F464451

General Info

Members Datasets Scaffolds Average Seq Length
566 305 1132 303

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0254114|Ga0501079_0254114_30_1076
Length 348
Sequence MELKTGTEQKSLLATLAPGKRARLRRLLFEFGPGNGAMLLLPIDQGIEHGPRDFFANPDSKDPEYQFRLAAEAGYSAIACQIGLATKYYPDYAGQVPLILKVNGRTDIPPSDEAFSATNAQVEDAVRLGADAVGYTLYVGSPRQDDDLHQLAGVREDCDRYGMPLVIWACPRGSAIDGKGGRDSFYAIDYAARMAMEMGADVVKLNMPKIDPEKDKDSPAPYNEGNFTQEDAIRHCVASAGRSLVVLSGGSKVDDDKLLEQTRFVLEAGGSGVIYGRNVWQREWGAALEIIEQIKEIMLSSVTRIPSVGTPGIALRRTLCVRASHRPRVHAADVRRTAPPTVPFWGRG

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
299 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
302 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 0
Rhizoplane 8.66
Rhizosphere 83.75
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0254114 3300049741 Bacteria 1374
2 JGI24746J21847_1000014 3300001977 Bacteria 16789
3 JGI24740J21852_10000990 3300001979 Bacteria 12697
4 JGI24742J22300_10015061 3300002244 Bacteria 1301
5 JGI24751J29686_10016604 3300002459 Bacteria 1518
6 Ga0070683_100008540 3300005329 Bacteria 8704
7 Ga0070683_100153852 3300005329 Bacteria 2181
8 Ga0070677_10000011 3300005333 Bacteria 60102
9 Ga0070666_10037792 3300005335 Bacteria 3211
10 Ga0070666_10310964 3300005335 Bacteria 1123
11 Ga0070682_100000028 3300005337 Bacteria 185177
12 Ga0070682_100000084 3300005337 Bacteria 84301
13 Ga0068868_100000008 3300005338 Bacteria 121926
14 Ga0068868_100146812 3300005338 Bacteria 1940
15 Ga0070660_100001924 3300005339 Bacteria 14311
16 Ga0070691_10012209 3300005341 Bacteria 3934
17 Ga0070687_100109518 3300005343 Bacteria 1561
18 Ga0070692_10005488 3300005345 Bacteria 5417
19 Ga0070675_100005523 3300005354 Bacteria 9677
20 Ga0070675_100038304 3300005354 Bacteria 3907
21 Ga0070674_100000006 3300005356 Bacteria 150063
22 Ga0070674_100000052 3300005356 Bacteria 50857
23 Ga0070674_100076617 3300005356 Bacteria 2378
24 Ga0070673_100016727 3300005364 Bacteria 5196
25 Ga0070688_100003416 3300005365 Bacteria 8157
26 Ga0070688_100030710 3300005365 Bacteria 3227
27 Ga0070667_100001507 3300005367 Bacteria 20839
28 Ga0070667_100047793 3300005367 Bacteria 3601
29 Ga0070713_100000022 3300005436 Bacteria 102527
30 Ga0070701_10061846 3300005438 Bacteria 1976
31 Ga0070700_100004418 3300005441 Bacteria 7348
32 Ga0070708_100283562 3300005445 Bacteria 1559
33 Ga0070663_100003390 3300005455 Bacteria 9204
34 Ga0070663_100007216 3300005455 Bacteria 6752
35 Ga0070662_100000038 3300005457 Bacteria 75003
36 Ga0068867_100000127 3300005459 Bacteria 49103
37 Ga0068867_100022063 3300005459 Bacteria 4549
38 Ga0068867_100066714 3300005459 Bacteria 2681
39 Ga0070685_10000021 3300005466 Bacteria 103600
40 Ga0070685_10000111 3300005466 Bacteria 52039
41 Ga0070685_10062249 3300005466 Bacteria 2188
42 Ga0070706_100258878 3300005467 Bacteria 1624
43 Ga0070707_100023957 3300005468 Bacteria 5775
44 Ga0070679_100000260 3300005530 Bacteria 44173
45 Ga0070679_100002161 3300005530 Bacteria 17724
46 Ga0070679_100055370 3300005530 Bacteria 3950
47 Ga0070684_100027713 3300005535 Bacteria 4785
48 Ga0070684_100055187 3300005535 Bacteria 3462
49 Ga0070684_100190563 3300005535 Bacteria 1866
50 Ga0070684_100248788 3300005535 Bacteria 1625
51 Ga0070672_100000580 3300005543 Bacteria 21508
52 Ga0070693_100002391 3300005547 Bacteria 8634
53 Ga0070693_100030355 3300005547 Bacteria 2955
54 Ga0070665_100000068 3300005548 Bacteria 204531
55 Ga0070665_100001200 3300005548 Bacteria 31604
56 Ga0070704_100147756 3300005549 Bacteria 1844
57 Ga0070664_100030206 3300005564 Bacteria 4521
58 Ga0068854_100000742 3300005578 Bacteria 19300
59 Ga0068854_100008988 3300005578 Bacteria 6440
60 Ga0068854_100169285 3300005578 Bacteria 1699
61 Ga0068856_100000971 3300005614 Bacteria 30576
62 Ga0070702_100003366 3300005615 Bacteria 7141
63 Ga0068852_100000005 3300005616 Bacteria 173127
64 Ga0068864_100000023 3300005618 Bacteria 257064
65 Ga0068866_10000011 3300005718 Bacteria 97191
66 Ga0068866_10000731 3300005718 Bacteria 14876
67 Ga0068866_10009631 3300005718 Bacteria 4110
68 Ga0068866_10019411 3300005718 Bacteria 3094
69 Ga0068861_100021136 3300005719 Bacteria 4676
70 Ga0068861_100177465 3300005719 Bacteria 1770
71 Ga0068863_100000004 3300005841 Bacteria 272478
72 Ga0068863_100005063 3300005841 Bacteria 13003
73 Ga0068858_100000012 3300005842 Bacteria 216931
74 Ga0068858_100000033 3300005842 Bacteria 142748
75 Ga0068858_100065858 3300005842 Bacteria 3353
76 Ga0068860_100001973 3300005843 Bacteria 21686
77 Ga0068860_100066245 3300005843 Bacteria 3431
78 Ga0068860_100094683 3300005843 Bacteria 2846
79 Ga0068862_100000050 3300005844 Bacteria 145502
80 Ga0081455_10006668 3300005937 Bacteria 12337
81 Ga0081455_10031042 3300005937 Bacteria 4842
82 Ga0081455_10056764 3300005937 Bacteria 3322
83 Ga0081455_10085770 3300005937 Bacteria 2566
84 Ga0081538_10000023 3300005981 Bacteria 131101
85 Ga0081538_10000450 3300005981 Bacteria 46279
86 Ga0081538_10051377 3300005981 Bacteria 2476
87 Ga0081540_1000106 3300005983 Bacteria 89767
88 Ga0081540_1027391 3300005983 Bacteria 3230
89 Ga0081540_1037440 3300005983 Bacteria 2572
90 Ga0081540_1045749 3300005983 Bacteria 2218
91 Ga0081539_10000504 3300005985 Bacteria 81870
92 Ga0081539_10028525 3300005985 Bacteria 3507
93 Ga0075365_10001858 3300006038 Bacteria 9916
94 Ga0075365_10016455 3300006038 Bacteria 4499
95 Ga0075365_10079190 3300006038 Bacteria 2223
96 Ga0075368_10078090 3300006042 Bacteria 1344
97 Ga0075363_100009763 3300006048 Bacteria 4522
98 Ga0075363_100014145 3300006048 Bacteria 3889
99 Ga0075363_100038843 3300006048 Bacteria 2504
100 Ga0075364_10053557 3300006051 Bacteria 2637
101 Ga0075364_10121362 3300006051 Bacteria 1749
102 Ga0075364_10149345 3300006051 Bacteria 1574
103 Ga0070715_10000011 3300006163 Bacteria 183857
104 Ga0070716_100136592 3300006173 Bacteria 1558
105 Ga0070712_100000850 3300006175 Bacteria 18181
106 Ga0075367_10055090 3300006178 Bacteria 2359
107 Ga0075367_10257520 3300006178 Bacteria 1095
108 Ga0075370_10137593 3300006353 Bacteria 1427
109 Ga0075428_100360125 3300006844 Bacteria 1560
110 Ga0075430_100052264 3300006846 Bacteria 3441
111 Ga0075430_100087765 3300006846 Bacteria 2603
112 Ga0075431_100169269 3300006847 Bacteria 2245
113 Ga0075431_100431565 3300006847 Bacteria 1316
114 Ga0075433_10000047 3300006852 Bacteria 50752
115 Ga0075433_10003789 3300006852 Bacteria 11715
116 Ga0075433_10087789 3300006852 Bacteria 2747
117 Ga0075433_10125721 3300006852 Bacteria 2277
118 Ga0075434_100039724 3300006871 Bacteria 4661
119 Ga0075434_100057418 3300006871 Bacteria 3868
120 Ga0075429_100002703 3300006880 Bacteria 14952
121 Ga0075429_100053990 3300006880 Bacteria 3496
122 Ga0068865_100000741 3300006881 Bacteria 18308
123 Ga0075435_100327450 3300007076 Bacteria 1312
124 Ga0105240_10145530 3300009093 Bacteria 2828
125 Ga0105240_10581878 3300009093 Bacteria 1235
126 Ga0111539_10014849 3300009094 Bacteria 9712
127 Ga0111539_10250260 3300009094 Bacteria 2063
128 Ga0105245_10000147 3300009098 Bacteria 66496
129 Ga0105245_10000365 3300009098 Bacteria 42328
130 Ga0105245_10004676 3300009098 Bacteria 12101
131 Ga0105245_10005201 3300009098 Bacteria 11426
132 Ga0105245_10006637 3300009098 Bacteria 10161
133 Ga0105245_10131158 3300009098 Bacteria 2351
134 Ga0105247_10000105 3300009101 Bacteria 87578
135 Ga0114129_10011624 3300009147 Bacteria 12531
136 Ga0114129_10258338 3300009147 Bacteria 2336
137 Ga0114129_10404351 3300009147 Bacteria 1799
138 Ga0105243_10003898 3300009148 Bacteria 11908
139 Ga0105243_10072507 3300009148 Bacteria 2788
140 Ga0105242_10000331 3300009176 Bacteria 37975
141 Ga0105242_10000335 3300009176 Bacteria 37854
142 Ga0105237_10153023 3300009545 Bacteria 2303
143 Ga0105238_10000023 3300009551 Bacteria 196844
144 Ga0105238_10106093 3300009551 Bacteria 2791
145 Ga0105238_10264033 3300009551 Bacteria 1701
146 Ga0105249_10000165 3300009553 Bacteria 77694
147 Ga0105249_10008206 3300009553 Bacteria 9099
148 Ga0105249_10177394 3300009553 Bacteria 2070
149 Ga0105249_10212831 3300009553 Bacteria 1898
150 Ga0105249_10376889 3300009553 Bacteria 1444
151 Ga0105239_10157351 3300010375 Bacteria 2538
152 Ga0105239_10169803 3300010375 Bacteria 2439
153 Ga0105239_10392017 3300010375 Bacteria 1571
154 Ga0157371_10007499 3300013102 Bacteria 8827
155 Ga0157370_10002070 3300013104 Bacteria 24567
156 Ga0157369_10000130 3300013105 Bacteria 108193
157 Ga0157374_10011988 3300013296 Bacteria 7526
158 Ga0157374_10050214 3300013296 Bacteria 3876
159 Ga0157378_10000803 3300013297 Bacteria 29232
160 Ga0157378_10061655 3300013297 Bacteria 3348
161 Ga0157375_10000153 3300013308 Bacteria 67321
162 Ga0157375_10001627 3300013308 Bacteria 19319
163 Ga0157380_10000028 3300014326 Bacteria 99836
164 Ga0157380_10019030 3300014326 Bacteria 5111
165 Ga0157380_10253188 3300014326 Bacteria 1595
166 Ga0157379_10045006 3300014968 Bacteria 3940
167 Ga0157379_10139357 3300014968 Bacteria 2186
168 Ga0157376_10012528 3300014969 Bacteria 6296
169 Ga0157376_10047854 3300014969 Bacteria 3533
170 Ga0163161_10000018 3300017792 Bacteria 228801
171 Ga0206356_10076920 3300020070 Bacteria 1124
172 Ga0206349_1095755 3300020075 Bacteria 1310
173 Ga0206351_10293384 3300020077 Bacteria 1010
174 Ga0206352_10666613 3300020078 Bacteria 1990
175 Ga0206354_11169333 3300020081 Bacteria 1078
176 Ga0206354_11422714 3300020081 Bacteria 1215
177 Ga0224712_10112242 3300022467 Bacteria 1170
178 Ga0207682_10000019 3300025893 Bacteria 64989
179 Ga0207642_10000010 3300025899 Bacteria 99207
180 Ga0207642_10000203 3300025899 Bacteria 17481
181 Ga0207642_10005469 3300025899 Bacteria 4150
182 Ga0207642_10015588 3300025899 Bacteria 2837
183 Ga0207710_10000448 3300025900 Bacteria 26775
184 Ga0207680_10003453 3300025903 Bacteria 7453
185 Ga0207685_10000001 3300025905 Bacteria 604473
186 Ga0207684_10004212 3300025910 Bacteria 13654
187 Ga0207707_10188616 3300025912 Bacteria 1799
188 Ga0207663_10051121 3300025916 Bacteria 2572
189 Ga0207660_10055328 3300025917 Bacteria 2835
190 Ga0207662_10047781 3300025918 Bacteria 2535
191 Ga0207657_10002993 3300025919 Bacteria 18112
192 Ga0207649_10000005 3300025920 Bacteria 356179
193 Ga0207649_10099284 3300025920 Bacteria 1923
194 Ga0207652_10000414 3300025921 Bacteria 44203
195 Ga0207652_10000581 3300025921 Bacteria 36793
196 Ga0207652_10072012 3300025921 Bacteria 3004
197 Ga0207646_10043760 3300025922 Bacteria 4019
198 Ga0207694_10000004 3300025924 Bacteria 967075
199 Ga0207650_10094815 3300025925 Bacteria 2287
200 Ga0207659_10000014 3300025926 Bacteria 168481
201 Ga0207659_10025930 3300025926 Bacteria 3948
202 Ga0207687_10000011 3300025927 Bacteria 388349
203 Ga0207687_10000026 3300025927 Bacteria 173968
204 Ga0207687_10000213 3300025927 Bacteria 39390
205 Ga0207687_10007516 3300025927 Bacteria 7164
206 Ga0207700_10000008 3300025928 Bacteria 341717
207 Ga0207664_10114088 3300025929 Bacteria 2251
208 Ga0207690_10027168 3300025932 Bacteria 3614
209 Ga0207706_10000026 3300025933 Bacteria 149379
210 Ga0207706_10002442 3300025933 Bacteria 18140
211 Ga0207686_10000032 3300025934 Bacteria 150341
212 Ga0207686_10000479 3300025934 Bacteria 26389
213 Ga0207709_10011319 3300025935 Bacteria 4920
214 Ga0207670_10107299 3300025936 Bacteria 2005
215 Ga0207669_10000010 3300025937 Bacteria 150070
216 Ga0207669_10000025 3300025937 Bacteria 93633
217 Ga0207669_10004213 3300025937 Bacteria 6307
218 Ga0207669_10040853 3300025937 Bacteria 2694
219 Ga0207704_10000045 3300025938 Bacteria 86589
220 Ga0207704_10006672 3300025938 Bacteria 5404
221 Ga0207704_10167999 3300025938 Bacteria 1569
222 Ga0207665_10131148 3300025939 Bacteria 1779
223 Ga0207691_10000429 3300025940 Bacteria 41790
224 Ga0207711_10000024 3300025941 Bacteria 293596
225 Ga0207711_10390201 3300025941 Bacteria 1293
226 Ga0207689_10155404 3300025942 Bacteria 1886
227 Ga0207661_10000165 3300025944 Bacteria 43066
228 Ga0207661_10011362 3300025944 Bacteria 6448
229 Ga0207661_10034006 3300025944 Bacteria 3960
230 Ga0207661_10038108 3300025944 Bacteria 3765
231 Ga0207661_10267638 3300025944 Bacteria 1524
232 Ga0207679_10019148 3300025945 Bacteria 4595
233 Ga0207679_10189314 3300025945 Bacteria 1709
234 Ga0207651_10019546 3300025960 Bacteria 4063
235 Ga0207712_10000037 3300025961 Bacteria 195906
236 Ga0207712_10004128 3300025961 Bacteria 9173
237 Ga0207668_10002386 3300025972 Bacteria 10977
238 Ga0207640_10000641 3300025981 Bacteria 20534
239 Ga0207640_10026073 3300025981 Bacteria 3545
240 Ga0207640_10092034 3300025981 Bacteria 2102
241 Ga0207658_10003653 3300025986 Bacteria 10855
242 Ga0207658_10032693 3300025986 Bacteria 3705
243 Ga0207677_10010345 3300026023 Bacteria 5275
244 Ga0207677_10037713 3300026023 Bacteria 3161
245 Ga0207703_10000091 3300026035 Bacteria 105608
246 Ga0207703_10000126 3300026035 Bacteria 91860
247 Ga0207703_10197448 3300026035 Bacteria 1786
248 Ga0207678_10001831 3300026067 Bacteria 19497
249 Ga0207678_10005463 3300026067 Bacteria 11362
250 Ga0207708_10001342 3300026075 Bacteria 18517
251 Ga0207702_10000865 3300026078 Bacteria 31579
252 Ga0207641_10000129 3300026088 Bacteria 110871
253 Ga0207641_10004517 3300026088 Bacteria 12026
254 Ga0207648_10001697 3300026089 Bacteria 24098
255 Ga0207648_10004886 3300026089 Bacteria 13661
256 Ga0207648_10080326 3300026089 Bacteria 2845
257 Ga0207676_10000025 3300026095 Bacteria 261714
258 Ga0207674_10009793 3300026116 Bacteria 10916
259 Ga0207675_100008487 3300026118 Bacteria 9675
260 Ga0207675_100105524 3300026118 Bacteria 2656
261 Ga0207675_100239636 3300026118 Bacteria 1752
262 Ga0207698_10000041 3300026142 Bacteria 97882
263 Ga0207698_10055275 3300026142 Bacteria 3058
264 Ga0209813_10024228 3300027866 Bacteria 1734
265 Ga0268266_10000020 3300028379 Bacteria 527065
266 Ga0268266_10000263 3300028379 Bacteria 88086
267 Ga0268266_10000303 3300028379 Bacteria 78632
268 Ga0268265_10002948 3300028380 Bacteria 12468
269 Ga0268264_10024099 3300028381 Bacteria 4967
270 Ga0268264_10126002 3300028381 Bacteria 2263
271 Ga0265319_1000028 3300028563 Bacteria 135557
272 Ga0265338_10001275 3300028800 Bacteria 41452
273 Ga0265327_10102149 3300031251 Bacteria 1382
274 Ga0316579_10096435 3300031691 Bacteria 1414
275 Ga0316576_10006733 3300031727 Bacteria 7182
276 Ga0316578_10095198 3300031728 Bacteria 1782
277 Ga0316577_10003050 3300031733 Bacteria 8403
278 Ga0307410_10105848 3300031852 Bacteria 2026
279 Ga0307406_10097352 3300031901 Bacteria 1995
280 Ga0307415_100001253 3300032126 Bacteria 11937
281 Ga0307415_100148512 3300032126 Bacteria 1801
282 Ga0316583_10026244 3300032133 Bacteria 2079
283 Ga0316574_0010440 3300035398 Bacteria 5250
284 Ga0316574_0116582 3300035398 Bacteria 1713
285 Ga0316574_0338489 3300035398 Bacteria 953
286 Ga0373937_0016562 3300036401 Bacteria 6547
287 Ga0373937_0028971 3300036401 Bacteria 5015
288 Ga0316582_0037069 3300036647 Unclassified 3020
289 Ga0316582_0143126 3300036647 Bacteria 1613
290 Ga0316584_0017340 3300036712 Bacteria 5174
291 Ga0316584_0020631 3300036712 Bacteria 4781
292 Ga0316584_0033607 3300036712 Unclassified 3800
293 Ga0316584_0134335 3300036712 Bacteria 1847
294 Ga0395898_0376111 3300037466 Bacteria 1355
295 Ga0316581_0022141 3300037588 Unclassified 1873
296 Ga0395901_0619759 3300038443 Bacteria 1089
297 Ga0395901_0624291 3300038443 Bacteria 1084
298 Ga0451800_0956312 3300041459 Bacteria 1331
299 Ga0451839_1291997 3300041496 Bacteria 1485
300 Ga0451853_3856884 3300041512 Bacteria 2538
301 Ga0466963_0000029 3300044694 Bacteria 47596
302 Ga0466963_0235735 3300044694 Bacteria 1283
303 Ga0466964_0063856 3300044706 Unclassified 1539
304 Ga0466957_0000175 3300044842 Bacteria 28579
305 Ga0466958_0049326 3300045836 Bacteria 2547
306 Ga0466967_0000021 3300045976 Bacteria 76829
307 Ga0466967_0019429 3300045976 Bacteria 5462
308 Ga0466967_0184392 3300045976 Bacteria 1970
309 Ga0466967_0418548 3300045976 Bacteria 1306
310 Ga0495592_0000324 3300046454 Bacteria 39852
311 Ga0495592_0034419 3300046454 Bacteria 3818
312 Ga0495603_0003969 3300046455 Bacteria 8813
313 Ga0495591_030597 3300046458 Bacteria 1624
314 Ga0495629_0000055 3300046459 Bacteria 105268
315 Ga0495629_0009655 3300046459 Bacteria 7046
316 Ga0495629_0148465 3300046459 Bacteria 1630
317 Ga0495638_0156201 3300046460 Bacteria 1319
318 Ga0495641_0000020 3300046461 Bacteria 115404
319 Ga0495651_0148409 3300046462 Bacteria 1693
320 Ga0495651_0159874 3300046462 Bacteria 1615
321 Ga0495653_0212606 3300046463 Bacteria 1305
322 Ga0495582_0004714 3300046473 Bacteria 7663
323 Ga0495639_0016251 3300046475 Bacteria 3230
324 Ga0495662_0000033 3300046476 Bacteria 46831
325 Ga0495594_0000007 3300046499 Bacteria 160047
326 Ga0495606_0000057 3300046507 Bacteria 197956
327 Ga0495608_0000094 3300046511 Bacteria 64194
328 Ga0495608_0005830 3300046511 Bacteria 8773
329 Ga0495608_0032097 3300046511 Bacteria 3550
330 Ga0495608_0182666 3300046511 Bacteria 1326
331 Ga0495610_0049413 3300046512 Bacteria 2060
332 Ga0495618_0000075 3300046514 Bacteria 70236
333 Ga0495620_0000303 3300046515 Bacteria 35057
334 Ga0495628_0000061 3300046516 Bacteria 86531
335 Ga0495628_0114481 3300046516 Bacteria 2072
336 Ga0495628_0157001 3300046516 Bacteria 1730
337 Ga0495630_0000025 3300046517 Bacteria 152364
338 Ga0495630_0000903 3300046517 Bacteria 20752
339 Ga0495630_0000951 3300046517 Bacteria 20235
340 Ga0495630_0098728 3300046517 Bacteria 2209
341 Ga0495643_0095511 3300046522 Bacteria 1529
342 Ga0495644_0008504 3300046523 Bacteria 3953
343 Ga0495644_0080034 3300046523 Bacteria 1231
344 Ga0495652_0000003 3300046529 Bacteria 597094
345 Ga0495652_0014350 3300046529 Bacteria 7112
346 Ga0495640_0032549 3300046533 Bacteria 3713
347 Ga0495587_0001735 3300046536 Bacteria 14556
348 Ga0495587_0132641 3300046536 Bacteria 1423
349 Ga0495621_0009521 3300046539 Bacteria 2953
350 Ga0495645_0014038 3300046543 Bacteria 5677
351 Ga0495645_0018421 3300046543 Bacteria 5013
352 Ga0495622_0000050 3300046557 Bacteria 106111
353 Ga0495667_0000022 3300046559 Bacteria 176919
354 Ga0495667_0136770 3300046559 Bacteria 1580
355 Ga0495656_0000220 3300046615 Bacteria 20337
356 Ga0495634_0000063 3300046642 Bacteria 86878
357 Ga0495634_0000296 3300046642 Bacteria 47756
358 Ga0495634_0012112 3300046642 Bacteria 6250
359 Ga0495625_0000029 3300046660 Bacteria 244646
360 Ga0495625_0235108 3300046660 Bacteria 1195
361 Ga0495635_0000037 3300046663 Bacteria 91677
362 Ga0495588_0000243 3300046674 Bacteria 45920
363 Ga0495588_0129317 3300046674 Bacteria 1332
364 Ga0495657_0000152 3300046675 Bacteria 62935
365 Ga0495657_0023413 3300046675 Bacteria 4414
366 Ga0495647_0000015 3300046681 Bacteria 86790
367 Ga0495647_0005669 3300046681 Bacteria 4102
368 Ga0495647_0005848 3300046681 Bacteria 4048
369 Ga0495658_0003614 3300046683 Bacteria 7654
370 Ga0495658_0016117 3300046683 Bacteria 3846
371 Ga0495669_0000137 3300046684 Bacteria 46480
372 Ga0495613_0000068 3300046689 Bacteria 101803
373 Ga0495613_0000109 3300046689 Bacteria 80473
374 Ga0495624_0000012 3300046690 Bacteria 124128
375 Ga0495624_0000298 3300046690 Bacteria 39145
376 Ga0495670_0054107 3300046691 Bacteria 2010
377 Ga0495600_0001659 3300046809 Bacteria 12411
378 Ga0495600_0003029 3300046809 Bacteria 9813
379 Ga0495581_0136488 3300047315 Bacteria 1430
380 Ga0495604_0000013 3300047317 Bacteria 234578
381 Ga0495604_0000631 3300047317 Bacteria 30246
382 Ga0495604_0055676 3300047317 Bacteria 3048
383 Ga0495674_0000020 3300047319 Bacteria 178465
384 Ga0495674_0135567 3300047319 Bacteria 2072
385 Ga0495676_0000729 3300047321 Bacteria 27371
386 Ga0495676_0000826 3300047321 Bacteria 25945
387 Ga0495680_0000464 3300047322 Bacteria 45610
388 Ga0495680_0000864 3300047322 Bacteria 33738
389 Ga0495680_0005623 3300047322 Bacteria 11747
390 Ga0495680_0044138 3300047322 Bacteria 3526
391 Ga0495675_0000095 3300047444 Bacteria 62902
392 Ga0495675_0048965 3300047444 Bacteria 2687
393 Ga0495679_016255 3300047446 Bacteria 2696
394 Ga0495685_013343 3300047447 Bacteria 2789
395 Ga0495686_0102332 3300047472 Bacteria 1726
396 Ga0495593_0129038 3300047673 Bacteria 1284
397 Ga0495602_0000009 3300048088 Bacteria 258991
398 Ga0495602_0000720 3300048088 Bacteria 31219
399 Ga0495602_0028346 3300048088 Bacteria 5361
400 Ga0496100_0000007 3300048903 Bacteria 261266
401 Ga0496100_0000012 3300048903 Bacteria 182426
402 Ga0496101_0000010 3300048904 Bacteria 281990
403 Ga0496101_0000013 3300048904 Bacteria 261266
404 Ga0496102_0000045 3300048905 Bacteria 186726
405 Ga0496102_0183171 3300048905 Bacteria 1973
406 Ga0496103_0000050 3300048906 Bacteria 152034
407 Ga0496103_0123923 3300048906 Bacteria 1647
408 Ga0496104_0000002 3300048907 Bacteria 686017
409 Ga0496104_0000013 3300048907 Bacteria 397163
410 Ga0496104_0000168 3300048907 Bacteria 58020
411 Ga0496104_0121174 3300048907 Bacteria 2511
412 Ga0496105_0000001 3300048908 Bacteria 1328178
413 Ga0496105_0000006 3300048908 Bacteria 393578
414 Ga0496105_0001115 3300048908 Bacteria 18692
415 Ga0496105_0041948 3300048908 Bacteria 3772
416 Ga0496105_0077288 3300048908 Bacteria 2749
417 Ga0496106_0000006 3300048909 Bacteria 251855
418 Ga0496106_0000017 3300048909 Bacteria 181561
419 Ga0496106_0000049 3300048909 Bacteria 97550
420 Ga0496107_0000007 3300048910 Bacteria 257113
421 Ga0496107_0000012 3300048910 Bacteria 181629
422 Ga0496107_0056120 3300048910 Bacteria 2845
423 Ga0496107_0063534 3300048910 Bacteria 2676
424 Ga0496108_0000001 3300048911 Bacteria 919044
425 Ga0496108_0000080 3300048911 Bacteria 102267
426 Ga0496108_0003785 3300048911 Bacteria 12109
427 Ga0496108_0030474 3300048911 Bacteria 4471
428 Ga0496108_0268918 3300048911 Bacteria 1483
429 Ga0496109_0000006 3300048912 Bacteria 325513
430 Ga0496109_0000021 3300048912 Bacteria 189945
431 Ga0496109_0000024 3300048912 Bacteria 174723
432 Ga0496109_0000039 3300048912 Bacteria 145769
433 Ga0496109_0036945 3300048912 Bacteria 4411
434 Ga0496110_0001421 3300048913 Bacteria 17298
435 Ga0496110_0019743 3300048913 Bacteria 5678
436 Ga0496110_0042965 3300048913 Bacteria 3945
437 Ga0496110_0234320 3300048913 Bacteria 1670
438 Ga0496111_0000583 3300048914 Bacteria 19116
439 Ga0496111_0017635 3300048914 Bacteria 4936
440 Ga0496111_0098567 3300048914 Bacteria 2146
441 Ga0496112_0000003 3300048915 Bacteria 660147
442 Ga0496112_0001882 3300048915 Bacteria 16540
443 Ga0496113_0000028 3300048916 Bacteria 62536
444 Ga0496113_0148956 3300048916 Bacteria 1845
445 Ga0496114_0000003 3300048917 Bacteria 630981
446 Ga0496115_0000020 3300048918 Bacteria 171995
447 Ga0496115_0000036 3300048918 Bacteria 127774
448 Ga0496116_0001127 3300048919 Bacteria 31841
449 Ga0496117_0019783 3300048920 Bacteria 5516
450 Ga0496118_0002198 3300048921 Bacteria 27099
451 Ga0496118_0208284 3300048921 Bacteria 1150
452 Ga0496119_0001930 3300048922 Bacteria 23652
453 Ga0496119_0005650 3300048922 Bacteria 11872
454 Ga0496119_0015839 3300048922 Bacteria 5774
455 Ga0496119_0056844 3300048922 Bacteria 2368
456 Ga0496120_0105329 3300048923 Bacteria 1483
457 Ga0496121_0117554 3300048924 Bacteria 2014
458 Ga0496124_0036714 3300048927 Bacteria 4270
459 Ga0496125_0063950 3300048928 Bacteria 2929
460 Ga0496125_0086466 3300048928 Bacteria 2371
461 Ga0496125_0242296 3300048928 Bacteria 1144
462 Ga0496126_0061012 3300048929 Bacteria 3389
463 Ga0501031_0015891 3300049568 Bacteria 4888
464 Ga0501032_0016103 3300049569 Bacteria 5261
465 Ga0501033_0001784 3300049570 Bacteria 18790
466 Ga0501033_0293433 3300049570 Bacteria 1146
467 Ga0501034_0000265 3300049571 Bacteria 94786
468 Ga0501034_0009457 3300049571 Bacteria 10202
469 Ga0501034_0088932 3300049571 Bacteria 3086
470 Ga0501034_0125888 3300049571 Bacteria 2548
471 Ga0501034_0234453 3300049571 Bacteria 1783
472 Ga0501036_0000029 3300049572 Bacteria 93314
473 Ga0501037_0017850 3300049573 Bacteria 5224
474 Ga0501039_0059941 3300049575 Bacteria 2947
475 Ga0501039_0348551 3300049575 Bacteria 1164
476 Ga0501040_0020668 3300049576 Bacteria 4390
477 Ga0501042_0133806 3300049578 Bacteria 1787
478 Ga0501042_0147304 3300049578 Bacteria 1697
479 Ga0501043_0022329 3300049579 Bacteria 4964
480 Ga0501046_0024007 3300049580 Bacteria 5007
481 Ga0501047_0025772 3300049581 Bacteria 5654
482 Ga0501048_0000888 3300049582 Bacteria 22108
483 Ga0501067_0047284 3300049583 Bacteria 2386
484 Ga0501069_0049240 3300049585 Bacteria 2341
485 Ga0501070_0000037 3300049586 Bacteria 122149
486 Ga0501070_0010598 3300049586 Bacteria 7791
487 Ga0501070_0027399 3300049586 Bacteria 4780
488 Ga0501070_0037461 3300049586 Bacteria 4048
489 Ga0501070_0038927 3300049586 Bacteria 3967
490 Ga0501070_0072248 3300049586 Bacteria 2856
491 Ga0501071_0024675 3300049587 Bacteria 4206
492 Ga0501071_0376481 3300049587 Bacteria 1082
493 Ga0501072_0096626 3300049588 Bacteria 2347
494 Ga0501072_0207703 3300049588 Bacteria 1561
495 Ga0501073_0035092 3300049589 Bacteria 3565
496 Ga0501074_0046693 3300049590 Bacteria 3131
497 Ga0501074_0073148 3300049590 Bacteria 2462
498 Ga0501075_0317591 3300049591 Bacteria 1187
499 Ga0501076_0081903 3300049592 Bacteria 2591
500 Ga0501077_0148436 3300049593 Bacteria 1488
501 Ga0501079_0039913 3300049741 Bacteria 3621
502 Ga0501079_0126589 3300049741 Bacteria 1987
503 Ga0501079_0163888 3300049741 Bacteria 1734
504 Ga0501079_0283915 3300049741 Bacteria 1294
505 Ga0501081_0147963 3300049743 Bacteria 1686
506 Ga0501083_0007735 3300049744 Bacteria 7617
507 Ga0501083_0039645 3300049744 Bacteria 3198
508 Ga0501035_0000920 3300049822 Bacteria 31172
509 Ga0501044_0010868 3300049823 Bacteria 9877
510 Ga0501044_0032872 3300049823 Bacteria 5452
511 Ga0501045_0084653 3300049824 Bacteria 2340
512 nmdc:mga00v17_152934_c1 3300050491 Bacteria 1483
513 nmdc:mga0yw44_20416_c1 3300050492 Bacteria 3676
514 nmdc:mga0yw44_3736_c3 3300050492 Bacteria 2960
515 nmdc:mga06z11_47670_c1 3300050494 Bacteria 2177
516 nmdc:mga04h51_29959_c1 3300050495 Bacteria 1709
517 nmdc:mga07m45_135490_c1 3300050496 Bacteria 1425
518 nmdc:mga05p37_9019_c1 3300050507 Bacteria 11796
519 nmdc:mga09592_157949_c1 3300050508 Bacteria 1958
520 nmdc:mga09592_459998_c1 3300050508 Bacteria 1097
521 nmdc:mga0qj67_38012_c1 3300050509 Bacteria 3774
522 nmdc:mga0qj67_41248_c1 3300050509 Bacteria 3630
523 nmdc:mga06r32_11478_c1 3300050510 Bacteria 7980
524 nmdc:mga06r32_249692_c1 3300050510 Bacteria 1762
525 nmdc:mga06r32_411579_c1 3300050510 Bacteria 1334
526 nmdc:mga08y16_677123_c1 3300050511 Bacteria 1033
527 nmdc:mga08y16_85541_c1 3300050511 Bacteria 3286
528 nmdc:mga08y16_9043_c1 3300050511 Bacteria 10457
529 nmdc:mga0n895_1297_c1 3300050512 Bacteria 18491
530 nmdc:mga0rr50_27858_c1 3300050513 Bacteria 3963
531 nmdc:mga0rr50_352386_c1 3300050513 Bacteria 1238
532 nmdc:mga0a205_142803_c1 3300050515 Bacteria 2294
533 nmdc:mga0a205_1659_c2 3300050515 Bacteria 16747
534 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
535 nmdc:mga0a205_21423_c1 3300050515 Bacteria 6115
536 Ga0495601_0000036 3300053077 Bacteria 91625
537 Ga0495601_0001858 3300053077 Bacteria 11762
538 Ga0495601_0036054 3300053077 Bacteria 3088
539 Ga0495601_0129676 3300053077 Bacteria 1642
540 Ga0495612_0000584 3300053078 Bacteria 14669
541 Ga0495612_0000965 3300053078 Bacteria 11825
542 Ga0495612_0007351 3300053078 Bacteria 4503
543 Ga0495655_0000004 3300053083 Bacteria 293683
544 Ga0495655_0001184 3300053083 Bacteria 4031
545 Ga0495595_0000046 3300053084 Bacteria 62935
546 Ga0495595_0000164 3300053084 Bacteria 26247
547 Ga0495619_0000001 3300053085 Bacteria 586054
548 Ga0495619_0000028 3300053085 Bacteria 162196
549 Ga0495619_0000237 3300053085 Bacteria 40100
550 Ga0495619_0001219 3300053085 Bacteria 16848
551 Ga0495619_0001547 3300053085 Bacteria 15154
552 Ga0495619_0002093 3300053085 Bacteria 13254
553 Ga0495619_0002189 3300053085 Bacteria 12946
554 Ga0495619_0159632 3300053085 Bacteria 1557
555 Ga0495619_0268824 3300053085 Bacteria 1181
556 Ga0500566_0000873 3300053094 Bacteria 17185
557 Ga0500569_065413 3300053109 Unclassified 1132
558 Ga0500595_026274 3300053119 Bacteria 2008
559 Ga0500614_003261 3300053123 Bacteria 3511
560 Ga0500628_000004 3300053129 Bacteria 202098
561 Ga0500658_0094511 3300053134 Bacteria 1297
562 Ga0501082_0030106 3300060353 Bacteria 4677
563 Ga0501082_0136467 3300060353 Bacteria 2129
564 Ga0501082_0433327 3300060353 Bacteria 1148
565 Ga0530510_0196863 3300061734 Bacteria 1496
566 Ga0530510_0243337 3300061734 Bacteria 1340
567 Ga0501079_0254114
568 JGI24746J21847_1000014
569 JGI24740J21852_10000990
570 JGI24742J22300_10015061
571 JGI24751J29686_10016604
572 Ga0070683_100008540
573 Ga0070683_100153852
574 Ga0070677_10000011
575 Ga0070666_10037792
576 Ga0070666_10310964
577 Ga0070682_100000028
578 Ga0070682_100000084
579 Ga0068868_100000008
580 Ga0068868_100146812
581 Ga0070660_100001924
582 Ga0070691_10012209
583 Ga0070687_100109518
584 Ga0070692_10005488
585 Ga0070675_100005523
586 Ga0070675_100038304
587 Ga0070674_100000006
588 Ga0070674_100000052
589 Ga0070674_100076617
590 Ga0070673_100016727
591 Ga0070688_100003416
592 Ga0070688_100030710
593 Ga0070667_100001507
594 Ga0070667_100047793
595 Ga0070713_100000022
596 Ga0070701_10061846
597 Ga0070700_100004418
598 Ga0070708_100283562
599 Ga0070663_100003390
600 Ga0070663_100007216
601 Ga0070662_100000038
602 Ga0068867_100000127
603 Ga0068867_100022063
604 Ga0068867_100066714
605 Ga0070685_10000021
606 Ga0070685_10000111
607 Ga0070685_10062249
608 Ga0070706_100258878
609 Ga0070707_100023957
610 Ga0070679_100000260
611 Ga0070679_100002161
612 Ga0070679_100055370
613 Ga0070684_100027713
614 Ga0070684_100055187
615 Ga0070684_100190563
616 Ga0070684_100248788
617 Ga0070672_100000580
618 Ga0070693_100002391
619 Ga0070693_100030355
620 Ga0070665_100000068
621 Ga0070665_100001200
622 Ga0070704_100147756
623 Ga0070664_100030206
624 Ga0068854_100000742
625 Ga0068854_100008988
626 Ga0068854_100169285
627 Ga0068856_100000971
628 Ga0070702_100003366
629 Ga0068852_100000005
630 Ga0068864_100000023
631 Ga0068866_10000011
632 Ga0068866_10000731
633 Ga0068866_10009631
634 Ga0068866_10019411
635 Ga0068861_100021136
636 Ga0068861_100177465
637 Ga0068863_100000004
638 Ga0068863_100005063
639 Ga0068858_100000012
640 Ga0068858_100000033
641 Ga0068858_100065858
642 Ga0068860_100001973
643 Ga0068860_100066245
644 Ga0068860_100094683
645 Ga0068862_100000050
646 Ga0081455_10006668
647 Ga0081455_10031042
648 Ga0081455_10056764
649 Ga0081455_10085770
650 Ga0081538_10000023
651 Ga0081538_10000450
652 Ga0081538_10051377
653 Ga0081540_1000106
654 Ga0081540_1027391
655 Ga0081540_1037440
656 Ga0081540_1045749
657 Ga0081539_10000504
658 Ga0081539_10028525
659 Ga0075365_10001858
660 Ga0075365_10016455
661 Ga0075365_10079190
662 Ga0075368_10078090
663 Ga0075363_100009763
664 Ga0075363_100014145
665 Ga0075363_100038843
666 Ga0075364_10053557
667 Ga0075364_10121362
668 Ga0075364_10149345
669 Ga0070715_10000011
670 Ga0070716_100136592
671 Ga0070712_100000850
672 Ga0075367_10055090
673 Ga0075367_10257520
674 Ga0075370_10137593
675 Ga0075428_100360125
676 Ga0075430_100052264
677 Ga0075430_100087765
678 Ga0075431_100169269
679 Ga0075431_100431565
680 Ga0075433_10000047
681 Ga0075433_10003789
682 Ga0075433_10087789
683 Ga0075433_10125721
684 Ga0075434_100039724
685 Ga0075434_100057418
686 Ga0075429_100002703
687 Ga0075429_100053990
688 Ga0068865_100000741
689 Ga0075435_100327450
690 Ga0105240_10145530
691 Ga0105240_10581878
692 Ga0111539_10014849
693 Ga0111539_10250260
694 Ga0105245_10000147
695 Ga0105245_10000365
696 Ga0105245_10004676
697 Ga0105245_10005201
698 Ga0105245_10006637
699 Ga0105245_10131158
700 Ga0105247_10000105
701 Ga0114129_10011624
702 Ga0114129_10258338
703 Ga0114129_10404351
704 Ga0105243_10003898
705 Ga0105243_10072507
706 Ga0105242_10000331
707 Ga0105242_10000335
708 Ga0105237_10153023
709 Ga0105238_10000023
710 Ga0105238_10106093
711 Ga0105238_10264033
712 Ga0105249_10000165
713 Ga0105249_10008206
714 Ga0105249_10177394
715 Ga0105249_10212831
716 Ga0105249_10376889
717 Ga0105239_10157351
718 Ga0105239_10169803
719 Ga0105239_10392017
720 Ga0157371_10007499
721 Ga0157370_10002070
722 Ga0157369_10000130
723 Ga0157374_10011988
724 Ga0157374_10050214
725 Ga0157378_10000803
726 Ga0157378_10061655
727 Ga0157375_10000153
728 Ga0157375_10001627
729 Ga0157380_10000028
730 Ga0157380_10019030
731 Ga0157380_10253188
732 Ga0157379_10045006
733 Ga0157379_10139357
734 Ga0157376_10012528
735 Ga0157376_10047854
736 Ga0163161_10000018
737 Ga0206356_10076920
738 Ga0206349_1095755
739 Ga0206351_10293384
740 Ga0206352_10666613
741 Ga0206354_11169333
742 Ga0206354_11422714
743 Ga0224712_10112242
744 Ga0207682_10000019
745 Ga0207642_10000010
746 Ga0207642_10000203
747 Ga0207642_10005469
748 Ga0207642_10015588
749 Ga0207710_10000448
750 Ga0207680_10003453
751 Ga0207685_10000001
752 Ga0207684_10004212
753 Ga0207707_10188616
754 Ga0207663_10051121
755 Ga0207660_10055328
756 Ga0207662_10047781
757 Ga0207657_10002993
758 Ga0207649_10000005
759 Ga0207649_10099284
760 Ga0207652_10000414
761 Ga0207652_10000581
762 Ga0207652_10072012
763 Ga0207646_10043760
764 Ga0207694_10000004
765 Ga0207650_10094815
766 Ga0207659_10000014
767 Ga0207659_10025930
768 Ga0207687_10000011
769 Ga0207687_10000026
770 Ga0207687_10000213
771 Ga0207687_10007516
772 Ga0207700_10000008
773 Ga0207664_10114088
774 Ga0207690_10027168
775 Ga0207706_10000026
776 Ga0207706_10002442
777 Ga0207686_10000032
778 Ga0207686_10000479
779 Ga0207709_10011319
780 Ga0207670_10107299
781 Ga0207669_10000010
782 Ga0207669_10000025
783 Ga0207669_10004213
784 Ga0207669_10040853
785 Ga0207704_10000045
786 Ga0207704_10006672
787 Ga0207704_10167999
788 Ga0207665_10131148
789 Ga0207691_10000429
790 Ga0207711_10000024
791 Ga0207711_10390201
792 Ga0207689_10155404
793 Ga0207661_10000165
794 Ga0207661_10011362
795 Ga0207661_10034006
796 Ga0207661_10038108
797 Ga0207661_10267638
798 Ga0207679_10019148
799 Ga0207679_10189314
800 Ga0207651_10019546
801 Ga0207712_10000037
802 Ga0207712_10004128
803 Ga0207668_10002386
804 Ga0207640_10000641
805 Ga0207640_10026073
806 Ga0207640_10092034
807 Ga0207658_10003653
808 Ga0207658_10032693
809 Ga0207677_10010345
810 Ga0207677_10037713
811 Ga0207703_10000091
812 Ga0207703_10000126
813 Ga0207703_10197448
814 Ga0207678_10001831
815 Ga0207678_10005463
816 Ga0207708_10001342
817 Ga0207702_10000865
818 Ga0207641_10000129
819 Ga0207641_10004517
820 Ga0207648_10001697
821 Ga0207648_10004886
822 Ga0207648_10080326
823 Ga0207676_10000025
824 Ga0207674_10009793
825 Ga0207675_100008487
826 Ga0207675_100105524
827 Ga0207675_100239636
828 Ga0207698_10000041
829 Ga0207698_10055275
830 Ga0209813_10024228
831 Ga0268266_10000020
832 Ga0268266_10000263
833 Ga0268266_10000303
834 Ga0268265_10002948
835 Ga0268264_10024099
836 Ga0268264_10126002
837 Ga0265319_1000028
838 Ga0265338_10001275
839 Ga0265327_10102149
840 Ga0316579_10096435
841 Ga0316576_10006733
842 Ga0316578_10095198
843 Ga0316577_10003050
844 Ga0307410_10105848
845 Ga0307406_10097352
846 Ga0307415_100001253
847 Ga0307415_100148512
848 Ga0316583_10026244
849 Ga0316574_0010440
850 Ga0316574_0116582
851 Ga0316574_0338489
852 Ga0373937_0016562
853 Ga0373937_0028971
854 Ga0316582_0037069
855 Ga0316582_0143126
856 Ga0316584_0017340
857 Ga0316584_0020631
858 Ga0316584_0033607
859 Ga0316584_0134335
860 Ga0395898_0376111
861 Ga0316581_0022141
862 Ga0395901_0619759
863 Ga0395901_0624291
864 Ga0451800_0956312
865 Ga0451839_1291997
866 Ga0451853_3856884
867 Ga0466963_0000029
868 Ga0466963_0235735
869 Ga0466964_0063856
870 Ga0466957_0000175
871 Ga0466958_0049326
872 Ga0466967_0000021
873 Ga0466967_0019429
874 Ga0466967_0184392
875 Ga0466967_0418548
876 Ga0495592_0000324
877 Ga0495592_0034419
878 Ga0495603_0003969
879 Ga0495591_030597
880 Ga0495629_0000055
881 Ga0495629_0009655
882 Ga0495629_0148465
883 Ga0495638_0156201
884 Ga0495641_0000020
885 Ga0495651_0148409
886 Ga0495651_0159874
887 Ga0495653_0212606
888 Ga0495582_0004714
889 Ga0495639_0016251
890 Ga0495662_0000033
891 Ga0495594_0000007
892 Ga0495606_0000057
893 Ga0495608_0000094
894 Ga0495608_0005830
895 Ga0495608_0032097
896 Ga0495608_0182666
897 Ga0495610_0049413
898 Ga0495618_0000075
899 Ga0495620_0000303
900 Ga0495628_0000061
901 Ga0495628_0114481
902 Ga0495628_0157001
903 Ga0495630_0000025
904 Ga0495630_0000903
905 Ga0495630_0000951
906 Ga0495630_0098728
907 Ga0495643_0095511
908 Ga0495644_0008504
909 Ga0495644_0080034
910 Ga0495652_0000003
911 Ga0495652_0014350
912 Ga0495640_0032549
913 Ga0495587_0001735
914 Ga0495587_0132641
915 Ga0495621_0009521
916 Ga0495645_0014038
917 Ga0495645_0018421
918 Ga0495622_0000050
919 Ga0495667_0000022
920 Ga0495667_0136770
921 Ga0495656_0000220
922 Ga0495634_0000063
923 Ga0495634_0000296
924 Ga0495634_0012112
925 Ga0495625_0000029
926 Ga0495625_0235108
927 Ga0495635_0000037
928 Ga0495588_0000243
929 Ga0495588_0129317
930 Ga0495657_0000152
931 Ga0495657_0023413
932 Ga0495647_0000015
933 Ga0495647_0005669
934 Ga0495647_0005848
935 Ga0495658_0003614
936 Ga0495658_0016117
937 Ga0495669_0000137
938 Ga0495613_0000068
939 Ga0495613_0000109
940 Ga0495624_0000012
941 Ga0495624_0000298
942 Ga0495670_0054107
943 Ga0495600_0001659
944 Ga0495600_0003029
945 Ga0495581_0136488
946 Ga0495604_0000013
947 Ga0495604_0000631
948 Ga0495604_0055676
949 Ga0495674_0000020
950 Ga0495674_0135567
951 Ga0495676_0000729
952 Ga0495676_0000826
953 Ga0495680_0000464
954 Ga0495680_0000864
955 Ga0495680_0005623
956 Ga0495680_0044138
957 Ga0495675_0000095
958 Ga0495675_0048965
959 Ga0495679_016255
960 Ga0495685_013343
961 Ga0495686_0102332
962 Ga0495593_0129038
963 Ga0495602_0000009
964 Ga0495602_0000720
965 Ga0495602_0028346
966 Ga0496100_0000007
967 Ga0496100_0000012
968 Ga0496101_0000010
969 Ga0496101_0000013
970 Ga0496102_0000045
971 Ga0496102_0183171
972 Ga0496103_0000050
973 Ga0496103_0123923
974 Ga0496104_0000002
975 Ga0496104_0000013
976 Ga0496104_0000168
977 Ga0496104_0121174
978 Ga0496105_0000001
979 Ga0496105_0000006
980 Ga0496105_0001115
981 Ga0496105_0041948
982 Ga0496105_0077288
983 Ga0496106_0000006
984 Ga0496106_0000017
985 Ga0496106_0000049
986 Ga0496107_0000007
987 Ga0496107_0000012
988 Ga0496107_0056120
989 Ga0496107_0063534
990 Ga0496108_0000001
991 Ga0496108_0000080
992 Ga0496108_0003785
993 Ga0496108_0030474
994 Ga0496108_0268918
995 Ga0496109_0000006
996 Ga0496109_0000021
997 Ga0496109_0000024
998 Ga0496109_0000039
999 Ga0496109_0036945
1000 Ga0496110_0001421
1001 Ga0496110_0019743
1002 Ga0496110_0042965
1003 Ga0496110_0234320
1004 Ga0496111_0000583
1005 Ga0496111_0017635
1006 Ga0496111_0098567
1007 Ga0496112_0000003
1008 Ga0496112_0001882
1009 Ga0496113_0000028
1010 Ga0496113_0148956
1011 Ga0496114_0000003
1012 Ga0496115_0000020
1013 Ga0496115_0000036
1014 Ga0496116_0001127
1015 Ga0496117_0019783
1016 Ga0496118_0002198
1017 Ga0496118_0208284
1018 Ga0496119_0001930
1019 Ga0496119_0005650
1020 Ga0496119_0015839
1021 Ga0496119_0056844
1022 Ga0496120_0105329
1023 Ga0496121_0117554
1024 Ga0496124_0036714
1025 Ga0496125_0063950
1026 Ga0496125_0086466
1027 Ga0496125_0242296
1028 Ga0496126_0061012
1029 Ga0501031_0015891
1030 Ga0501032_0016103
1031 Ga0501033_0001784
1032 Ga0501033_0293433
1033 Ga0501034_0000265
1034 Ga0501034_0009457
1035 Ga0501034_0088932
1036 Ga0501034_0125888
1037 Ga0501034_0234453
1038 Ga0501036_0000029
1039 Ga0501037_0017850
1040 Ga0501039_0059941
1041 Ga0501039_0348551
1042 Ga0501040_0020668
1043 Ga0501042_0133806
1044 Ga0501042_0147304
1045 Ga0501043_0022329
1046 Ga0501046_0024007
1047 Ga0501047_0025772
1048 Ga0501048_0000888
1049 Ga0501067_0047284
1050 Ga0501069_0049240
1051 Ga0501070_0000037
1052 Ga0501070_0010598
1053 Ga0501070_0027399
1054 Ga0501070_0037461
1055 Ga0501070_0038927
1056 Ga0501070_0072248
1057 Ga0501071_0024675
1058 Ga0501071_0376481
1059 Ga0501072_0096626
1060 Ga0501072_0207703
1061 Ga0501073_0035092
1062 Ga0501074_0046693
1063 Ga0501074_0073148
1064 Ga0501075_0317591
1065 Ga0501076_0081903
1066 Ga0501077_0148436
1067 Ga0501079_0039913
1068 Ga0501079_0126589
1069 Ga0501079_0163888
1070 Ga0501079_0283915
1071 Ga0501081_0147963
1072 Ga0501083_0007735
1073 Ga0501083_0039645
1074 Ga0501035_0000920
1075 Ga0501044_0010868
1076 Ga0501044_0032872
1077 Ga0501045_0084653
1078 nmdc:mga00v17_152934_c1
1079 nmdc:mga0yw44_20416_c1
1080 nmdc:mga0yw44_3736_c3
1081 nmdc:mga06z11_47670_c1
1082 nmdc:mga04h51_29959_c1
1083 nmdc:mga07m45_135490_c1
1084 nmdc:mga05p37_9019_c1
1085 nmdc:mga09592_157949_c1
1086 nmdc:mga09592_459998_c1
1087 nmdc:mga0qj67_38012_c1
1088 nmdc:mga0qj67_41248_c1
1089 nmdc:mga06r32_11478_c1
1090 nmdc:mga06r32_249692_c1
1091 nmdc:mga06r32_411579_c1
1092 nmdc:mga08y16_677123_c1
1093 nmdc:mga08y16_85541_c1
1094 nmdc:mga08y16_9043_c1
1095 nmdc:mga0n895_1297_c1
1096 nmdc:mga0rr50_27858_c1
1097 nmdc:mga0rr50_352386_c1
1098 nmdc:mga0a205_142803_c1
1099 nmdc:mga0a205_1659_c2
1100 nmdc:mga0a205_1_c2
1101 nmdc:mga0a205_21423_c1
1102 Ga0495601_0000036
1103 Ga0495601_0001858
1104 Ga0495601_0036054
1105 Ga0495601_0129676
1106 Ga0495612_0000584
1107 Ga0495612_0000965
1108 Ga0495612_0007351
1109 Ga0495655_0000004
1110 Ga0495655_0001184
1111 Ga0495595_0000046
1112 Ga0495595_0000164
1113 Ga0495619_0000001
1114 Ga0495619_0000028
1115 Ga0495619_0000237
1116 Ga0495619_0001219
1117 Ga0495619_0001547
1118 Ga0495619_0002093
1119 Ga0495619_0002189
1120 Ga0495619_0159632
1121 Ga0495619_0268824
1122 Ga0500566_0000873
1123 Ga0500569_065413
1124 Ga0500595_026274
1125 Ga0500614_003261
1126 Ga0500628_000004
1127 Ga0500658_0094511
1128 Ga0501082_0030106
1129 Ga0501082_0136467
1130 Ga0501082_0433327
1131 Ga0530510_0196863
1132 Ga0530510_0243337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01791

DeoC

DeoC/LacD family aldolase

38

282

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w8s-assembly1.cif.gz_A the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates 0.9366 22 298
1ok6-assembly1.cif.gz_A orthorhombic crystal form of an archaeal fructose 1,6-bisphosphate aldolase 0.9335 17 300
1ok6-assembly1.cif.gz_A orthorhombic crystal form of an archaeal fructose 1,6-bisphosphate aldolase 0.9229 17 300
2yce-assembly1.cif.gz_E structure of an archaeal fructose-1,6-bisphosphate aldolase with the catalytic lys covalently bound to the carbinolamine intermediate of the substrate. 0.9217 22 304
1w8s-assembly1.cif.gz_A the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates 0.9187 22 298
ID Description Score Start End Superfamily
1ok6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9335 17 300 3.20.20.70
1ok6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9229 17 300 3.20.20.70
af_P0A991_40_348_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8807 15 299 3.20.20.70
4mozD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8799 19 300 3.20.20.70
2qjgK00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.836 11 304 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A524M4H2-F1-model_v4 Fructose-bisphosphate aldolase 0.983 146 300 GO:0016829
AF-A0A524E8E1-F1-model_v4 Fructose-bisphosphate aldolase 0.9828 16 299 GO:0004332
AF-E6Q7Z0-F1-model_v4 Putative Fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9792 15 303 GO:0004332
AF-T1BV28-F1-model_v4 Fructose-bisphosphate aldolase, class I 0.9769 13 277 GO:0004332
AF-A0A511QYZ5-F1-model_v4 Fructose-bisphosphate aldolase 0.9759 41 300 GO:0004332

Map