F464442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 263 | 1132 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300048926|Ga0496123_0022756|Ga0496123_0022756_945_2129 |
| Length | 360 |
| Sequence | VAAGFATTGIDATDGPVRGRVLVILPSQYKKLCCEVYWHCTGFVTKHKPMNPNTPALTTHRRLSDETAGMLLGLIGVAIFSLTLPFTRLAVSGGMAGGLSPMFVALGRALTAAILAAGWLYCKRAPLPPRSAVPALAMVAIGCVIGFPWLTSIAMRTLPAAHGAVLVGVLPLATALFAALLGGEKPSQGFWIMAILGSVLVIGFALRQSGGSLHPADLAIFVAVLLAAMGYAAGGRLSQTLGGQQTICWALILAAPPLLPVVGWLAWQDSAQLAHASAAAWTGFAYVSVFSMFIGFFFWYRGMALGGVARVGQVQLVQPFLSVLGATVVLGETLEWPTLAFAIAVIATVAAGRKMQVKRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 42 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 56 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 57 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 99 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 106 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 107 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 108 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 111 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 112 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 193 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 194 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 195 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 196 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 197 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 198 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 199 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 200 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 201 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 208 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 214 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 215 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 216 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 217 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 218 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 219 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 220 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 221 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 222 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 223 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 224 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 225 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 226 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 227 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 228 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 229 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 230 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 232 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 234 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 235 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 236 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 237 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 238 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 239 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 240 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 241 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 242 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 243 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 244 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 245 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 246 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 247 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 248 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 249 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 250 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 251 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 252 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 253 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 254 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 255 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 256 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 257 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 258 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 259 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 260 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 261 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 262 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 263 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.52 |
| Metatranscriptomes | 0 |
| Isolates | 5.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.96 |
| Nodule | 1.06 |
| Rhizoplane | 2.47 |
| Rhizosphere | 62.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496123_0022756 | 3300048926 | Bacteria | 4819 |
| 2 | JGI25155J39150_1000284 | 3300002704 | Bacteria | 18276 |
| 3 | JGI25155J39150_1000359 | 3300002704 | Bacteria | 14221 |
| 4 | JGI25156J39149_1000110 | 3300002705 | Bacteria | 59456 |
| 5 | JGI25162J39368_1000091 | 3300002737 | Bacteria | 101521 |
| 6 | JGI25162J39368_1004743 | 3300002737 | Bacteria | 2996 |
| 7 | JGI25154J39366_1000117 | 3300002738 | Bacteria | 65094 |
| 8 | JGI25154J39366_1000231 | 3300002738 | Bacteria | 37387 |
| 9 | JGI25154J39366_1001222 | 3300002738 | Bacteria | 9699 |
| 10 | JGI25158J39367_1000664 | 3300002739 | Bacteria | 6716 |
| 11 | JGI25157J39369_1000705 | 3300002741 | Bacteria | 18005 |
| 12 | JGI25163J39215_1002784 | 3300002771 | Bacteria | 1628 |
| 13 | JGI25152J39213_1000011 | 3300002773 | Bacteria | 130992 |
| 14 | JGI25150J39212_1000192 | 3300002774 | Bacteria | 34489 |
| 15 | JGI25159J45721_1002888 | 3300002987 | Bacteria | 6275 |
| 16 | JGI25159J45721_1005248 | 3300002987 | Bacteria | 4096 |
| 17 | JGI25165J46597_1000172 | 3300003214 | Bacteria | 101521 |
| 18 | JGI25153J46596_10000177 | 3300003215 | Bacteria | 63555 |
| 19 | JGI25153J46596_10017322 | 3300003215 | Bacteria | 2842 |
| 20 | rootL2_10030296 | 3300003322 | Bacteria | 8873 |
| 21 | JGI25161J50226_1000320 | 3300003374 | Bacteria | 26259 |
| 22 | Ga0055538_1000063 | 3300003751 | Bacteria | 101521 |
| 23 | Ga0055539_1000096 | 3300003752 | Bacteria | 101521 |
| 24 | Ga0055533_1000107 | 3300003756 | Bacteria | 101521 |
| 25 | Ga0055532_1000015 | 3300003758 | Bacteria | 340197 |
| 26 | Ga0055525_1000140 | 3300003759 | Bacteria | 101521 |
| 27 | Ga0055535_1009130 | 3300003761 | Bacteria | 1732 |
| 28 | Ga0055529_1000390 | 3300003763 | Bacteria | 47242 |
| 29 | Ga0055526_1000074 | 3300003771 | Bacteria | 92854 |
| 30 | Ga0055526_1000086 | 3300003771 | Bacteria | 86198 |
| 31 | Ga0055526_1000092 | 3300003771 | Bacteria | 82076 |
| 32 | Ga0055526_1003041 | 3300003771 | Bacteria | 10901 |
| 33 | Ga0055537_1000012 | 3300003773 | Bacteria | 133761 |
| 34 | Ga0055524_1000021 | 3300003775 | Bacteria | 227578 |
| 35 | Ga0055524_1000099 | 3300003775 | Bacteria | 107171 |
| 36 | Ga0055524_1000917 | 3300003775 | Bacteria | 19044 |
| 37 | Ga0055534_1000436 | 3300003784 | Bacteria | 24676 |
| 38 | Ga0055534_1009245 | 3300003784 | Bacteria | 2158 |
| 39 | Ga0055528_1000134 | 3300003790 | Bacteria | 60071 |
| 40 | Ga0055531_10001186 | 3300003794 | Bacteria | 20002 |
| 41 | Ga0055541_1000064 | 3300003841 | Bacteria | 101521 |
| 42 | Ga0055543_1000224 | 3300004625 | Bacteria | 45523 |
| 43 | Ga0055543_1001825 | 3300004625 | Bacteria | 7803 |
| 44 | Ga0055543_1009139 | 3300004625 | Bacteria | 2151 |
| 45 | Ga0065165_1000055 | 3300005262 | Bacteria | 187003 |
| 46 | Ga0065165_1001224 | 3300005262 | Bacteria | 29476 |
| 47 | Ga0065165_1013965 | 3300005262 | Bacteria | 3147 |
| 48 | Ga0065165_1023108 | 3300005262 | Bacteria | 2116 |
| 49 | Ga0065704_10191543 | 3300005289 | Bacteria | 1187 |
| 50 | Ga0070658_10206342 | 3300005327 | Bacteria | 1659 |
| 51 | Ga0068855_100029241 | 3300005563 | Bacteria | 6590 |
| 52 | Ga0068855_100077054 | 3300005563 | Bacteria | 3868 |
| 53 | Ga0068856_100046976 | 3300005614 | Bacteria | 4253 |
| 54 | Ga0068852_100173688 | 3300005616 | Bacteria | 2022 |
| 55 | Ga0068852_100179309 | 3300005616 | Bacteria | 1991 |
| 56 | Ga0068862_100064282 | 3300005844 | Bacteria | 3158 |
| 57 | Ga0070712_100069526 | 3300006175 | Bacteria | 2512 |
| 58 | Ga0075428_100125369 | 3300006844 | Bacteria | 2794 |
| 59 | Ga0068865_100096889 | 3300006881 | Bacteria | 2152 |
| 60 | Ga0079104_1022921 | 3300006946 | Bacteria | 1670 |
| 61 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 62 | Ga0105251_10058809 | 3300009011 | Bacteria | 1814 |
| 63 | Ga0105244_10007123 | 3300009036 | Bacteria | 7145 |
| 64 | Ga0105244_10008840 | 3300009036 | Bacteria | 6253 |
| 65 | Ga0105244_10026932 | 3300009036 | Bacteria | 3106 |
| 66 | Ga0105243_10315853 | 3300009148 | Bacteria | 1422 |
| 67 | Ga0105242_10420895 | 3300009176 | Bacteria | 1252 |
| 68 | Ga0105238_10223668 | 3300009551 | Bacteria | 1859 |
| 69 | Ga0105239_10503697 | 3300010375 | Bacteria | 1377 |
| 70 | Ga0157371_10000078 | 3300013102 | Bacteria | 154095 |
| 71 | Ga0182008_10006868 | 3300014497 | Bacteria | 6326 |
| 72 | Ga0182006_1000026 | 3300015261 | Bacteria | 253543 |
| 73 | Ga0182006_1000097 | 3300015261 | Bacteria | 102186 |
| 74 | Ga0182006_1011001 | 3300015261 | Bacteria | 3996 |
| 75 | Ga0182007_10000227 | 3300015262 | Bacteria | 37880 |
| 76 | Ga0182007_10006048 | 3300015262 | Bacteria | 5232 |
| 77 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 78 | Ga0182005_1000038 | 3300015265 | Bacteria | 160030 |
| 79 | Ga0182005_1000505 | 3300015265 | Bacteria | 19944 |
| 80 | Ga0163161_10041925 | 3300017792 | Bacteria | 3290 |
| 81 | Ga0163161_10073546 | 3300017792 | Bacteria | 2504 |
| 82 | Ga0213872_10088621 | 3300021361 | Bacteria | 1386 |
| 83 | Ga0209435_100021 | 3300025206 | Bacteria | 223961 |
| 84 | Ga0209435_100163 | 3300025206 | Bacteria | 21322 |
| 85 | Ga0209436_100144 | 3300025208 | Bacteria | 34421 |
| 86 | Ga0209784_100079 | 3300025224 | Bacteria | 136351 |
| 87 | Ga0209566_100093 | 3300025225 | Bacteria | 136351 |
| 88 | Ga0209674_100115 | 3300025226 | Bacteria | 136351 |
| 89 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 90 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 91 | Ga0209563_100113 | 3300025230 | Bacteria | 136351 |
| 92 | Ga0209437_100045 | 3300025233 | Bacteria | 429809 |
| 93 | Ga0209437_100176 | 3300025233 | Bacteria | 136351 |
| 94 | Ga0209258_100083 | 3300025242 | Bacteria | 246008 |
| 95 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 96 | Ga0207425_1000059 | 3300025245 | Bacteria | 146258 |
| 97 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 98 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 99 | Ga0209646_1000074 | 3300025246 | Bacteria | 223961 |
| 100 | Ga0209026_1000058 | 3300025250 | Bacteria | 228656 |
| 101 | Ga0209026_1001283 | 3300025250 | Bacteria | 11393 |
| 102 | Ga0209026_1004032 | 3300025250 | Bacteria | 4547 |
| 103 | Ga0209677_100072 | 3300025253 | Bacteria | 136351 |
| 104 | Ga0209677_103791 | 3300025253 | Bacteria | 4694 |
| 105 | Ga0209759_1000046 | 3300025256 | Bacteria | 230149 |
| 106 | Ga0209759_1000073 | 3300025256 | Bacteria | 178048 |
| 107 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 108 | Ga0209233_1000183 | 3300025261 | Bacteria | 136351 |
| 109 | Ga0209565_1000057 | 3300025263 | Bacteria | 196908 |
| 110 | Ga0209565_1004533 | 3300025263 | Bacteria | 4199 |
| 111 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 112 | Ga0209673_1000051 | 3300025273 | Bacteria | 282161 |
| 113 | Ga0209130_1000197 | 3300025284 | Bacteria | 82611 |
| 114 | Ga0209130_1000588 | 3300025284 | Bacteria | 35429 |
| 115 | Ga0209130_1004697 | 3300025284 | Bacteria | 5057 |
| 116 | Ga0209675_1000027 | 3300025291 | Bacteria | 282175 |
| 117 | Ga0209675_1001414 | 3300025291 | Bacteria | 13876 |
| 118 | Ga0209025_1023174 | 3300025294 | Bacteria | 3257 |
| 119 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 120 | Ga0209564_1000033 | 3300025295 | Bacteria | 446200 |
| 121 | Ga0209564_1000094 | 3300025295 | Bacteria | 243176 |
| 122 | Ga0209564_1014621 | 3300025295 | Bacteria | 3248 |
| 123 | Ga0209758_1000033 | 3300025297 | Bacteria | 469998 |
| 124 | Ga0209758_1000073 | 3300025297 | Bacteria | 276262 |
| 125 | Ga0209758_1000227 | 3300025297 | Bacteria | 120073 |
| 126 | Ga0209758_1004049 | 3300025297 | Bacteria | 12629 |
| 127 | Ga0209050_1000046 | 3300025298 | Bacteria | 386466 |
| 128 | Ga0209050_1000269 | 3300025298 | Bacteria | 111072 |
| 129 | Ga0209050_1013081 | 3300025298 | Bacteria | 3731 |
| 130 | Ga0209050_1024836 | 3300025298 | Bacteria | 2058 |
| 131 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 132 | Ga0209256_1000116 | 3300025299 | Bacteria | 169876 |
| 133 | Ga0209256_1000139 | 3300025299 | Bacteria | 155515 |
| 134 | Ga0209256_1000145 | 3300025299 | Bacteria | 150609 |
| 135 | Ga0207426_1006629 | 3300025302 | Bacteria | 4983 |
| 136 | Ga0207426_1012949 | 3300025302 | Bacteria | 3112 |
| 137 | Ga0207426_1036941 | 3300025302 | Bacteria | 1549 |
| 138 | Ga0209257_1000068 | 3300025304 | Bacteria | 341291 |
| 139 | Ga0209257_1000239 | 3300025304 | Bacteria | 128383 |
| 140 | Ga0209257_1008912 | 3300025304 | Bacteria | 5526 |
| 141 | Ga0209257_1028456 | 3300025304 | Bacteria | 1838 |
| 142 | Ga0207655_1009719 | 3300025728 | Bacteria | 5935 |
| 143 | Ga0207655_1010839 | 3300025728 | Bacteria | 5490 |
| 144 | Ga0207705_10004777 | 3300025909 | Bacteria | 10200 |
| 145 | Ga0207654_10048890 | 3300025911 | Bacteria | 2423 |
| 146 | Ga0207695_10004054 | 3300025913 | Bacteria | 20140 |
| 147 | Ga0207695_10285792 | 3300025913 | Bacteria | 1542 |
| 148 | Ga0207693_10228504 | 3300025915 | Bacteria | 1461 |
| 149 | Ga0207657_10101987 | 3300025919 | Bacteria | 2380 |
| 150 | Ga0207657_10476766 | 3300025919 | Bacteria | 978 |
| 151 | Ga0207694_10092084 | 3300025924 | Bacteria | 2393 |
| 152 | Ga0207694_10145587 | 3300025924 | Bacteria | 1907 |
| 153 | Ga0207706_10115916 | 3300025933 | Bacteria | 2356 |
| 154 | Ga0207704_10050448 | 3300025938 | Bacteria | 2510 |
| 155 | Ga0207667_10016858 | 3300025949 | Bacteria | 8240 |
| 156 | Ga0207667_10049408 | 3300025949 | Bacteria | 4442 |
| 157 | Ga0207667_10176600 | 3300025949 | Bacteria | 2194 |
| 158 | Ga0207702_10030896 | 3300026078 | Bacteria | 4464 |
| 159 | Ga0207698_10244247 | 3300026142 | Bacteria | 1638 |
| 160 | Ga0207698_10404681 | 3300026142 | Bacteria | 1305 |
| 161 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 162 | Ga0268265_10002366 | 3300028380 | Bacteria | 14272 |
| 163 | Ga0307513_10117821 | 3300031456 | Bacteria | 2632 |
| 164 | Ga0307408_100001025 | 3300031548 | Bacteria | 21471 |
| 165 | Ga0307408_100006114 | 3300031548 | Bacteria | 8004 |
| 166 | Ga0307408_100014545 | 3300031548 | Bacteria | 5228 |
| 167 | Ga0395899_0003263 | 3300037312 | Bacteria | 12860 |
| 168 | Ga0395899_0006655 | 3300037312 | Bacteria | 8955 |
| 169 | Ga0395899_0009771 | 3300037312 | Bacteria | 7361 |
| 170 | Ga0395899_0011753 | 3300037312 | Bacteria | 6700 |
| 171 | Ga0395899_0018969 | 3300037312 | Bacteria | 5226 |
| 172 | Ga0395900_0000393 | 3300037418 | Bacteria | 63296 |
| 173 | Ga0395900_0001606 | 3300037418 | Bacteria | 26645 |
| 174 | Ga0395900_0006618 | 3300037418 | Bacteria | 12059 |
| 175 | Ga0395900_0010222 | 3300037418 | Bacteria | 9596 |
| 176 | Ga0395900_0140847 | 3300037418 | Bacteria | 2469 |
| 177 | Ga0395898_0015586 | 3300037466 | Bacteria | 7792 |
| 178 | Ga0395898_0033549 | 3300037466 | Bacteria | 5121 |
| 179 | Ga0395905_0000455 | 3300037471 | Bacteria | 57161 |
| 180 | Ga0395905_0059442 | 3300037471 | Bacteria | 3573 |
| 181 | Ga0395901_0000054 | 3300038443 | Bacteria | 160505 |
| 182 | Ga0395901_0002967 | 3300038443 | Bacteria | 17118 |
| 183 | Ga0395901_0009279 | 3300038443 | Bacteria | 9973 |
| 184 | Ga0395901_0009778 | 3300038443 | Bacteria | 9725 |
| 185 | Ga0395901_0068798 | 3300038443 | Bacteria | 3688 |
| 186 | Ga0439448_0030272 | 3300042005 | Bacteria | 1716 |
| 187 | Ga0439458_0020240 | 3300042157 | Bacteria | 1536 |
| 188 | Ga0466972_0000163 | 3300044658 | Bacteria | 53265 |
| 189 | Ga0466972_0014599 | 3300044658 | Bacteria | 3932 |
| 190 | Ga0466965_0017485 | 3300044683 | Bacteria | 3428 |
| 191 | Ga0466965_0072542 | 3300044683 | Bacteria | 1732 |
| 192 | Ga0466965_0149209 | 3300044683 | Bacteria | 1221 |
| 193 | Ga0466966_0006906 | 3300044684 | Bacteria | 7521 |
| 194 | Ga0466964_0009038 | 3300044706 | Bacteria | 3747 |
| 195 | Ga0466968_0006093 | 3300044735 | Bacteria | 4530 |
| 196 | Ga0466968_0027908 | 3300044735 | Bacteria | 2325 |
| 197 | Ga0466970_0009193 | 3300044765 | Bacteria | 4986 |
| 198 | Ga0466957_0002945 | 3300044842 | Bacteria | 9226 |
| 199 | Ga0466959_0002491 | 3300045049 | Bacteria | 11792 |
| 200 | Ga0466967_0075933 | 3300045976 | Bacteria | 3021 |
| 201 | Ga0495617_000037 | 3300046452 | Bacteria | 134553 |
| 202 | Ga0495617_004402 | 3300046452 | Bacteria | 5133 |
| 203 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 204 | Ga0495627_011001 | 3300046453 | Bacteria | 3261 |
| 205 | Ga0495627_058164 | 3300046453 | Bacteria | 1149 |
| 206 | Ga0495592_0018741 | 3300046454 | Bacteria | 5268 |
| 207 | Ga0495591_000218 | 3300046458 | Bacteria | 57622 |
| 208 | Ga0495591_013480 | 3300046458 | Bacteria | 2988 |
| 209 | Ga0495638_0000525 | 3300046460 | Bacteria | 44714 |
| 210 | Ga0495638_0039264 | 3300046460 | Bacteria | 3005 |
| 211 | Ga0495638_0041783 | 3300046460 | Bacteria | 2899 |
| 212 | Ga0495638_0050710 | 3300046460 | Bacteria | 2591 |
| 213 | Ga0495638_0199697 | 3300046460 | Bacteria | 1130 |
| 214 | Ga0495651_0001054 | 3300046462 | Bacteria | 21337 |
| 215 | Ga0495651_0196856 | 3300046462 | Bacteria | 1413 |
| 216 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 217 | Ga0495650_0000156 | 3300046471 | Bacteria | 155338 |
| 218 | Ga0495650_0000166 | 3300046471 | Bacteria | 146047 |
| 219 | Ga0495650_0008179 | 3300046471 | Bacteria | 6148 |
| 220 | Ga0495650_0030138 | 3300046471 | Bacteria | 2461 |
| 221 | Ga0495605_0000059 | 3300046474 | Bacteria | 146371 |
| 222 | Ga0495605_0003743 | 3300046474 | Bacteria | 9029 |
| 223 | Ga0495605_0007373 | 3300046474 | Bacteria | 6245 |
| 224 | Ga0495605_0022799 | 3300046474 | Bacteria | 3300 |
| 225 | Ga0495605_0114990 | 3300046474 | Bacteria | 1224 |
| 226 | Ga0495584_0000842 | 3300046491 | Bacteria | 19886 |
| 227 | Ga0495584_0002208 | 3300046491 | Bacteria | 11100 |
| 228 | Ga0495584_0022494 | 3300046491 | Bacteria | 3198 |
| 229 | Ga0495584_0090359 | 3300046491 | Bacteria | 1544 |
| 230 | Ga0495585_0000282 | 3300046492 | Bacteria | 50936 |
| 231 | Ga0495585_0001540 | 3300046492 | Bacteria | 17908 |
| 232 | Ga0495585_0002719 | 3300046492 | Bacteria | 12362 |
| 233 | Ga0495585_0009970 | 3300046492 | Bacteria | 5677 |
| 234 | Ga0495585_0012419 | 3300046492 | Bacteria | 5018 |
| 235 | Ga0495585_0030062 | 3300046492 | Bacteria | 3090 |
| 236 | Ga0495585_0043491 | 3300046492 | Bacteria | 2512 |
| 237 | Ga0495585_0085496 | 3300046492 | Bacteria | 1704 |
| 238 | Ga0495585_0087344 | 3300046492 | Bacteria | 1683 |
| 239 | Ga0495585_0124215 | 3300046492 | Bacteria | 1363 |
| 240 | Ga0495596_0000236 | 3300046500 | Bacteria | 37630 |
| 241 | Ga0495596_0026206 | 3300046500 | Bacteria | 2350 |
| 242 | Ga0495596_0094330 | 3300046500 | Bacteria | 1161 |
| 243 | Ga0495607_0000720 | 3300046501 | Bacteria | 31834 |
| 244 | Ga0495607_0002743 | 3300046501 | Bacteria | 14044 |
| 245 | Ga0495607_0028819 | 3300046501 | Bacteria | 3420 |
| 246 | Ga0495607_0030127 | 3300046501 | Bacteria | 3334 |
| 247 | Ga0495607_0060766 | 3300046501 | Bacteria | 2149 |
| 248 | Ga0495607_0079609 | 3300046501 | Bacteria | 1804 |
| 249 | Ga0495583_0000035 | 3300046506 | Bacteria | 246849 |
| 250 | Ga0495583_0000533 | 3300046506 | Bacteria | 53778 |
| 251 | Ga0495583_0015439 | 3300046506 | Bacteria | 4153 |
| 252 | Ga0495583_0146012 | 3300046506 | Bacteria | 982 |
| 253 | Ga0495606_0000011 | 3300046507 | Bacteria | 296816 |
| 254 | Ga0495606_0000156 | 3300046507 | Bacteria | 118821 |
| 255 | Ga0495606_0001370 | 3300046507 | Bacteria | 32980 |
| 256 | Ga0495606_0013757 | 3300046507 | Bacteria | 6368 |
| 257 | Ga0495606_0017341 | 3300046507 | Bacteria | 5449 |
| 258 | Ga0495606_0018661 | 3300046507 | Bacteria | 5192 |
| 259 | Ga0495606_0024090 | 3300046507 | Bacteria | 4397 |
| 260 | Ga0495606_0061816 | 3300046507 | Bacteria | 2393 |
| 261 | Ga0495608_0006692 | 3300046511 | Bacteria | 8170 |
| 262 | Ga0495608_0014117 | 3300046511 | Bacteria | 5543 |
| 263 | Ga0495610_0002417 | 3300046512 | Bacteria | 15726 |
| 264 | Ga0495610_0014767 | 3300046512 | Bacteria | 4572 |
| 265 | Ga0495610_0023778 | 3300046512 | Bacteria | 3322 |
| 266 | Ga0495610_0051345 | 3300046512 | Bacteria | 2007 |
| 267 | Ga0495610_0061409 | 3300046512 | Bacteria | 1785 |
| 268 | Ga0495610_0087120 | 3300046512 | Bacteria | 1421 |
| 269 | Ga0495616_0001160 | 3300046513 | Bacteria | 18645 |
| 270 | Ga0495616_0009093 | 3300046513 | Bacteria | 5827 |
| 271 | Ga0495616_0013212 | 3300046513 | Bacteria | 4666 |
| 272 | Ga0495616_0028329 | 3300046513 | Bacteria | 2966 |
| 273 | Ga0495616_0028692 | 3300046513 | Bacteria | 2944 |
| 274 | Ga0495616_0030695 | 3300046513 | Bacteria | 2821 |
| 275 | Ga0495616_0070380 | 3300046513 | Bacteria | 1693 |
| 276 | Ga0495618_0038079 | 3300046514 | Bacteria | 3021 |
| 277 | Ga0495628_0003780 | 3300046516 | Bacteria | 13478 |
| 278 | Ga0495628_0005081 | 3300046516 | Bacteria | 11565 |
| 279 | Ga0495631_0001988 | 3300046518 | Bacteria | 11954 |
| 280 | Ga0495631_0004070 | 3300046518 | Bacteria | 7855 |
| 281 | Ga0495631_0018177 | 3300046518 | Bacteria | 3313 |
| 282 | Ga0495631_0019851 | 3300046518 | Bacteria | 3146 |
| 283 | Ga0495631_0030489 | 3300046518 | Bacteria | 2446 |
| 284 | Ga0495631_0053157 | 3300046518 | Bacteria | 1768 |
| 285 | Ga0495632_0001939 | 3300046519 | Bacteria | 16513 |
| 286 | Ga0495632_0011971 | 3300046519 | Bacteria | 5030 |
| 287 | Ga0495632_0035643 | 3300046519 | Bacteria | 2537 |
| 288 | Ga0495632_0133679 | 3300046519 | Bacteria | 1153 |
| 289 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 290 | Ga0495637_0000230 | 3300046520 | Bacteria | 43334 |
| 291 | Ga0495637_0111875 | 3300046520 | Bacteria | 1057 |
| 292 | Ga0495643_0000170 | 3300046522 | Bacteria | 103438 |
| 293 | Ga0495643_0002817 | 3300046522 | Bacteria | 13272 |
| 294 | Ga0495643_0013083 | 3300046522 | Bacteria | 4983 |
| 295 | Ga0495643_0059271 | 3300046522 | Bacteria | 2035 |
| 296 | Ga0495643_0119259 | 3300046522 | Bacteria | 1335 |
| 297 | Ga0495644_0006414 | 3300046523 | Bacteria | 4558 |
| 298 | Ga0495644_0007598 | 3300046523 | Bacteria | 4178 |
| 299 | Ga0495644_0014135 | 3300046523 | Bacteria | 3058 |
| 300 | Ga0495644_0016693 | 3300046523 | Bacteria | 2809 |
| 301 | Ga0495644_0018970 | 3300046523 | Bacteria | 2625 |
| 302 | Ga0495644_0020066 | 3300046523 | Bacteria | 2550 |
| 303 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 304 | Ga0495648_0001030 | 3300046524 | Bacteria | 28338 |
| 305 | Ga0495648_0005449 | 3300046524 | Bacteria | 10562 |
| 306 | Ga0495648_0005800 | 3300046524 | Bacteria | 10179 |
| 307 | Ga0495648_0018466 | 3300046524 | Bacteria | 4935 |
| 308 | Ga0495648_0043686 | 3300046524 | Bacteria | 2806 |
| 309 | Ga0495663_0030430 | 3300046525 | Bacteria | 1600 |
| 310 | Ga0495642_0005908 | 3300046528 | Bacteria | 4694 |
| 311 | Ga0495642_0010902 | 3300046528 | Bacteria | 3484 |
| 312 | Ga0495642_0137711 | 3300046528 | Bacteria | 1053 |
| 313 | Ga0495652_0008038 | 3300046529 | Bacteria | 9667 |
| 314 | Ga0495652_0090958 | 3300046529 | Bacteria | 2495 |
| 315 | Ga0495654_0000028 | 3300046530 | Bacteria | 223384 |
| 316 | Ga0495654_0023794 | 3300046530 | Bacteria | 3170 |
| 317 | Ga0495609_0002199 | 3300046538 | Bacteria | 12226 |
| 318 | Ga0495609_0003695 | 3300046538 | Bacteria | 8661 |
| 319 | Ga0495609_0003800 | 3300046538 | Bacteria | 8503 |
| 320 | Ga0495609_0004814 | 3300046538 | Bacteria | 7280 |
| 321 | Ga0495609_0016896 | 3300046538 | Bacteria | 3396 |
| 322 | Ga0495609_0034208 | 3300046538 | Bacteria | 2304 |
| 323 | Ga0495609_0085294 | 3300046538 | Bacteria | 1377 |
| 324 | Ga0495597_0000289 | 3300046542 | Bacteria | 45132 |
| 325 | Ga0495597_0002615 | 3300046542 | Bacteria | 11204 |
| 326 | Ga0495597_0007644 | 3300046542 | Bacteria | 5470 |
| 327 | Ga0495597_0031535 | 3300046542 | Bacteria | 2410 |
| 328 | Ga0495645_0017644 | 3300046543 | Bacteria | 5115 |
| 329 | Ga0495645_0059193 | 3300046543 | Bacteria | 2778 |
| 330 | Ga0495622_0000087 | 3300046557 | Bacteria | 82912 |
| 331 | Ga0495622_0053206 | 3300046557 | Bacteria | 1878 |
| 332 | Ga0495622_0071340 | 3300046557 | Bacteria | 1603 |
| 333 | Ga0495633_0000727 | 3300046558 | Bacteria | 29818 |
| 334 | Ga0495633_0001004 | 3300046558 | Bacteria | 23116 |
| 335 | Ga0495633_0001667 | 3300046558 | Bacteria | 16758 |
| 336 | Ga0495633_0002672 | 3300046558 | Bacteria | 12403 |
| 337 | Ga0495633_0006941 | 3300046558 | Bacteria | 6620 |
| 338 | Ga0495633_0016794 | 3300046558 | Bacteria | 3760 |
| 339 | Ga0495633_0018092 | 3300046558 | Bacteria | 3584 |
| 340 | Ga0495633_0021984 | 3300046558 | Bacteria | 3182 |
| 341 | Ga0495633_0035211 | 3300046558 | Bacteria | 2404 |
| 342 | Ga0495633_0085855 | 3300046558 | Bacteria | 1463 |
| 343 | Ga0495668_0000048 | 3300046616 | Bacteria | 217867 |
| 344 | Ga0495668_0000185 | 3300046616 | Bacteria | 92731 |
| 345 | Ga0495668_0000378 | 3300046616 | Bacteria | 59112 |
| 346 | Ga0495668_0002254 | 3300046616 | Bacteria | 16242 |
| 347 | Ga0495668_0022303 | 3300046616 | Bacteria | 3620 |
| 348 | Ga0495668_0022871 | 3300046616 | Bacteria | 3570 |
| 349 | Ga0495668_0257963 | 3300046616 | Bacteria | 954 |
| 350 | Ga0495611_0000778 | 3300046648 | Bacteria | 17723 |
| 351 | Ga0495611_0003825 | 3300046648 | Bacteria | 6566 |
| 352 | Ga0495611_0031129 | 3300046648 | Bacteria | 2347 |
| 353 | Ga0495611_0051801 | 3300046648 | Bacteria | 1851 |
| 354 | Ga0495611_0095686 | 3300046648 | Bacteria | 1374 |
| 355 | Ga0495625_0000164 | 3300046660 | Bacteria | 103037 |
| 356 | Ga0495625_0000372 | 3300046660 | Bacteria | 68695 |
| 357 | Ga0495625_0000925 | 3300046660 | Bacteria | 39454 |
| 358 | Ga0495625_0001300 | 3300046660 | Bacteria | 31240 |
| 359 | Ga0495625_0130366 | 3300046660 | Bacteria | 1703 |
| 360 | Ga0495659_0003759 | 3300046664 | Bacteria | 4826 |
| 361 | Ga0495661_0002081 | 3300046665 | Bacteria | 15698 |
| 362 | Ga0495661_0002174 | 3300046665 | Bacteria | 15309 |
| 363 | Ga0495661_0003078 | 3300046665 | Bacteria | 12540 |
| 364 | Ga0495661_0025875 | 3300046665 | Bacteria | 3784 |
| 365 | Ga0495661_0034146 | 3300046665 | Bacteria | 3202 |
| 366 | Ga0495661_0049235 | 3300046665 | Bacteria | 2556 |
| 367 | Ga0495661_0123422 | 3300046665 | Bacteria | 1427 |
| 368 | Ga0495661_0161765 | 3300046665 | Bacteria | 1201 |
| 369 | Ga0495661_0170305 | 3300046665 | Bacteria | 1162 |
| 370 | Ga0495588_0065241 | 3300046674 | Bacteria | 1888 |
| 371 | Ga0495657_0169287 | 3300046675 | Bacteria | 1346 |
| 372 | Ga0495599_0001150 | 3300046678 | Bacteria | 14996 |
| 373 | Ga0495623_0014783 | 3300046679 | Bacteria | 5045 |
| 374 | Ga0495623_0026212 | 3300046679 | Bacteria | 3753 |
| 375 | Ga0495646_0005539 | 3300046680 | Bacteria | 7985 |
| 376 | Ga0495646_0010931 | 3300046680 | Bacteria | 5764 |
| 377 | Ga0495669_0003235 | 3300046684 | Bacteria | 6701 |
| 378 | Ga0495669_0007213 | 3300046684 | Bacteria | 4658 |
| 379 | Ga0495669_0008369 | 3300046684 | Bacteria | 4347 |
| 380 | Ga0495624_0020213 | 3300046690 | Bacteria | 4435 |
| 381 | Ga0495670_0028974 | 3300046691 | Bacteria | 2746 |
| 382 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 383 | Ga0495671_0007946 | 3300046692 | Bacteria | 6001 |
| 384 | Ga0495671_0013142 | 3300046692 | Bacteria | 4495 |
| 385 | Ga0495671_0117202 | 3300046692 | Bacteria | 1300 |
| 386 | Ga0495649_0000825 | 3300046694 | Bacteria | 24917 |
| 387 | Ga0495649_0008171 | 3300046694 | Bacteria | 6311 |
| 388 | Ga0495649_0014919 | 3300046694 | Bacteria | 4440 |
| 389 | Ga0495600_0000857 | 3300046809 | Bacteria | 16227 |
| 390 | Ga0495660_0000215 | 3300046810 | Bacteria | 58954 |
| 391 | Ga0495660_0002871 | 3300046810 | Bacteria | 10832 |
| 392 | Ga0495660_0004775 | 3300046810 | Bacteria | 8185 |
| 393 | Ga0495660_0007119 | 3300046810 | Bacteria | 6590 |
| 394 | Ga0495660_0007416 | 3300046810 | Bacteria | 6439 |
| 395 | Ga0495660_0029378 | 3300046810 | Bacteria | 3102 |
| 396 | Ga0495604_0006145 | 3300047317 | Bacteria | 9531 |
| 397 | Ga0495636_0001331 | 3300047318 | Bacteria | 9381 |
| 398 | Ga0495672_0000477 | 3300047320 | Bacteria | 47447 |
| 399 | Ga0495672_0000549 | 3300047320 | Bacteria | 42649 |
| 400 | Ga0495672_0000590 | 3300047320 | Bacteria | 41027 |
| 401 | Ga0495672_0064671 | 3300047320 | Bacteria | 2093 |
| 402 | Ga0495672_0076129 | 3300047320 | Bacteria | 1885 |
| 403 | Ga0495683_0000423 | 3300047323 | Bacteria | 33823 |
| 404 | Ga0495683_0001542 | 3300047323 | Bacteria | 14920 |
| 405 | Ga0495683_0050817 | 3300047323 | Bacteria | 2074 |
| 406 | Ga0495687_000148 | 3300047443 | Bacteria | 106947 |
| 407 | Ga0495687_002695 | 3300047443 | Bacteria | 13782 |
| 408 | Ga0495687_002776 | 3300047443 | Bacteria | 13551 |
| 409 | Ga0495677_0001205 | 3300047445 | Bacteria | 10352 |
| 410 | Ga0495677_0003426 | 3300047445 | Bacteria | 6160 |
| 411 | Ga0495677_0003541 | 3300047445 | Bacteria | 6058 |
| 412 | Ga0495677_0011672 | 3300047445 | Bacteria | 3210 |
| 413 | Ga0495677_0025091 | 3300047445 | Bacteria | 2162 |
| 414 | Ga0495677_0031376 | 3300047445 | Bacteria | 1934 |
| 415 | Ga0495679_012059 | 3300047446 | Bacteria | 3309 |
| 416 | Ga0495679_020770 | 3300047446 | Bacteria | 2281 |
| 417 | Ga0495679_025460 | 3300047446 | Bacteria | 1977 |
| 418 | Ga0495685_000018 | 3300047447 | Bacteria | 74016 |
| 419 | Ga0495685_007739 | 3300047447 | Bacteria | 3556 |
| 420 | Ga0495685_010293 | 3300047447 | Bacteria | 3134 |
| 421 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 422 | Ga0495673_0000100 | 3300047469 | Bacteria | 173962 |
| 423 | Ga0495673_0007838 | 3300047469 | Bacteria | 6074 |
| 424 | Ga0495673_0102459 | 3300047469 | Bacteria | 1155 |
| 425 | Ga0495681_0002720 | 3300047470 | Bacteria | 12506 |
| 426 | Ga0495681_0003523 | 3300047470 | Bacteria | 10879 |
| 427 | Ga0495681_0019135 | 3300047470 | Bacteria | 3748 |
| 428 | Ga0495681_0027075 | 3300047470 | Bacteria | 2972 |
| 429 | Ga0495681_0035303 | 3300047470 | Bacteria | 2483 |
| 430 | Ga0495686_0001020 | 3300047472 | Bacteria | 33872 |
| 431 | Ga0495686_0014956 | 3300047472 | Bacteria | 5322 |
| 432 | Ga0495686_0022931 | 3300047472 | Bacteria | 4124 |
| 433 | Ga0495686_0183683 | 3300047472 | Bacteria | 1210 |
| 434 | Ga0495602_0043420 | 3300048088 | Bacteria | 4088 |
| 435 | Ga0495626_0000026 | 3300048091 | Bacteria | 207698 |
| 436 | Ga0495626_0004798 | 3300048091 | Bacteria | 8158 |
| 437 | Ga0495626_0005823 | 3300048091 | Bacteria | 7108 |
| 438 | Ga0495626_0011806 | 3300048091 | Bacteria | 4601 |
| 439 | Ga0495626_0018337 | 3300048091 | Bacteria | 3516 |
| 440 | Ga0495626_0030209 | 3300048091 | Bacteria | 2614 |
| 441 | Ga0496100_0014139 | 3300048903 | Bacteria | 4625 |
| 442 | Ga0496101_0108916 | 3300048904 | Bacteria | 2083 |
| 443 | Ga0496102_0042128 | 3300048905 | Bacteria | 4137 |
| 444 | Ga0496102_0424364 | 3300048905 | Bacteria | 1249 |
| 445 | Ga0496105_0324304 | 3300048908 | Bacteria | 1234 |
| 446 | Ga0496106_0102393 | 3300048909 | Bacteria | 2221 |
| 447 | Ga0496107_0050197 | 3300048910 | Bacteria | 3007 |
| 448 | Ga0496109_0216343 | 3300048912 | Bacteria | 1802 |
| 449 | Ga0496110_0444272 | 3300048913 | Bacteria | 1182 |
| 450 | Ga0496110_0532580 | 3300048913 | Bacteria | 1068 |
| 451 | Ga0496111_0015643 | 3300048914 | Bacteria | 5214 |
| 452 | Ga0496112_0253804 | 3300048915 | Bacteria | 1709 |
| 453 | Ga0496113_0023588 | 3300048916 | Bacteria | 4363 |
| 454 | Ga0496116_0032337 | 3300048919 | Bacteria | 3730 |
| 455 | Ga0496116_0038374 | 3300048919 | Bacteria | 3327 |
| 456 | Ga0496116_0173482 | 3300048919 | Bacteria | 1165 |
| 457 | Ga0496117_0000132 | 3300048920 | Bacteria | 162117 |
| 458 | Ga0496118_0000099 | 3300048921 | Bacteria | 160412 |
| 459 | Ga0496118_0193120 | 3300048921 | Bacteria | 1215 |
| 460 | Ga0496119_0064930 | 3300048922 | Bacteria | 2165 |
| 461 | Ga0496121_0005743 | 3300048924 | Bacteria | 15756 |
| 462 | Ga0496121_0019888 | 3300048924 | Bacteria | 6684 |
| 463 | Ga0496121_0037606 | 3300048924 | Bacteria | 4297 |
| 464 | Ga0496121_0051735 | 3300048924 | Bacteria | 3457 |
| 465 | Ga0496121_0078670 | 3300048924 | Bacteria | 2621 |
| 466 | Ga0496121_0141597 | 3300048924 | Bacteria | 1783 |
| 467 | Ga0496121_0156778 | 3300048924 | Bacteria | 1670 |
| 468 | Ga0496121_0291649 | 3300048924 | Bacteria | 1111 |
| 469 | Ga0496122_0001387 | 3300048925 | Bacteria | 39286 |
| 470 | Ga0496122_0003476 | 3300048925 | Bacteria | 20726 |
| 471 | Ga0496122_0005530 | 3300048925 | Bacteria | 15007 |
| 472 | Ga0496122_0023040 | 3300048925 | Bacteria | 5510 |
| 473 | Ga0496122_0177536 | 3300048925 | Bacteria | 1275 |
| 474 | Ga0496123_0000180 | 3300048926 | Bacteria | 127726 |
| 475 | Ga0496123_0004067 | 3300048926 | Bacteria | 15752 |
| 476 | Ga0496123_0005184 | 3300048926 | Bacteria | 13252 |
| 477 | Ga0496123_0184949 | 3300048926 | Bacteria | 1084 |
| 478 | Ga0496124_0012720 | 3300048927 | Bacteria | 8275 |
| 479 | Ga0496124_0025147 | 3300048927 | Bacteria | 5398 |
| 480 | Ga0496124_0061700 | 3300048927 | Bacteria | 3141 |
| 481 | Ga0496124_0106932 | 3300048927 | Bacteria | 2258 |
| 482 | Ga0496124_0137123 | 3300048927 | Bacteria | 1936 |
| 483 | Ga0496124_0180714 | 3300048927 | Bacteria | 1624 |
| 484 | Ga0496125_0003731 | 3300048928 | Bacteria | 18151 |
| 485 | Ga0496125_0004083 | 3300048928 | Bacteria | 17080 |
| 486 | Ga0496125_0004935 | 3300048928 | Bacteria | 15102 |
| 487 | Ga0496125_0094783 | 3300048928 | Bacteria | 2222 |
| 488 | Ga0496125_0108107 | 3300048928 | Bacteria | 2024 |
| 489 | Ga0496126_0024631 | 3300048929 | Bacteria | 5806 |
| 490 | Ga0496126_0107990 | 3300048929 | Bacteria | 2427 |
| 491 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 492 | Ga0495678_000335 | 3300049459 | Bacteria | 49388 |
| 493 | Ga0495678_062004 | 3300049459 | Bacteria | 1400 |
| 494 | Ga0495682_0002266 | 3300049460 | Bacteria | 9232 |
| 495 | Ga0495682_0002534 | 3300049460 | Bacteria | 8603 |
| 496 | Ga0495682_0003829 | 3300049460 | Bacteria | 6599 |
| 497 | Ga0495682_0009178 | 3300049460 | Bacteria | 3871 |
| 498 | Ga0495682_0021057 | 3300049460 | Bacteria | 2445 |
| 499 | Ga0501034_0280469 | 3300049571 | Bacteria | 1606 |
| 500 | Ga0501043_0457989 | 3300049579 | Bacteria | 957 |
| 501 | Ga0501047_0209247 | 3300049581 | Bacteria | 1809 |
| 502 | Ga0501080_0070542 | 3300049742 | Bacteria | 3250 |
| 503 | Ga0501269_000023 | 3300049766 | Bacteria | 53029 |
| 504 | Ga0501279_002841 | 3300049775 | Bacteria | 2258 |
| 505 | Ga0501035_0005111 | 3300049822 | Bacteria | 12426 |
| 506 | Ga0501044_0059830 | 3300049823 | Bacteria | 3902 |
| 507 | Ga0501044_0202995 | 3300049823 | Bacteria | 1940 |
| 508 | Ga0495601_0016461 | 3300053077 | Bacteria | 4480 |
| 509 | Ga0495655_0082844 | 3300053083 | Bacteria | 920 |
| 510 | Ga0500646_0003084 | 3300053090 | Bacteria | 4272 |
| 511 | Ga0500651_0006700 | 3300053093 | Bacteria | 6667 |
| 512 | Ga0500641_0001358 | 3300053096 | Bacteria | 8702 |
| 513 | Ga0500555_006346 | 3300053103 | Bacteria | 3357 |
| 514 | Ga0500595_001700 | 3300053119 | Bacteria | 11534 |
| 515 | Ga0500595_005617 | 3300053119 | Bacteria | 5454 |
| 516 | Ga0500607_086185 | 3300053121 | Bacteria | 1591 |
| 517 | Ga0500618_000358 | 3300053125 | Bacteria | 31730 |
| 518 | Ga0500642_0001266 | 3300053130 | Bacteria | 7235 |
| 519 | Ga0500642_0019822 | 3300053130 | Bacteria | 2631 |
| 520 | Ga0500658_0071953 | 3300053134 | Bacteria | 1461 |
| 521 | Ga0500658_0099548 | 3300053134 | Bacteria | 1267 |
| 522 | Ga0500568_0007626 | 3300053139 | Bacteria | 5288 |
| 523 | Ga0500568_0027205 | 3300053139 | Bacteria | 2393 |
| 524 | Ga0500574_005248 | 3300053141 | Bacteria | 2504 |
| 525 | Ga0500586_013088 | 3300053145 | Bacteria | 2433 |
| 526 | Ga0500588_0002990 | 3300053146 | Bacteria | 3521 |
| 527 | Ga0500588_0007736 | 3300053146 | Bacteria | 2488 |
| 528 | Ga0500604_0091821 | 3300053151 | Bacteria | 992 |
| 529 | Ga0500616_0000749 | 3300053153 | Bacteria | 37374 |
| 530 | Ga0500616_0011753 | 3300053153 | Bacteria | 5152 |
| 531 | Ga0500619_000541 | 3300053154 | Bacteria | 6487 |
| 532 | Ga0500624_002391 | 3300053157 | Bacteria | 2546 |
| 533 | Ga0500627_0167191 | 3300053158 | Bacteria | 992 |
| 534 | Ga0500609_002453 | 3300053731 | Bacteria | 2641 |
| 535 | Ga0501084_0142511 | 3300054114 | Bacteria | 2018 |
| 536 | 2511250263 | 2511231003 | Bacteria | 5606035 |
| 537 | 2550692461 | 2548876994 | Bacteria | 4904866 |
| 538 | 2601670181 | 2600255292 | Bacteria | 6300551 |
| 539 | 2644027757 | 2643221603 | Bacteria | 6147767 |
| 540 | 2644215866 | 2643221638 | Bacteria | 6579467 |
| 541 | 2739153080 | 2738541357 | Bacteria | 6549408 |
| 542 | 2739195000 | 2738543003 | Bacteria | 6549560 |
| 543 | 2739277449 | 2738543018 | Bacteria | 6718814 |
| 544 | 2739321476 | 2738543026 | Bacteria | 6549408 |
| 545 | 2739339968 | 2738543029 | Bacteria | 6549249 |
| 546 | 2739346628 | 2738543030 | Bacteria | 6719714 |
| 547 | 2765568866 | 2765235838 | Bacteria | 5445269 |
| 548 | 2809145333 | 2808606418 | Bacteria | 6724496 |
| 549 | 2819541272 | 2818991436 | Bacteria | 5376622 |
| 550 | 2819592181 | 2818991445 | Bacteria | 4955017 |
| 551 | 2821131523 | 2821131069 | Bacteria | 6108407 |
| 552 | 2839096253 | 2839094727 | Bacteria | 5534556 |
| 553 | 2842714112 | 2842711865 | Bacteria | 7155354 |
| 554 | 2857553089 | 2857547612 | Bacteria | 6179999 |
| 555 | 2857554405 | 2857553236 | Bacteria | 6166726 |
| 556 | 2857560017 | 2857558681 | Bacteria | 6617694 |
| 557 | 2857564810 | 2857564685 | Bacteria | 6290584 |
| 558 | 2884816113 | 2884811622 | Bacteria | 5552861 |
| 559 | 2884840397 | 2884836552 | Bacteria | 5219991 |
| 560 | 2884855653 | 2884852848 | Bacteria | 5221161 |
| 561 | 2885084262 | 2885080285 | Bacteria | 6355622 |
| 562 | 2896157421 | 2896154374 | Bacteria | 5221518 |
| 563 | 2904426101 | 2904424332 | Bacteria | 7633521 |
| 564 | 2919478492 | 2919476304 | Bacteria | 5888696 |
| 565 | 2932413688 | 2932410948 | Bacteria | 6312192 |
| 566 | 2932417748 | 2932416698 | Bacteria | 6315112 |
| 567 | Ga0496123_0022756 | |||
| 568 | JGI25155J39150_1000284 | |||
| 569 | JGI25155J39150_1000359 | |||
| 570 | JGI25156J39149_1000110 | |||
| 571 | JGI25162J39368_1000091 | |||
| 572 | JGI25162J39368_1004743 | |||
| 573 | JGI25154J39366_1000117 | |||
| 574 | JGI25154J39366_1000231 | |||
| 575 | JGI25154J39366_1001222 | |||
| 576 | JGI25158J39367_1000664 | |||
| 577 | JGI25157J39369_1000705 | |||
| 578 | JGI25163J39215_1002784 | |||
| 579 | JGI25152J39213_1000011 | |||
| 580 | JGI25150J39212_1000192 | |||
| 581 | JGI25159J45721_1002888 | |||
| 582 | JGI25159J45721_1005248 | |||
| 583 | JGI25165J46597_1000172 | |||
| 584 | JGI25153J46596_10000177 | |||
| 585 | JGI25153J46596_10017322 | |||
| 586 | rootL2_10030296 | |||
| 587 | JGI25161J50226_1000320 | |||
| 588 | Ga0055538_1000063 | |||
| 589 | Ga0055539_1000096 | |||
| 590 | Ga0055533_1000107 | |||
| 591 | Ga0055532_1000015 | |||
| 592 | Ga0055525_1000140 | |||
| 593 | Ga0055535_1009130 | |||
| 594 | Ga0055529_1000390 | |||
| 595 | Ga0055526_1000074 | |||
| 596 | Ga0055526_1000086 | |||
| 597 | Ga0055526_1000092 | |||
| 598 | Ga0055526_1003041 | |||
| 599 | Ga0055537_1000012 | |||
| 600 | Ga0055524_1000021 | |||
| 601 | Ga0055524_1000099 | |||
| 602 | Ga0055524_1000917 | |||
| 603 | Ga0055534_1000436 | |||
| 604 | Ga0055534_1009245 | |||
| 605 | Ga0055528_1000134 | |||
| 606 | Ga0055531_10001186 | |||
| 607 | Ga0055541_1000064 | |||
| 608 | Ga0055543_1000224 | |||
| 609 | Ga0055543_1001825 | |||
| 610 | Ga0055543_1009139 | |||
| 611 | Ga0065165_1000055 | |||
| 612 | Ga0065165_1001224 | |||
| 613 | Ga0065165_1013965 | |||
| 614 | Ga0065165_1023108 | |||
| 615 | Ga0065704_10191543 | |||
| 616 | Ga0070658_10206342 | |||
| 617 | Ga0068855_100029241 | |||
| 618 | Ga0068855_100077054 | |||
| 619 | Ga0068856_100046976 | |||
| 620 | Ga0068852_100173688 | |||
| 621 | Ga0068852_100179309 | |||
| 622 | Ga0068862_100064282 | |||
| 623 | Ga0070712_100069526 | |||
| 624 | Ga0075428_100125369 | |||
| 625 | Ga0068865_100096889 | |||
| 626 | Ga0079104_1022921 | |||
| 627 | Ga0099826_10000002 | |||
| 628 | Ga0105251_10058809 | |||
| 629 | Ga0105244_10007123 | |||
| 630 | Ga0105244_10008840 | |||
| 631 | Ga0105244_10026932 | |||
| 632 | Ga0105243_10315853 | |||
| 633 | Ga0105242_10420895 | |||
| 634 | Ga0105238_10223668 | |||
| 635 | Ga0105239_10503697 | |||
| 636 | Ga0157371_10000078 | |||
| 637 | Ga0182008_10006868 | |||
| 638 | Ga0182006_1000026 | |||
| 639 | Ga0182006_1000097 | |||
| 640 | Ga0182006_1011001 | |||
| 641 | Ga0182007_10000227 | |||
| 642 | Ga0182007_10006048 | |||
| 643 | Ga0182005_1000007 | |||
| 644 | Ga0182005_1000038 | |||
| 645 | Ga0182005_1000505 | |||
| 646 | Ga0163161_10041925 | |||
| 647 | Ga0163161_10073546 | |||
| 648 | Ga0213872_10088621 | |||
| 649 | Ga0209435_100021 | |||
| 650 | Ga0209435_100163 | |||
| 651 | Ga0209436_100144 | |||
| 652 | Ga0209784_100079 | |||
| 653 | Ga0209566_100093 | |||
| 654 | Ga0209674_100115 | |||
| 655 | Ga0209147_100004 | |||
| 656 | Ga0209563_100007 | |||
| 657 | Ga0209563_100113 | |||
| 658 | Ga0209437_100045 | |||
| 659 | Ga0209437_100176 | |||
| 660 | Ga0209258_100083 | |||
| 661 | Ga0207425_1000001 | |||
| 662 | Ga0207425_1000059 | |||
| 663 | Ga0209646_1000010 | |||
| 664 | Ga0209646_1000020 | |||
| 665 | Ga0209646_1000074 | |||
| 666 | Ga0209026_1000058 | |||
| 667 | Ga0209026_1001283 | |||
| 668 | Ga0209026_1004032 | |||
| 669 | Ga0209677_100072 | |||
| 670 | Ga0209677_103791 | |||
| 671 | Ga0209759_1000046 | |||
| 672 | Ga0209759_1000073 | |||
| 673 | Ga0209129_1000001 | |||
| 674 | Ga0209233_1000183 | |||
| 675 | Ga0209565_1000057 | |||
| 676 | Ga0209565_1004533 | |||
| 677 | Ga0209455_1000037 | |||
| 678 | Ga0209673_1000051 | |||
| 679 | Ga0209130_1000197 | |||
| 680 | Ga0209130_1000588 | |||
| 681 | Ga0209130_1004697 | |||
| 682 | Ga0209675_1000027 | |||
| 683 | Ga0209675_1001414 | |||
| 684 | Ga0209025_1023174 | |||
| 685 | Ga0209564_1000009 | |||
| 686 | Ga0209564_1000033 | |||
| 687 | Ga0209564_1000094 | |||
| 688 | Ga0209564_1014621 | |||
| 689 | Ga0209758_1000033 | |||
| 690 | Ga0209758_1000073 | |||
| 691 | Ga0209758_1000227 | |||
| 692 | Ga0209758_1004049 | |||
| 693 | Ga0209050_1000046 | |||
| 694 | Ga0209050_1000269 | |||
| 695 | Ga0209050_1013081 | |||
| 696 | Ga0209050_1024836 | |||
| 697 | Ga0209256_1000044 | |||
| 698 | Ga0209256_1000116 | |||
| 699 | Ga0209256_1000139 | |||
| 700 | Ga0209256_1000145 | |||
| 701 | Ga0207426_1006629 | |||
| 702 | Ga0207426_1012949 | |||
| 703 | Ga0207426_1036941 | |||
| 704 | Ga0209257_1000068 | |||
| 705 | Ga0209257_1000239 | |||
| 706 | Ga0209257_1008912 | |||
| 707 | Ga0209257_1028456 | |||
| 708 | Ga0207655_1009719 | |||
| 709 | Ga0207655_1010839 | |||
| 710 | Ga0207705_10004777 | |||
| 711 | Ga0207654_10048890 | |||
| 712 | Ga0207695_10004054 | |||
| 713 | Ga0207695_10285792 | |||
| 714 | Ga0207693_10228504 | |||
| 715 | Ga0207657_10101987 | |||
| 716 | Ga0207657_10476766 | |||
| 717 | Ga0207694_10092084 | |||
| 718 | Ga0207694_10145587 | |||
| 719 | Ga0207706_10115916 | |||
| 720 | Ga0207704_10050448 | |||
| 721 | Ga0207667_10016858 | |||
| 722 | Ga0207667_10049408 | |||
| 723 | Ga0207667_10176600 | |||
| 724 | Ga0207702_10030896 | |||
| 725 | Ga0207698_10244247 | |||
| 726 | Ga0207698_10404681 | |||
| 727 | Ga0209282_1000001 | |||
| 728 | Ga0268265_10002366 | |||
| 729 | Ga0307513_10117821 | |||
| 730 | Ga0307408_100001025 | |||
| 731 | Ga0307408_100006114 | |||
| 732 | Ga0307408_100014545 | |||
| 733 | Ga0395899_0003263 | |||
| 734 | Ga0395899_0006655 | |||
| 735 | Ga0395899_0009771 | |||
| 736 | Ga0395899_0011753 | |||
| 737 | Ga0395899_0018969 | |||
| 738 | Ga0395900_0000393 | |||
| 739 | Ga0395900_0001606 | |||
| 740 | Ga0395900_0006618 | |||
| 741 | Ga0395900_0010222 | |||
| 742 | Ga0395900_0140847 | |||
| 743 | Ga0395898_0015586 | |||
| 744 | Ga0395898_0033549 | |||
| 745 | Ga0395905_0000455 | |||
| 746 | Ga0395905_0059442 | |||
| 747 | Ga0395901_0000054 | |||
| 748 | Ga0395901_0002967 | |||
| 749 | Ga0395901_0009279 | |||
| 750 | Ga0395901_0009778 | |||
| 751 | Ga0395901_0068798 | |||
| 752 | Ga0439448_0030272 | |||
| 753 | Ga0439458_0020240 | |||
| 754 | Ga0466972_0000163 | |||
| 755 | Ga0466972_0014599 | |||
| 756 | Ga0466965_0017485 | |||
| 757 | Ga0466965_0072542 | |||
| 758 | Ga0466965_0149209 | |||
| 759 | Ga0466966_0006906 | |||
| 760 | Ga0466964_0009038 | |||
| 761 | Ga0466968_0006093 | |||
| 762 | Ga0466968_0027908 | |||
| 763 | Ga0466970_0009193 | |||
| 764 | Ga0466957_0002945 | |||
| 765 | Ga0466959_0002491 | |||
| 766 | Ga0466967_0075933 | |||
| 767 | Ga0495617_000037 | |||
| 768 | Ga0495617_004402 | |||
| 769 | Ga0495627_000007 | |||
| 770 | Ga0495627_011001 | |||
| 771 | Ga0495627_058164 | |||
| 772 | Ga0495592_0018741 | |||
| 773 | Ga0495591_000218 | |||
| 774 | Ga0495591_013480 | |||
| 775 | Ga0495638_0000525 | |||
| 776 | Ga0495638_0039264 | |||
| 777 | Ga0495638_0041783 | |||
| 778 | Ga0495638_0050710 | |||
| 779 | Ga0495638_0199697 | |||
| 780 | Ga0495651_0001054 | |||
| 781 | Ga0495651_0196856 | |||
| 782 | Ga0495653_0000002 | |||
| 783 | Ga0495650_0000156 | |||
| 784 | Ga0495650_0000166 | |||
| 785 | Ga0495650_0008179 | |||
| 786 | Ga0495650_0030138 | |||
| 787 | Ga0495605_0000059 | |||
| 788 | Ga0495605_0003743 | |||
| 789 | Ga0495605_0007373 | |||
| 790 | Ga0495605_0022799 | |||
| 791 | Ga0495605_0114990 | |||
| 792 | Ga0495584_0000842 | |||
| 793 | Ga0495584_0002208 | |||
| 794 | Ga0495584_0022494 | |||
| 795 | Ga0495584_0090359 | |||
| 796 | Ga0495585_0000282 | |||
| 797 | Ga0495585_0001540 | |||
| 798 | Ga0495585_0002719 | |||
| 799 | Ga0495585_0009970 | |||
| 800 | Ga0495585_0012419 | |||
| 801 | Ga0495585_0030062 | |||
| 802 | Ga0495585_0043491 | |||
| 803 | Ga0495585_0085496 | |||
| 804 | Ga0495585_0087344 | |||
| 805 | Ga0495585_0124215 | |||
| 806 | Ga0495596_0000236 | |||
| 807 | Ga0495596_0026206 | |||
| 808 | Ga0495596_0094330 | |||
| 809 | Ga0495607_0000720 | |||
| 810 | Ga0495607_0002743 | |||
| 811 | Ga0495607_0028819 | |||
| 812 | Ga0495607_0030127 | |||
| 813 | Ga0495607_0060766 | |||
| 814 | Ga0495607_0079609 | |||
| 815 | Ga0495583_0000035 | |||
| 816 | Ga0495583_0000533 | |||
| 817 | Ga0495583_0015439 | |||
| 818 | Ga0495583_0146012 | |||
| 819 | Ga0495606_0000011 | |||
| 820 | Ga0495606_0000156 | |||
| 821 | Ga0495606_0001370 | |||
| 822 | Ga0495606_0013757 | |||
| 823 | Ga0495606_0017341 | |||
| 824 | Ga0495606_0018661 | |||
| 825 | Ga0495606_0024090 | |||
| 826 | Ga0495606_0061816 | |||
| 827 | Ga0495608_0006692 | |||
| 828 | Ga0495608_0014117 | |||
| 829 | Ga0495610_0002417 | |||
| 830 | Ga0495610_0014767 | |||
| 831 | Ga0495610_0023778 | |||
| 832 | Ga0495610_0051345 | |||
| 833 | Ga0495610_0061409 | |||
| 834 | Ga0495610_0087120 | |||
| 835 | Ga0495616_0001160 | |||
| 836 | Ga0495616_0009093 | |||
| 837 | Ga0495616_0013212 | |||
| 838 | Ga0495616_0028329 | |||
| 839 | Ga0495616_0028692 | |||
| 840 | Ga0495616_0030695 | |||
| 841 | Ga0495616_0070380 | |||
| 842 | Ga0495618_0038079 | |||
| 843 | Ga0495628_0003780 | |||
| 844 | Ga0495628_0005081 | |||
| 845 | Ga0495631_0001988 | |||
| 846 | Ga0495631_0004070 | |||
| 847 | Ga0495631_0018177 | |||
| 848 | Ga0495631_0019851 | |||
| 849 | Ga0495631_0030489 | |||
| 850 | Ga0495631_0053157 | |||
| 851 | Ga0495632_0001939 | |||
| 852 | Ga0495632_0011971 | |||
| 853 | Ga0495632_0035643 | |||
| 854 | Ga0495632_0133679 | |||
| 855 | Ga0495637_0000004 | |||
| 856 | Ga0495637_0000230 | |||
| 857 | Ga0495637_0111875 | |||
| 858 | Ga0495643_0000170 | |||
| 859 | Ga0495643_0002817 | |||
| 860 | Ga0495643_0013083 | |||
| 861 | Ga0495643_0059271 | |||
| 862 | Ga0495643_0119259 | |||
| 863 | Ga0495644_0006414 | |||
| 864 | Ga0495644_0007598 | |||
| 865 | Ga0495644_0014135 | |||
| 866 | Ga0495644_0016693 | |||
| 867 | Ga0495644_0018970 | |||
| 868 | Ga0495644_0020066 | |||
| 869 | Ga0495648_0000001 | |||
| 870 | Ga0495648_0001030 | |||
| 871 | Ga0495648_0005449 | |||
| 872 | Ga0495648_0005800 | |||
| 873 | Ga0495648_0018466 | |||
| 874 | Ga0495648_0043686 | |||
| 875 | Ga0495663_0030430 | |||
| 876 | Ga0495642_0005908 | |||
| 877 | Ga0495642_0010902 | |||
| 878 | Ga0495642_0137711 | |||
| 879 | Ga0495652_0008038 | |||
| 880 | Ga0495652_0090958 | |||
| 881 | Ga0495654_0000028 | |||
| 882 | Ga0495654_0023794 | |||
| 883 | Ga0495609_0002199 | |||
| 884 | Ga0495609_0003695 | |||
| 885 | Ga0495609_0003800 | |||
| 886 | Ga0495609_0004814 | |||
| 887 | Ga0495609_0016896 | |||
| 888 | Ga0495609_0034208 | |||
| 889 | Ga0495609_0085294 | |||
| 890 | Ga0495597_0000289 | |||
| 891 | Ga0495597_0002615 | |||
| 892 | Ga0495597_0007644 | |||
| 893 | Ga0495597_0031535 | |||
| 894 | Ga0495645_0017644 | |||
| 895 | Ga0495645_0059193 | |||
| 896 | Ga0495622_0000087 | |||
| 897 | Ga0495622_0053206 | |||
| 898 | Ga0495622_0071340 | |||
| 899 | Ga0495633_0000727 | |||
| 900 | Ga0495633_0001004 | |||
| 901 | Ga0495633_0001667 | |||
| 902 | Ga0495633_0002672 | |||
| 903 | Ga0495633_0006941 | |||
| 904 | Ga0495633_0016794 | |||
| 905 | Ga0495633_0018092 | |||
| 906 | Ga0495633_0021984 | |||
| 907 | Ga0495633_0035211 | |||
| 908 | Ga0495633_0085855 | |||
| 909 | Ga0495668_0000048 | |||
| 910 | Ga0495668_0000185 | |||
| 911 | Ga0495668_0000378 | |||
| 912 | Ga0495668_0002254 | |||
| 913 | Ga0495668_0022303 | |||
| 914 | Ga0495668_0022871 | |||
| 915 | Ga0495668_0257963 | |||
| 916 | Ga0495611_0000778 | |||
| 917 | Ga0495611_0003825 | |||
| 918 | Ga0495611_0031129 | |||
| 919 | Ga0495611_0051801 | |||
| 920 | Ga0495611_0095686 | |||
| 921 | Ga0495625_0000164 | |||
| 922 | Ga0495625_0000372 | |||
| 923 | Ga0495625_0000925 | |||
| 924 | Ga0495625_0001300 | |||
| 925 | Ga0495625_0130366 | |||
| 926 | Ga0495659_0003759 | |||
| 927 | Ga0495661_0002081 | |||
| 928 | Ga0495661_0002174 | |||
| 929 | Ga0495661_0003078 | |||
| 930 | Ga0495661_0025875 | |||
| 931 | Ga0495661_0034146 | |||
| 932 | Ga0495661_0049235 | |||
| 933 | Ga0495661_0123422 | |||
| 934 | Ga0495661_0161765 | |||
| 935 | Ga0495661_0170305 | |||
| 936 | Ga0495588_0065241 | |||
| 937 | Ga0495657_0169287 | |||
| 938 | Ga0495599_0001150 | |||
| 939 | Ga0495623_0014783 | |||
| 940 | Ga0495623_0026212 | |||
| 941 | Ga0495646_0005539 | |||
| 942 | Ga0495646_0010931 | |||
| 943 | Ga0495669_0003235 | |||
| 944 | Ga0495669_0007213 | |||
| 945 | Ga0495669_0008369 | |||
| 946 | Ga0495624_0020213 | |||
| 947 | Ga0495670_0028974 | |||
| 948 | Ga0495671_0000001 | |||
| 949 | Ga0495671_0007946 | |||
| 950 | Ga0495671_0013142 | |||
| 951 | Ga0495671_0117202 | |||
| 952 | Ga0495649_0000825 | |||
| 953 | Ga0495649_0008171 | |||
| 954 | Ga0495649_0014919 | |||
| 955 | Ga0495600_0000857 | |||
| 956 | Ga0495660_0000215 | |||
| 957 | Ga0495660_0002871 | |||
| 958 | Ga0495660_0004775 | |||
| 959 | Ga0495660_0007119 | |||
| 960 | Ga0495660_0007416 | |||
| 961 | Ga0495660_0029378 | |||
| 962 | Ga0495604_0006145 | |||
| 963 | Ga0495636_0001331 | |||
| 964 | Ga0495672_0000477 | |||
| 965 | Ga0495672_0000549 | |||
| 966 | Ga0495672_0000590 | |||
| 967 | Ga0495672_0064671 | |||
| 968 | Ga0495672_0076129 | |||
| 969 | Ga0495683_0000423 | |||
| 970 | Ga0495683_0001542 | |||
| 971 | Ga0495683_0050817 | |||
| 972 | Ga0495687_000148 | |||
| 973 | Ga0495687_002695 | |||
| 974 | Ga0495687_002776 | |||
| 975 | Ga0495677_0001205 | |||
| 976 | Ga0495677_0003426 | |||
| 977 | Ga0495677_0003541 | |||
| 978 | Ga0495677_0011672 | |||
| 979 | Ga0495677_0025091 | |||
| 980 | Ga0495677_0031376 | |||
| 981 | Ga0495679_012059 | |||
| 982 | Ga0495679_020770 | |||
| 983 | Ga0495679_025460 | |||
| 984 | Ga0495685_000018 | |||
| 985 | Ga0495685_007739 | |||
| 986 | Ga0495685_010293 | |||
| 987 | Ga0495673_0000003 | |||
| 988 | Ga0495673_0000100 | |||
| 989 | Ga0495673_0007838 | |||
| 990 | Ga0495673_0102459 | |||
| 991 | Ga0495681_0002720 | |||
| 992 | Ga0495681_0003523 | |||
| 993 | Ga0495681_0019135 | |||
| 994 | Ga0495681_0027075 | |||
| 995 | Ga0495681_0035303 | |||
| 996 | Ga0495686_0001020 | |||
| 997 | Ga0495686_0014956 | |||
| 998 | Ga0495686_0022931 | |||
| 999 | Ga0495686_0183683 | |||
| 1000 | Ga0495602_0043420 | |||
| 1001 | Ga0495626_0000026 | |||
| 1002 | Ga0495626_0004798 | |||
| 1003 | Ga0495626_0005823 | |||
| 1004 | Ga0495626_0011806 | |||
| 1005 | Ga0495626_0018337 | |||
| 1006 | Ga0495626_0030209 | |||
| 1007 | Ga0496100_0014139 | |||
| 1008 | Ga0496101_0108916 | |||
| 1009 | Ga0496102_0042128 | |||
| 1010 | Ga0496102_0424364 | |||
| 1011 | Ga0496105_0324304 | |||
| 1012 | Ga0496106_0102393 | |||
| 1013 | Ga0496107_0050197 | |||
| 1014 | Ga0496109_0216343 | |||
| 1015 | Ga0496110_0444272 | |||
| 1016 | Ga0496110_0532580 | |||
| 1017 | Ga0496111_0015643 | |||
| 1018 | Ga0496112_0253804 | |||
| 1019 | Ga0496113_0023588 | |||
| 1020 | Ga0496116_0032337 | |||
| 1021 | Ga0496116_0038374 | |||
| 1022 | Ga0496116_0173482 | |||
| 1023 | Ga0496117_0000132 | |||
| 1024 | Ga0496118_0000099 | |||
| 1025 | Ga0496118_0193120 | |||
| 1026 | Ga0496119_0064930 | |||
| 1027 | Ga0496121_0005743 | |||
| 1028 | Ga0496121_0019888 | |||
| 1029 | Ga0496121_0037606 | |||
| 1030 | Ga0496121_0051735 | |||
| 1031 | Ga0496121_0078670 | |||
| 1032 | Ga0496121_0141597 | |||
| 1033 | Ga0496121_0156778 | |||
| 1034 | Ga0496121_0291649 | |||
| 1035 | Ga0496122_0001387 | |||
| 1036 | Ga0496122_0003476 | |||
| 1037 | Ga0496122_0005530 | |||
| 1038 | Ga0496122_0023040 | |||
| 1039 | Ga0496122_0177536 | |||
| 1040 | Ga0496123_0000180 | |||
| 1041 | Ga0496123_0004067 | |||
| 1042 | Ga0496123_0005184 | |||
| 1043 | Ga0496123_0184949 | |||
| 1044 | Ga0496124_0012720 | |||
| 1045 | Ga0496124_0025147 | |||
| 1046 | Ga0496124_0061700 | |||
| 1047 | Ga0496124_0106932 | |||
| 1048 | Ga0496124_0137123 | |||
| 1049 | Ga0496124_0180714 | |||
| 1050 | Ga0496125_0003731 | |||
| 1051 | Ga0496125_0004083 | |||
| 1052 | Ga0496125_0004935 | |||
| 1053 | Ga0496125_0094783 | |||
| 1054 | Ga0496125_0108107 | |||
| 1055 | Ga0496126_0024631 | |||
| 1056 | Ga0496126_0107990 | |||
| 1057 | Ga0495678_000004 | |||
| 1058 | Ga0495678_000335 | |||
| 1059 | Ga0495678_062004 | |||
| 1060 | Ga0495682_0002266 | |||
| 1061 | Ga0495682_0002534 | |||
| 1062 | Ga0495682_0003829 | |||
| 1063 | Ga0495682_0009178 | |||
| 1064 | Ga0495682_0021057 | |||
| 1065 | Ga0501034_0280469 | |||
| 1066 | Ga0501043_0457989 | |||
| 1067 | Ga0501047_0209247 | |||
| 1068 | Ga0501080_0070542 | |||
| 1069 | Ga0501269_000023 | |||
| 1070 | Ga0501279_002841 | |||
| 1071 | Ga0501035_0005111 | |||
| 1072 | Ga0501044_0059830 | |||
| 1073 | Ga0501044_0202995 | |||
| 1074 | Ga0495601_0016461 | |||
| 1075 | Ga0495655_0082844 | |||
| 1076 | Ga0500646_0003084 | |||
| 1077 | Ga0500651_0006700 | |||
| 1078 | Ga0500641_0001358 | |||
| 1079 | Ga0500555_006346 | |||
| 1080 | Ga0500595_001700 | |||
| 1081 | Ga0500595_005617 | |||
| 1082 | Ga0500607_086185 | |||
| 1083 | Ga0500618_000358 | |||
| 1084 | Ga0500642_0001266 | |||
| 1085 | Ga0500642_0019822 | |||
| 1086 | Ga0500658_0071953 | |||
| 1087 | Ga0500658_0099548 | |||
| 1088 | Ga0500568_0007626 | |||
| 1089 | Ga0500568_0027205 | |||
| 1090 | Ga0500574_005248 | |||
| 1091 | Ga0500586_013088 | |||
| 1092 | Ga0500588_0002990 | |||
| 1093 | Ga0500588_0007736 | |||
| 1094 | Ga0500604_0091821 | |||
| 1095 | Ga0500616_0000749 | |||
| 1096 | Ga0500616_0011753 | |||
| 1097 | Ga0500619_000541 | |||
| 1098 | Ga0500624_002391 | |||
| 1099 | Ga0500627_0167191 | |||
| 1100 | Ga0500609_002453 | |||
| 1101 | Ga0501084_0142511 | |||
| 1102 | 2511250263 | |||
| 1103 | 2550692461 | |||
| 1104 | 2601670181 | |||
| 1105 | 2644027757 | |||
| 1106 | 2644215866 | |||
| 1107 | 2739153080 | |||
| 1108 | 2739195000 | |||
| 1109 | 2739277449 | |||
| 1110 | 2739321476 | |||
| 1111 | 2739339968 | |||
| 1112 | 2739346628 | |||
| 1113 | 2765568866 | |||
| 1114 | 2809145333 | |||
| 1115 | 2819541272 | |||
| 1116 | 2819592181 | |||
| 1117 | 2821131523 | |||
| 1118 | 2839096253 | |||
| 1119 | 2842714112 | |||
| 1120 | 2857553089 | |||
| 1121 | 2857554405 | |||
| 1122 | 2857560017 | |||
| 1123 | 2857564810 | |||
| 1124 | 2884816113 | |||
| 1125 | 2884840397 | |||
| 1126 | 2884855653 | |||
| 1127 | 2885084262 | |||
| 1128 | 2896157421 | |||
| 1129 | 2904426101 | |||
| 1130 | 2919478492 | |||
| 1131 | 2932413688 | |||
| 1132 | 2932417748 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b0k-assembly1.cif.gz_A | membrane protein structure | 0.7423 | 8 | 281 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.7419 | 8 | 282 |
| 5y79-assembly1.cif.gz_B | crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate | 0.738 | 7 | 286 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.7328 | 8 | 282 |
| 7b0k-assembly1.cif.gz_A | membrane protein structure | 0.7297 | 8 | 281 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0WMA8_96_409_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7489 | 8 | 284 | 1.20.1740.10 |
| af_A0A0P0WMA8_96_409_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6963 | 8 | 284 | 1.20.1740.10 |
| af_Q8RY83_36_351_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.5703 | 10 | 285 | 1.20.1740.10 |
| af_A0A0P0YAS8_28_439_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.563 | 1 | 291 | 1.20.1740.10 |
| af_A0A0P0YAS8_28_439_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.5484 | 1 | 291 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3SKC4-F1-model_v4 | DMT family transporter | 0.9974 | 1 | 289 |
GO:0016020
|
| AF-A0A6B3SKC4-F1-model_v4 | DMT family transporter | 0.9939 | 1 | 289 |
GO:0016020
|
| AF-I0H6E0-F1-model_v4 | Putative integral membrane protein | 0.9908 | 3 | 285 |
GO:0016020
|
| AF-A0A1T5APK1-F1-model_v4 | Permease of the drug/metabolite transporter (DMT) superfamily | 0.9858 | 4 | 286 |
GO:0016020
|
| AF-A0A4S8PHB6-F1-model_v4 | DMT family transporter | 0.9858 | 5 | 285 |
GO:0016020
|