0094330 3300046500 Bacteria 1161
243 Ga0495607_0000720 3300046501 Bacteria 31834
244 Ga0495607_0002743 3300046501 Bacteria 14044
245 Ga0495607_0028819 3300046501 Bacteria 3420
246 Ga0495607_0030127 3300046501 Bacteria 3334
247 Ga0495607_0060766 3300046501 Bacteria 2149
248 Ga0495607_0079609 3300046501 Bacteria 1804
249 Ga0495583_0000035 3300046506 Bacteria 246849
250 Ga0495583_0000533 3300046506 Bacteria 53778
251 Ga0495583_0015439 3300046506 Bacteria 4153
252 Ga0495583_0146012 3300046506 Bacteria 982
253 Ga0495606_0000011 3300046507 Bacteria 296816
254 Ga0495606_0000156 3300046507 Bacteria 118821
255 Ga0495606_0001370 3300046507 Bacteria 32980
256 Ga0495606_0013757 3300046507 Bacteria 6368
257 Ga0495606_0017341 3300046507 Bacteria 5449
258 Ga0495606_0018661 3300046507 Bacteria 5192
259 Ga0495606_0024090 3300046507 Bacteria 4397
260 Ga0495606_0061816 3300046507 Bacteria 2393
261 Ga0495608_0006692 3300046511 Bacteria 8170
262 Ga0495608_0014117 3300046511 Bacteria 5543
263 Ga0495610_0002417 3300046512 Bacteria 15726
264 Ga0495610_0014767 3300046512 Bacteria 4572
265 Ga0495610_0023778 3300046512 Bacteria 3322
266 Ga0495610_0051345 3300046512 Bacteria 2007
267 Ga0495610_0061409 3300046512 Bacteria 1785
268 Ga0495610_0087120 3300046512 Bacteria 1421
269 Ga0495616_0001160 3300046513 Bacteria 18645
270 Ga0495616_0009093 3300046513 Bacteria 5827
271 Ga0495616_0013212 3300046513 Bacteria 4666
272 Ga0495616_0028329 3300046513 Bacteria 2966
273 Ga0495616_0028692 3300046513 Bacteria 2944
274 Ga0495616_0030695 3300046513 Bacteria 2821
275 Ga0495616_0070380 3300046513 Bacteria 1693
276 Ga0495618_0038079 3300046514 Bacteria 3021
277 Ga0495628_0003780 3300046516 Bacteria 13478
278 Ga0495628_0005081 3300046516 Bacteria 11565
279 Ga0495631_0001988 3300046518 Bacteria 11954
280 Ga0495631_0004070 3300046518 Bacteria 7855
281 Ga0495631_0018177 3300046518 Bacteria 3313
282 Ga0495631_0019851 3300046518 Bacteria 3146
283 Ga0495631_0030489 3300046518 Bacteria 2446
284 Ga0495631_0053157 3300046518 Bacteria 1768
285 Ga0495632_0001939 3300046519 Bacteria 16513
286 Ga0495632_0011971 3300046519 Bacteria 5030
287 Ga0495632_0035643 3300046519 Bacteria 2537
288 Ga0495632_0133679 3300046519 Bacteria 1153
289 Ga0495637_0000004 3300046520 Bacteria 589740
290 Ga0495637_0000230 3300046520 Bacteria 43334
291 Ga0495637_0111875 3300046520 Bacteria 1057
292 Ga0495643_0000170 3300046522 Bacteria 103438
293 Ga0495643_0002817 3300046522 Bacteria 13272
294 Ga0495643_0013083 3300046522 Bacteria 4983
295 Ga0495643_0059271 3300046522 Bacteria 2035
296 Ga0495643_0119259 3300046522 Bacteria 1335
297 Ga0495644_0006414 3300046523 Bacteria 4558
298 Ga0495644_0007598 3300046523 Bacteria 4178
299 Ga0495644_0014135 3300046523 Bacteria 3058
300 Ga0495644_0016693 3300046523 Bacteria 2809
301 Ga0495644_0018970 3300046523 Bacteria 2625
302 Ga0495644_0020066 3300046523 Bacteria 2550
303 Ga0495648_0000001 3300046524 Bacteria 696872
304 Ga0495648_0001030 3300046524 Bacteria 28338
305 Ga0495648_0005449 3300046524 Bacteria 10562
306 Ga0495648_0005800 3300046524 Bacteria 10179
307 Ga0495648_0018466 3300046524 Bacteria 4935
308 Ga0495648_0043686 3300046524 Bacteria 2806
309 Ga0495663_0030430 3300046525 Bacteria 1600
310 Ga0495642_0005908 3300046528 Bacteria 4694
311 Ga0495642_0010902 3300046528 Bacteria 3484
312 Ga0495642_0137711 3300046528 Bacteria 1053
313 Ga0495652_0008038 3300046529 Bacteria 9667
314 Ga0495652_0090958 3300046529 Bacteria 2495
315 Ga0495654_0000028 3300046530 Bacteria 223384
316 Ga0495654_0023794 3300046530 Bacteria 3170
317 Ga0495609_0002199 3300046538 Bacteria 12226
318 Ga0495609_0003695 3300046538 Bacteria 8661
319 Ga0495609_0003800 3300046538 Bacteria 8503
320 Ga0495609_0004814 3300046538 Bacteria 7280
321 Ga0495609_0016896 3300046538 Bacteria 3396
322 Ga0495609_0034208 3300046538 Bacteria 2304
323 Ga0495609_0085294 3300046538 Bacteria 1377
324 Ga0495597_0000289 3300046542 Bacteria 45132
325 Ga0495597_0002615 3300046542 Bacteria 11204
326 Ga0495597_0007644 3300046542 Bacteria 5470
327 Ga0495597_0031535 3300046542 Bacteria 2410
328 Ga0495645_0017644 3300046543 Bacteria 5115
329 Ga0495645_0059193 3300046543 Bacteria 2778
330 Ga0495622_0000087 3300046557 Bacteria 82912
331 Ga0495622_0053206 3300046557 Bacteria 1878
332 Ga0495622_0071340 3300046557 Bacteria 1603
333 Ga0495633_0000727 3300046558 Bacteria 29818
334 Ga0495633_0001004 3300046558 Bacteria 23116
335 Ga0495633_0001667 3300046558 Bacteria 16758
336 Ga0495633_0002672 3300046558 Bacteria 12403
337 Ga0495633_0006941 3300046558 Bacteria 6620
338 Ga0495633_0016794 3300046558 Bacteria 3760
339 Ga0495633_0018092 3300046558 Bacteria 3584
340 Ga0495633_0021984 3300046558 Bacteria 3182
341 Ga0495633_0035211 3300046558 Bacteria 2404
342 Ga0495633_0085855 3300046558 Bacteria 1463
343 Ga0495668_0000048 3300046616 Bacteria 217867
344 Ga0495668_0000185 3300046616 Bacteria 92731
345 Ga0495668_0000378 3300046616 Bacteria 59112
346 Ga0495668_0002254 3300046616 Bacteria 16242
347 Ga0495668_0022303 3300046616 Bacteria 3620
348 Ga0495668_0022871 3300046616 Bacteria 3570
349 Ga0495668_0257963 3300046616 Bacteria 954
350 Ga0495611_0000778 3300046648 Bacteria 17723
351 Ga0495611_0003825 3300046648 Bacteria 6566
352 Ga0495611_0031129 3300046648 Bacteria 2347
353 Ga0495611_0051801 3300046648 Bacteria 1851
354 Ga0495611_0095686 3300046648 Bacteria 1374
355 Ga0495625_0000164 3300046660 Bacteria 103037
356 Ga0495625_0000372 3300046660 Bacteria 68695
357 Ga0495625_0000925 3300046660 Bacteria 39454
358 Ga0495625_0001300 3300046660 Bacteria 31240
359 Ga0495625_0130366 3300046660 Bacteria 1703
360 Ga0495659_0003759 3300046664 Bacteria 4826
361 Ga0495661_0002081 3300046665 Bacteria 15698
362 Ga0495661_0002174 3300046665 Bacteria 15309
363 Ga0495661_0003078 3300046665 Bacteria 12540
364 Ga0495661_0025875 3300046665 Bacteria 3784
365 Ga0495661_0034146 3300046665 Bacteria 3202
366 Ga0495661_0049235 3300046665 Bacteria 2556
367 Ga0495661_0123422 3300046665 Bacteria 1427
368 Ga0495661_0161765 3300046665 Bacteria 1201
369 Ga0495661_0170305 3300046665 Bacteria 1162
370 Ga0495588_0065241 3300046674 Bacteria 1888
371 Ga0495657_0169287 3300046675 Bacteria 1346
372 Ga0495599_0001150 3300046678 Bacteria 14996
373 Ga0495623_0014783 3300046679 Bacteria 5045
374 Ga0495623_0026212 3300046679 Bacteria 3753
375 Ga0495646_0005539 3300046680 Bacteria 7985
376 Ga0495646_0010931 3300046680 Bacteria 5764
377 Ga0495669_0003235 3300046684 Bacteria 6701
378 Ga0495669_0007213 3300046684 Bacteria 4658
379 Ga0495669_0008369 3300046684 Bacteria 4347
380 Ga0495624_0020213 3300046690 Bacteria 4435
381 Ga0495670_0028974 3300046691 Bacteria 2746
382 Ga0495671_0000001 3300046692 Bacteria 1169494
383 Ga0495671_0007946 3300046692 Bacteria 6001
384 Ga0495671_0013142 3300046692 Bacteria 4495
385 Ga0495671_0117202 3300046692 Bacteria 1300
386 Ga0495649_0000825 3300046694 Bacteria 24917
387 Ga0495649_0008171 3300046694 Bacteria 6311
388 Ga0495649_0014919 3300046694 Bacteria 4440
389 Ga0495600_0000857 3300046809 Bacteria 16227
390 Ga0495660_0000215 3300046810 Bacteria 58954
391 Ga0495660_0002871 3300046810 Bacteria 10832
392 Ga0495660_0004775 3300046810 Bacteria 8185
393 Ga0495660_0007119 3300046810 Bacteria 6590
394 Ga0495660_0007416 3300046810 Bacteria 6439
395 Ga0495660_0029378 3300046810 Bacteria 3102
396 Ga0495604_0006145 3300047317 Bacteria 9531
397 Ga0495636_0001331 3300047318 Bacteria 9381
398 Ga0495672_0000477 3300047320 Bacteria 47447
399 Ga0495672_0000549 3300047320 Bacteria 42649
400 Ga0495672_0000590 3300047320 Bacteria 41027
401 Ga0495672_0064671 3300047320 Bacteria 2093
402 Ga0495672_0076129 3300047320 Bacteria 1885
403 Ga0495683_0000423 3300047323 Bacteria 33823
404 Ga0495683_0001542 3300047323 Bacteria 14920
405 Ga0495683_0050817 3300047323 Bacteria 2074
406 Ga0495687_000148 3300047443 Bacteria 106947
407 Ga0495687_002695 3300047443 Bacteria 13782
408 Ga0495687_002776 3300047443 Bacteria 13551
409 Ga0495677_0001205 3300047445 Bacteria 10352
410 Ga0495677_0003426 3300047445 Bacteria 6160
411 Ga0495677_0003541 3300047445 Bacteria 6058
412 Ga0495677_0011672 3300047445 Bacteria 3210
413 Ga0495677_0025091 3300047445 Bacteria 2162
414 Ga0495677_0031376 3300047445 Bacteria 1934
415 Ga0495679_012059 3300047446 Bacteria 3309
416 Ga0495679_020770 3300047446 Bacteria 2281
417 Ga0495679_025460 3300047446 Bacteria 1977
418 Ga0495685_000018 3300047447 Bacteria 74016
419 Ga0495685_007739 3300047447 Bacteria 3556
420 Ga0495685_010293 3300047447 Bacteria 3134
421 Ga0495673_0000003 3300047469 Bacteria 1491337
422 Ga0495673_0000100 3300047469 Bacteria 173962
423 Ga0495673_0007838 3300047469 Bacteria 6074
424 Ga0495673_0102459 3300047469 Bacteria 1155
425 Ga0495681_0002720 3300047470 Bacteria 12506
426 Ga0495681_0003523 3300047470 Bacteria 10879
427 Ga0495681_0019135 3300047470 Bacteria 3748
428 Ga0495681_0027075 3300047470 Bacteria 2972
429 Ga0495681_0035303 3300047470 Bacteria 2483
430 Ga0495686_0001020 3300047472 Bacteria 33872
431 Ga0495686_0014956 3300047472 Bacteria 5322
432 Ga0495686_0022931 3300047472 Bacteria 4124
433 Ga0495686_0183683 3300047472 Bacteria 1210
434 Ga0495602_0043420 3300048088 Bacteria 4088
435 Ga0495626_0000026 3300048091 Bacteria 207698
436 Ga0495626_0004798 3300048091 Bacteria 8158
437 Ga0495626_0005823 3300048091 Bacteria 7108
438 Ga0495626_0011806 3300048091 Bacteria 4601
439 Ga0495626_0018337 3300048091 Bacteria 3516
440 Ga0495626_0030209 3300048091 Bacteria 2614
441 Ga0496100_0014139 3300048903 Bacteria 4625
442 Ga0496101_0108916 3300048904 Bacteria 2083
443 Ga0496102_0042128 3300048905 Bacteria 4137
444 Ga0496102_0424364 3300048905 Bacteria 1249
445 Ga0496105_0324304 3300048908 Bacteria 1234
446 Ga0496106_0102393 3300048909 Bacteria 2221
447 Ga0496107_0050197 3300048910 Bacteria 3007
448 Ga0496109_0216343 3300048912 Bacteria 1802
449 Ga0496110_0444272 3300048913 Bacteria 1182
450 Ga0496110_0532580 3300048913 Bacteria 1068
451 Ga0496111_0015643 3300048914 Bacteria 5214
452 Ga0496112_0253804 3300048915 Bacteria 1709
453 Ga0496113_0023588 3300048916 Bacteria 4363
454 Ga0496116_0032337 3300048919 Bacteria 3730
455 Ga0496116_0038374 3300048919 Bacteria 3327
456 Ga0496116_0173482 3300048919 Bacteria 1165
457 Ga0496117_0000132 3300048920 Bacteria 162117
458 Ga0496118_0000099 3300048921 Bacteria 160412
459 Ga0496118_0193120 3300048921 Bacteria 1215
460 Ga0496119_0064930 3300048922 Bacteria 2165
461 Ga0496121_0005743 3300048924 Bacteria 15756
462 Ga0496121_0019888 3300048924 Bacteria 6684
463 Ga0496121_0037606 3300048924 Bacteria 4297
464 Ga0496121_0051735 3300048924 Bacteria 3457
465 Ga0496121_0078670 3300048924 Bacteria 2621
466 Ga0496121_0141597 3300048924 Bacteria 1783
467 Ga0496121_0156778 3300048924 Bacteria 1670
468 Ga0496121_0291649 3300048924 Bacteria 1111
469 Ga0496122_0001387 3300048925 Bacteria 39286
470 Ga0496122_0003476 3300048925 Bacteria 20726
471 Ga0496122_0005530 3300048925 Bacteria 15007
472 Ga0496122_0023040 3300048925 Bacteria 5510
473 Ga0496122_0177536 3300048925 Bacteria 1275
474 Ga0496123_0000180 3300048926 Bacteria 127726
475 Ga0496123_0004067 3300048926 Bacteria 15752
476 Ga0496123_0005184 3300048926 Bacteria 13252
477 Ga0496123_0184949 3300048926 Bacteria 1084
478 Ga0496124_0012720 3300048927 Bacteria 8275
479 Ga0496124_0025147 3300048927 Bacteria 5398
480 Ga0496124_0061700 3300048927 Bacteria 3141
481 Ga0496124_0106932 3300048927 Bacteria 2258
482 Ga0496124_0137123 3300048927 Bacteria 1936
483 Ga0496124_0180714 3300048927 Bacteria 1624
484 Ga0496125_0003731 3300048928 Bacteria 18151
485 Ga0496125_0004083 3300048928 Bacteria 17080
486 Ga0496125_0004935 3300048928 Bacteria 15102
487 Ga0496125_0094783 3300048928 Bacteria 2222
488 Ga0496125_0108107 3300048928 Bacteria 2024
489 Ga0496126_0024631 3300048929 Bacteria 5806
490 Ga0496126_0107990 3300048929 Bacteria 2427
491 Ga0495678_000004 3300049459 Bacteria 532920
492 Ga0495678_000335 3300049459 Bacteria 49388
493 Ga0495678_062004 3300049459 Bacteria 1400
494 Ga0495682_0002266 3300049460 Bacteria 9232
495 Ga0495682_0002534 3300049460 Bacteria 8603
496 Ga0495682_0003829 3300049460 Bacteria 6599
497 Ga0495682_0009178 3300049460 Bacteria 3871
498 Ga0495682_0021057 3300049460 Bacteria 2445
499 Ga0501034_0280469 3300049571 Bacteria 1606
500 Ga0501043_0457989 3300049579 Bacteria 957
501 Ga0501047_0209247 3300049581 Bacteria 1809
502 Ga0501080_0070542 3300049742 Bacteria 3250
503 Ga0501269_000023 3300049766 Bacteria 53029
504 Ga0501279_002841 3300049775 Bacteria 2258
505 Ga0501035_0005111 3300049822 Bacteria 12426
506 Ga0501044_0059830 3300049823 Bacteria 3902
507 Ga0501044_0202995 3300049823 Bacteria 1940
508 Ga0495601_0016461 3300053077 Bacteria 4480
509 Ga0495655_0082844 3300053083 Bacteria 920
510 Ga0500646_0003084 3300053090 Bacteria 4272
511 Ga0500651_0006700 3300053093 Bacteria 6667
512 Ga0500641_0001358 3300053096 Bacteria 8702
513 Ga0500555_006346 3300053103 Bacteria 3357
514 Ga0500595_001700 3300053119 Bacteria 11534
515 Ga0500595_005617 3300053119 Bacteria 5454
516 Ga0500607_086185 3300053121 Bacteria 1591
517 Ga0500618_000358 3300053125 Bacteria 31730
518 Ga0500642_0001266 3300053130 Bacteria 7235
519 Ga0500642_0019822 3300053130 Bacteria 2631
520 Ga0500658_0071953 3300053134 Bacteria 1461
521 Ga0500658_0099548 3300053134 Bacteria 1267
522 Ga0500568_0007626 3300053139 Bacteria 5288
523 Ga0500568_0027205 3300053139 Bacteria 2393
524 Ga0500574_005248 3300053141 Bacteria 2504
525 Ga0500586_013088 3300053145 Bacteria 2433
526 Ga0500588_0002990 3300053146 Bacteria 3521
527 Ga0500588_0007736 3300053146 Bacteria 2488
528 Ga0500604_0091821 3300053151 Bacteria 992
529 Ga0500616_0000749 3300053153 Bacteria 37374
530 Ga0500616_0011753 3300053153 Bacteria 5152
531 Ga0500619_000541 3300053154 Bacteria 6487
532 Ga0500624_002391 3300053157 Bacteria 2546
533 Ga0500627_0167191 3300053158 Bacteria 992
534 Ga0500609_002453 3300053731 Bacteria 2641
535 Ga0501084_0142511 3300054114 Bacteria 2018
536 2511250263 2511231003 Bacteria 5606035
537 2550692461 2548876994 Bacteria 4904866
538 2601670181 2600255292 Bacteria 6300551
539 2644027757 2643221603 Bacteria 6147767
540 2644215866 2643221638 Bacteria 6579467
541 2739153080 2738541357 Bacteria 6549408
542 2739195000 2738543003 Bacteria 6549560
543 2739277449 2738543018 Bacteria 6718814
544 2739321476 2738543026 Bacteria 6549408
545 2739339968 2738543029 Bacteria 6549249
546 2739346628 2738543030 Bacteria 6719714
547 2765568866 2765235838 Bacteria 5445269
548 2809145333 2808606418 Bacteria 6724496
549 2819541272 2818991436 Bacteria 5376622
550 2819592181 2818991445 Bacteria 4955017
551 2821131523 2821131069 Bacteria 6108407
552 2839096253 2839094727 Bacteria 5534556
553 2842714112 2842711865 Bacteria 7155354
554 2857553089 2857547612 Bacteria 6179999
555 2857554405 2857553236 Bacteria 6166726
556 2857560017 2857558681 Bacteria 6617694
557 2857564810 2857564685 Bacteria 6290584
558 2884816113 2884811622 Bacteria 5552861
559 2884840397 2884836552 Bacteria 5219991
560 2884855653 2884852848 Bacteria 5221161
561 2885084262 2885080285 Bacteria 6355622
562 2896157421 2896154374 Bacteria 5221518
563 2904426101 2904424332 Bacteria 7633521
564 2919478492 2919476304 Bacteria 5888696
565 2932413688 2932410948 Bacteria 6312192
566 2932417748 2932416698 Bacteria 6315112
567 Ga0496123_0022756
568 JGI25155J39150_1000284
569 JGI25155J39150_1000359
570 JGI25156J39149_1000110
571 JGI25162J39368_1000091
572 JGI25162J39368_1004743
573 JGI25154J39366_1000117
574 JGI25154J39366_1000231
575 JGI25154J39366_1001222
576 JGI25158J39367_1000664
577 JGI25157J39369_1000705
578 JGI25163J39215_1002784
579 JGI25152J39213_1000011
580 JGI25150J39212_1000192
581 JGI25159J45721_1002888
582 JGI25159J45721_1005248
583 JGI25165J46597_1000172
584 JGI25153J46596_10000177
585 JGI25153J46596_10017322
586 rootL2_10030296
587 JGI25161J50226_1000320
588 Ga0055538_1000063
589 Ga0055539_1000096
590 Ga0055533_1000107
591 Ga0055532_1000015
592 Ga0055525_1000140
593 Ga0055535_1009130
594 Ga0055529_1000390
595 Ga0055526_1000074
596 Ga0055526_1000086
597 Ga0055526_1000092
598 Ga0055526_1003041
599 Ga0055537_1000012
600 Ga0055524_1000021
601 Ga0055524_1000099
602 Ga0055524_1000917
603 Ga0055534_1000436
604 Ga0055534_1009245
605 Ga0055528_1000134
606 Ga0055531_10001186
607 Ga0055541_1000064
608 Ga0055543_1000224
609 Ga0055543_1001825
610 Ga0055543_1009139
611 Ga0065165_1000055
612 Ga0065165_1001224
613 Ga0065165_1013965
614 Ga0065165_1023108
615 Ga0065704_10191543
616 Ga0070658_10206342
617 Ga0068855_100029241
618 Ga0068855_100077054
619 Ga0068856_100046976
620 Ga0068852_100173688
621 Ga0068852_100179309
622 Ga0068862_100064282
623 Ga0070712_100069526
624 Ga0075428_100125369
625 Ga0068865_100096889
626 Ga0079104_1022921
627 Ga0099826_10000002
628 Ga0105251_10058809
629 Ga0105244_10007123
630 Ga0105244_10008840
631 Ga0105244_10026932
632 Ga0105243_10315853
633 Ga0105242_10420895
634 Ga0105238_10223668
635 Ga0105239_10503697
636 Ga0157371_10000078
637 Ga0182008_10006868
638 Ga0182006_1000026
639 Ga0182006_1000097
640 Ga0182006_1011001
641 Ga0182007_10000227
642 Ga0182007_10006048
643 Ga0182005_1000007
644 Ga0182005_1000038
645 Ga0182005_1000505
646 Ga0163161_10041925
647 Ga0163161_10073546
648 Ga0213872_10088621
649 Ga0209435_100021
650 Ga0209435_100163
651 Ga0209436_100144
652 Ga0209784_100079
653 Ga0209566_100093
654 Ga0209674_100115
655 Ga0209147_100004
656 Ga0209563_100007
657 Ga0209563_100113
658 Ga0209437_100045
659 Ga0209437_100176
660 Ga0209258_100083
661 Ga0207425_1000001
662 Ga0207425_1000059
663 Ga0209646_1000010
664 Ga0209646_1000020
665 Ga0209646_1000074
666 Ga0209026_1000058
667 Ga0209026_1001283
668 Ga0209026_1004032
669 Ga0209677_100072
670 Ga0209677_103791
671 Ga0209759_1000046
672 Ga0209759_1000073
673 Ga0209129_1000001
674 Ga0209233_1000183
675 Ga0209565_1000057
676 Ga0209565_1004533
677 Ga0209455_1000037
678 Ga0209673_1000051
679 Ga0209130_1000197
680 Ga0209130_1000588
681 Ga0209130_1004697
682 Ga0209675_1000027
683 Ga0209675_1001414
684 Ga0209025_1023174
685 Ga0209564_1000009
686 Ga0209564_1000033
687 Ga0209564_1000094
688 Ga0209564_1014621
689 Ga0209758_1000033
690 Ga0209758_1000073
691 Ga0209758_1000227
692 Ga0209758_1004049
693 Ga0209050_1000046
694 Ga0209050_1000269
695 Ga0209050_1013081
696 Ga0209050_1024836
697 Ga0209256_1000044
698 Ga0209256_1000116
699 Ga0209256_1000139
700 Ga0209256_1000145
701 Ga0207426_1006629
702 Ga0207426_1012949
703 Ga0207426_1036941
704 Ga0209257_1000068
705 Ga0209257_1000239
706 Ga0209257_1008912
707 Ga0209257_1028456
708 Ga0207655_1009719
709 Ga0207655_1010839
710 Ga0207705_10004777
711 Ga0207654_10048890
712 Ga0207695_10004054
713 Ga0207695_10285792
714 Ga0207693_10228504
715 Ga0207657_10101987
716 Ga0207657_10476766
717 Ga0207694_10092084
718 Ga0207694_10145587
719 Ga0207706_10115916
720 Ga0207704_10050448
721 Ga0207667_10016858
722 Ga0207667_10049408
723 Ga0207667_10176600
724 Ga0207702_10030896
725 Ga0207698_10244247
726 Ga0207698_10404681
727 Ga0209282_1000001
728 Ga0268265_10002366
729 Ga0307513_10117821
730 Ga0307408_100001025
731 Ga0307408_100006114
732 Ga0307408_100014545
733 Ga0395899_0003263
734 Ga0395899_0006655
735 Ga0395899_0009771
736 Ga0395899_0011753
737 Ga0395899_0018969
738 Ga0395900_0000393
739 Ga0395900_0001606
740 Ga0395900_0006618
741 Ga0395900_0010222
742 Ga0395900_0140847
743 Ga0395898_0015586
744 Ga0395898_0033549
745 Ga0395905_0000455
746 Ga0395905_0059442
747 Ga0395901_0000054
748 Ga0395901_0002967
749 Ga0395901_0009279
750 Ga0395901_0009778
751 Ga0395901_0068798
752 Ga0439448_0030272
753 Ga0439458_0020240
754 Ga0466972_0000163
755 Ga0466972_0014599
756 Ga0466965_0017485
757 Ga0466965_0072542
758 Ga0466965_0149209
759 Ga0466966_0006906
760 Ga0466964_0009038
761 Ga0466968_0006093
762 Ga0466968_0027908
763 Ga0466970_0009193
764 Ga0466957_0002945
765 Ga0466959_0002491
766 Ga0466967_0075933
767 Ga0495617_000037
768 Ga0495617_004402
769 Ga0495627_000007
770 Ga0495627_011001
771 Ga0495627_058164
772 Ga0495592_0018741
773 Ga0495591_000218
774 Ga0495591_013480
775 Ga0495638_0000525
776 Ga0495638_0039264
777 Ga0495638_0041783
778 Ga0495638_0050710
779 Ga0495638_0199697
780 Ga0495651_0001054
781 Ga0495651_0196856
782 Ga0495653_0000002
783 Ga0495650_0000156
784 Ga0495650_0000166
785 Ga0495650_0008179
786 Ga0495650_0030138
787 Ga0495605_0000059
788 Ga0495605_0003743
789 Ga0495605_0007373
790 Ga0495605_0022799
791 Ga0495605_0114990
792 Ga0495584_0000842
793 Ga0495584_0002208
794 Ga0495584_0022494
795 Ga0495584_0090359
796 Ga0495585_0000282
797 Ga0495585_0001540
798 Ga0495585_0002719
799 Ga0495585_0009970
800 Ga0495585_0012419
801 Ga0495585_0030062
802 Ga0495585_0043491
803 Ga0495585_0085496
804 Ga0495585_0087344
805 Ga0495585_0124215
806 Ga0495596_0000236
807 Ga0495596_0026206
808 Ga0495596_0094330
809 Ga0495607_0000720
810 Ga0495607_0002743
811 Ga0495607_0028819
812 Ga0495607_0030127
813 Ga0495607_0060766
814 Ga0495607_0079609
815 Ga0495583_0000035
816 Ga0495583_0000533
817 Ga0495583_0015439
818 Ga0495583_0146012
819 Ga0495606_0000011
820 Ga0495606_0000156
821 Ga0495606_0001370
822 Ga0495606_0013757
823 Ga0495606_0017341
824 Ga0495606_0018661
825 Ga0495606_0024090
826 Ga0495606_0061816
827 Ga0495608_0006692
828 Ga0495608_0014117
829 Ga0495610_0002417
830 Ga0495610_0014767
831 Ga0495610_0023778
832 Ga0495610_0051345
833 Ga0495610_0061409
834 Ga0495610_0087120
835 Ga0495616_0001160
836 Ga0495616_0009093
837 Ga0495616_0013212
838 Ga0495616_0028329
839 Ga0495616_0028692
840 Ga0495616_0030695
841 Ga0495616_0070380
842 Ga0495618_0038079
843 Ga0495628_0003780
844 Ga0495628_0005081
845 Ga0495631_0001988
846 Ga0495631_0004070
847 Ga0495631_0018177
848 Ga0495631_0019851
849 Ga0495631_0030489
850 Ga0495631_0053157
851 Ga0495632_0001939
852 Ga0495632_0011971
853 Ga0495632_0035643
854 Ga0495632_0133679
855 Ga0495637_0000004
856 Ga0495637_0000230
857 Ga0495637_0111875
858 Ga0495643_0000170
859 Ga0495643_0002817
860 Ga0495643_0013083
861 Ga0495643_0059271
862 Ga0495643_0119259
863 Ga0495644_0006414
864 Ga0495644_0007598
865 Ga0495644_0014135
866 Ga0495644_0016693
867 Ga0495644_0018970
868 Ga0495644_0020066
869 Ga0495648_0000001
870 Ga0495648_0001030
871 Ga0495648_0005449
872 Ga0495648_0005800
873 Ga0495648_0018466
874 Ga0495648_0043686
875 Ga0495663_0030430
876 Ga0495642_0005908
877 Ga0495642_0010902
878 Ga0495642_0137711
879 Ga0495652_0008038
880 Ga0495652_0090958
881 Ga0495654_0000028
882 Ga0495654_0023794
883 Ga0495609_0002199
884 Ga0495609_0003695
885 Ga0495609_0003800
886 Ga0495609_0004814
887 Ga0495609_0016896
888 Ga0495609_0034208
889 Ga0495609_0085294
890 Ga0495597_0000289
891 Ga0495597_0002615
892 Ga0495597_0007644
893 Ga0495597_0031535
894 Ga0495645_0017644
895 Ga0495645_0059193
896 Ga0495622_0000087
897 Ga0495622_0053206
898 Ga0495622_0071340
899 Ga0495633_0000727
900 Ga0495633_0001004
901 Ga0495633_0001667
902 Ga0495633_0002672
903 Ga0495633_0006941
904 Ga0495633_0016794
905 Ga0495633_0018092
906 Ga0495633_0021984
907 Ga0495633_0035211
908 Ga0495633_0085855
909 Ga0495668_0000048
910 Ga0495668_0000185
911 Ga0495668_0000378
912 Ga0495668_0002254
913 Ga0495668_0022303
914 Ga0495668_0022871
915 Ga0495668_0257963
916 Ga0495611_0000778
917 Ga0495611_0003825
918 Ga0495611_0031129
919 Ga0495611_0051801
920 Ga0495611_0095686
921 Ga0495625_0000164
922 Ga0495625_0000372
923 Ga0495625_0000925
924 Ga0495625_0001300
925 Ga0495625_0130366
926 Ga0495659_0003759
927 Ga0495661_0002081
928 Ga0495661_0002174
929 Ga0495661_0003078
930 Ga0495661_0025875
931 Ga0495661_0034146
932 Ga0495661_0049235
933 Ga0495661_0123422
934 Ga0495661_0161765
935 Ga0495661_0170305
936 Ga0495588_0065241
937 Ga0495657_0169287
938 Ga0495599_0001150
939 Ga0495623_0014783
940 Ga0495623_0026212
941 Ga0495646_0005539
942 Ga0495646_0010931
943 Ga0495669_0003235
944 Ga0495669_0007213
945 Ga0495669_0008369
946 Ga0495624_0020213
947 Ga0495670_0028974
948 Ga0495671_0000001
949 Ga0495671_0007946
950 Ga0495671_0013142
951 Ga0495671_0117202
952 Ga0495649_0000825
953 Ga0495649_0008171
954 Ga0495649_0014919
955 Ga0495600_0000857
956 Ga0495660_0000215
957 Ga0495660_0002871
958 Ga0495660_0004775
959 Ga0495660_0007119
960 Ga0495660_0007416
961 Ga0495660_0029378
962 Ga0495604_0006145
963 Ga0495636_0001331
964 Ga0495672_0000477
965 Ga0495672_0000549
966 Ga0495672_0000590
967 Ga0495672_0064671
968 Ga0495672_0076129
969 Ga0495683_0000423
970 Ga0495683_0001542
971 Ga0495683_0050817
972 Ga0495687_000148
973 Ga0495687_002695
974 Ga0495687_002776
975 Ga0495677_0001205
976 Ga0495677_0003426
977 Ga0495677_0003541
978 Ga0495677_0011672
979 Ga0495677_0025091
980 Ga0495677_0031376
981 Ga0495679_012059
982 Ga0495679_020770
983 Ga0495679_025460
984 Ga0495685_000018
985 Ga0495685_007739
986 Ga0495685_010293
987 Ga0495673_0000003
988 Ga0495673_0000100
989 Ga0495673_0007838
990 Ga0495673_0102459
991 Ga0495681_0002720
992 Ga0495681_0003523
993 Ga0495681_0019135
994 Ga0495681_0027075
995 Ga0495681_0035303
996 Ga0495686_0001020
997 Ga0495686_0014956
998 Ga0495686_0022931
999 Ga0495686_0183683
1000 Ga0495602_0043420
1001 Ga0495626_0000026
1002 Ga0495626_0004798
1003 Ga0495626_0005823
1004 Ga0495626_0011806
1005 Ga0495626_0018337
1006 Ga0495626_0030209
1007 Ga0496100_0014139
1008 Ga0496101_0108916
1009 Ga0496102_0042128
1010 Ga0496102_0424364
1011 Ga0496105_0324304
1012 Ga0496106_0102393
1013 Ga0496107_0050197
1014 Ga0496109_0216343
1015 Ga0496110_0444272
1016 Ga0496110_0532580
1017 Ga0496111_0015643
1018 Ga0496112_0253804
1019 Ga0496113_0023588
1020 Ga0496116_0032337
1021 Ga0496116_0038374
1022 Ga0496116_0173482
1023 Ga0496117_0000132
1024 Ga0496118_0000099
1025 Ga0496118_0193120
1026 Ga0496119_0064930
1027 Ga0496121_0005743
1028 Ga0496121_0019888
1029 Ga0496121_0037606
1030 Ga0496121_0051735
1031 Ga0496121_0078670
1032 Ga0496121_0141597
1033 Ga0496121_0156778
1034 Ga0496121_0291649
1035 Ga0496122_0001387
1036 Ga0496122_0003476
1037 Ga0496122_0005530
1038 Ga0496122_0023040
1039 Ga0496122_0177536
1040 Ga0496123_0000180
1041 Ga0496123_0004067
1042 Ga0496123_0005184
1043 Ga0496123_0184949
1044 Ga0496124_0012720
1045 Ga0496124_0025147
1046 Ga0496124_0061700
1047 Ga0496124_0106932
1048 Ga0496124_0137123
1049 Ga0496124_0180714
1050 Ga0496125_0003731
1051 Ga0496125_0004083
1052 Ga0496125_0004935
1053 Ga0496125_0094783
1054 Ga0496125_0108107
1055 Ga0496126_0024631
1056 Ga0496126_0107990
1057 Ga0495678_000004
1058 Ga0495678_000335
1059 Ga0495678_062004
1060 Ga0495682_0002266
1061 Ga0495682_0002534
1062 Ga0495682_0003829
1063 Ga0495682_0009178
1064 Ga0495682_0021057
1065 Ga0501034_0280469
1066 Ga0501043_0457989
1067 Ga0501047_0209247
1068 Ga0501080_0070542
1069 Ga0501269_000023
1070 Ga0501279_002841
1071 Ga0501035_0005111
1072 Ga0501044_0059830
1073 Ga0501044_0202995
1074 Ga0495601_0016461
1075 Ga0495655_0082844
1076 Ga0500646_0003084
1077 Ga0500651_0006700
1078 Ga0500641_0001358
1079 Ga0500555_006346
1080 Ga0500595_001700
1081 Ga0500595_005617
1082 Ga0500607_086185
1083 Ga0500618_000358
1084 Ga0500642_0001266
1085 Ga0500642_0019822
1086 Ga0500658_0071953
1087 Ga0500658_0099548
1088 Ga0500568_0007626
1089 Ga0500568_0027205
1090 Ga0500574_005248
1091 Ga0500586_013088
1092 Ga0500588_0002990
1093 Ga0500588_0007736
1094 Ga0500604_0091821
1095 Ga0500616_0000749
1096 Ga0500616_0011753
1097 Ga0500619_000541
1098 Ga0500624_002391
1099 Ga0500627_0167191
1100 Ga0500609_002453
1101 Ga0501084_0142511
1102 2511250263
1103 2550692461
1104 2601670181
1105 2644027757
1106 2644215866
1107 2739153080
1108 2739195000
1109 2739277449
1110 2739321476
1111 2739339968
1112 2739346628
1113 2765568866
1114 2809145333
1115 2819541272
1116 2819592181
1117 2821131523
1118 2839096253
1119 2842714112
1120 2857553089
1121 2857554405
1122 2857560017
1123 2857564810
1124 2884816113
1125 2884840397
1126 2884855653
1127 2885084262
1128 2896157421
1129 2904426101
1130 2919478492
1131 2932413688
1132 2932417748

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

214

351

0.92

PF00892

EamA

EamA-like transporter family

67

206

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0k-assembly1.cif.gz_A membrane protein structure 0.7423 8 281
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7419 8 282
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.738 7 286
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7328 8 282
7b0k-assembly1.cif.gz_A membrane protein structure 0.7297 8 281
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7489 8 284 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6963 8 284 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.5703 10 285 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.563 1 291 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.5484 1 291 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A6B3SKC4-F1-model_v4 DMT family transporter 0.9974 1 289 GO:0016020
AF-A0A6B3SKC4-F1-model_v4 DMT family transporter 0.9939 1 289 GO:0016020
AF-I0H6E0-F1-model_v4 Putative integral membrane protein 0.9908 3 285 GO:0016020
AF-A0A1T5APK1-F1-model_v4 Permease of the drug/metabolite transporter (DMT) superfamily 0.9858 4 286 GO:0016020
AF-A0A4S8PHB6-F1-model_v4 DMT family transporter 0.9858 5 285 GO:0016020

Map