F464461

General Info

Members Datasets Scaffolds Average Seq Length
566 263 1130 246

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581311|2585292821
Length 241
Sequence ILIIGATSAIATACARRWTNGTRLFLVGRNAARLQQVTDDLNSRGASATCMQLDVNDYAGHQALFARLEVEMPTIDIALIAPGTLPDQDMCQHDAVIAVREFNTNATSLIALLTPLANRMEAHKHGVIAVISSVAGDRGRPSNYLYGSAKAALSTFCEGLRARLAKSNVHLVTVKPGFVDTPMTAGLPLPGPLVATADKVAADIDRAIAKRINVLYTPWFWSGIMLIIRSIPQFVFKRISL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
81 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
93 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
94 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
97 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
98 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
99 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
100 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
101 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
102 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
107 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
218 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
219 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
220 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
221 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
222 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
223 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
224 2511231016 Pseudomonas sp. GM50 Isolate Nodule
225 2511231021 Pseudomonas sp. GM78 Isolate Nodule
226 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
227 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
228 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
229 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
230 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
231 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
232 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
233 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
234 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
235 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
236 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
237 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
238 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
239 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
240 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
241 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
242 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
243 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
244 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
245 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
246 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
247 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
248 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
249 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
250 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
251 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
252 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
253 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
254 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
255 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
256 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
257 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
258 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
259 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
260 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
261 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
262 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
263 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.34
Metatranscriptomes 0.18
Isolates 8.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.47
Nodule 1.59
Rhizoplane 3.71
Rhizosphere 78.98
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_7381 2124908027 Bacteria 3043
2 MRS2a_Contig_8530 2124908027 Bacteria 3038
3 MRS2a_Contig_9777 2124908027 Bacteria 1443
4 JGI24735J21928_10010979 3300002067 Bacteria 2877
5 JGI25162J39368_1000216 3300002737 Bacteria 60602
6 JGI25163J39215_1000422 3300002771 Bacteria 13137
7 JGI25164J39214_1000176 3300002772 Bacteria 59249
8 JGI25165J46597_1000306 3300003214 Bacteria 60602
9 rootH1_10069774 3300003323 Bacteria 3059
10 JGI25160J50197_1029645 3300003354 Bacteria 1442
11 Ga0055536_1000202 3300003781 Bacteria 48758
12 Ga0065714_10091474 3300005288 Bacteria 1909
13 Ga0065714_10133796 3300005288 Bacteria 1227
14 Ga0065712_10068210 3300005290 Bacteria 13033
15 Ga0070658_10491252 3300005327 Bacteria 1060
16 Ga0070676_10058900 3300005328 Bacteria 2277
17 Ga0070690_100083460 3300005330 Bacteria 2093
18 Ga0070670_100002657 3300005331 Bacteria 14780
19 Ga0070670_100106293 3300005331 Bacteria 2419
20 Ga0068869_100100353 3300005334 Bacteria 2189
21 Ga0070666_10071070 3300005335 Bacteria 2368
22 Ga0070660_100044536 3300005339 Bacteria 3395
23 Ga0070675_100089144 3300005354 Bacteria 2582
24 Ga0070667_100138695 3300005367 Bacteria 2128
25 Ga0070662_100059591 3300005457 Bacteria 2781
26 Ga0070662_100295519 3300005457 Bacteria 1314
27 Ga0070681_10749516 3300005458 Bacteria 893
28 Ga0070672_100082651 3300005543 Bacteria 2577
29 Ga0068855_100249332 3300005563 Bacteria 1981
30 Ga0070664_100009019 3300005564 Bacteria 8091
31 Ga0068857_100106154 3300005577 Unclassified 2522
32 Ga0068854_100248003 3300005578 Bacteria 1421
33 Ga0068856_100036828 3300005614 Bacteria 4797
34 Ga0068852_100172943 3300005616 Bacteria 2026
35 Ga0068859_100124974 3300005617 Bacteria 2641
36 Ga0068864_100158645 3300005618 Bacteria 2055
37 Ga0068863_100045354 3300005841 Bacteria 4172
38 Ga0068860_100031611 3300005843 Bacteria 5088
39 Ga0068862_100281479 3300005844 Bacteria 1524
40 Ga0097621_100066710 3300006237 Bacteria 2964
41 Ga0097620_100124973 3300006931 Bacteria 2641
42 Ga0079104_1002868 3300006946 Bacteria 8614
43 Ga0105251_10005072 3300009011 Bacteria 8726
44 Ga0105251_10007371 3300009011 Bacteria 6795
45 Ga0105244_10000547 3300009036 Bacteria 33532
46 Ga0105244_10002169 3300009036 Bacteria 15048
47 Ga0105244_10002784 3300009036 Bacteria 13032
48 Ga0105244_10005981 3300009036 Bacteria 7971
49 Ga0105244_10006623 3300009036 Bacteria 7464
50 Ga0105244_10100368 3300009036 Bacteria 1416
51 Ga0105244_10100380 3300009036 Bacteria 1416
52 Ga0105250_10000802 3300009092 Bacteria 18942
53 Ga0105240_10423946 3300009093 Bacteria 1494
54 Ga0105243_10597356 3300009148 Unclassified 1062
55 Ga0105241_10046171 3300009174 Bacteria 3307
56 Ga0105239_10045370 3300010375 Bacteria 4817
57 Ga0105246_10091664 3300011119 Unclassified 2191
58 Ga0157373_10000705 3300013100 Bacteria 26209
59 Ga0157373_10004133 3300013100 Bacteria 10948
60 Ga0157373_10004773 3300013100 Bacteria 10201
61 Ga0157373_10011757 3300013100 Bacteria 6430
62 Ga0157373_10213034 3300013100 Bacteria 1362
63 Ga0157373_10416359 3300013100 Bacteria 964
64 Ga0157371_10006831 3300013102 Bacteria 9324
65 Ga0157371_10041487 3300013102 Bacteria 3283
66 Ga0157370_10003320 3300013104 Bacteria 18958
67 Ga0157370_10012282 3300013104 Bacteria 8888
68 Ga0157369_10002104 3300013105 Bacteria 23998
69 Ga0157369_10023692 3300013105 Bacteria 6836
70 Ga0157369_10486539 3300013105 Bacteria 1277
71 Ga0163162_10000188 3300013306 Bacteria 57231
72 Ga0163162_10000307 3300013306 Bacteria 45339
73 Ga0157375_10130021 3300013308 Bacteria 2636
74 Ga0182008_10004199 3300014497 Bacteria 8472
75 Ga0182008_10008909 3300014497 Bacteria 5442
76 Ga0182008_10034396 3300014497 Bacteria 2541
77 Ga0157376_10128188 3300014969 Bacteria 2260
78 Ga0182006_1033133 3300015261 Bacteria 2072
79 Ga0182007_10000633 3300015262 Bacteria 20430
80 Ga0182007_10001455 3300015262 Bacteria 12711
81 Ga0182007_10013951 3300015262 Bacteria 3046
82 Ga0182007_10029106 3300015262 Bacteria 1893
83 Ga0182005_1023061 3300015265 Bacteria 1703
84 Ga0182005_1023614 3300015265 Bacteria 1680
85 Ga0163161_10000482 3300017792 Bacteria 32775
86 Ga0163161_10010145 3300017792 Bacteria 6520
87 Ga0163161_10213657 3300017792 Bacteria 1491
88 Ga0163161_10417132 3300017792 Bacteria 1079
89 Ga0209435_106156 3300025206 Bacteria 1338
90 Ga0209760_100011 3300025207 Bacteria 197221
91 Ga0207427_100008 3300025231 Bacteria 740731
92 Ga0209437_100014 3300025233 Bacteria 740714
93 Ga0209759_1000711 3300025256 Bacteria 29498
94 Ga0209233_1000008 3300025261 Bacteria 1356712
95 Ga0209676_1000270 3300025292 Bacteria 108368
96 Ga0207426_1001782 3300025302 Bacteria 16168
97 Ga0207696_1000097 3300025711 Bacteria 175696
98 Ga0207655_1000706 3300025728 Bacteria 38597
99 Ga0207655_1000711 3300025728 Bacteria 38267
100 Ga0207655_1001196 3300025728 Bacteria 25074
101 Ga0207655_1002594 3300025728 Bacteria 14396
102 Ga0207655_1002966 3300025728 Bacteria 13044
103 Ga0207655_1005353 3300025728 Bacteria 8755
104 Ga0207713_1022484 3300025735 Bacteria 2991
105 Ga0207713_1032383 3300025735 Bacteria 2296
106 Ga0207680_10044008 3300025903 Bacteria 2622
107 Ga0207647_10057009 3300025904 Bacteria 2396
108 Ga0207695_10181236 3300025913 Bacteria 2027
109 Ga0207671_10242695 3300025914 Bacteria 1415
110 Ga0207657_10023926 3300025919 Bacteria 5672
111 Ga0207649_10086194 3300025920 Bacteria 2046
112 Ga0207650_10000186 3300025925 Bacteria 72380
113 Ga0207706_10068107 3300025933 Bacteria 3133
114 Ga0207691_10101520 3300025940 Bacteria 2567
115 Ga0207689_10337191 3300025942 Bacteria 1252
116 Ga0207674_10030426 3300026116 Bacteria 5675
117 Ga0209281_1001531 3300027111 Bacteria 12971
118 Ga0209970_1000551 3300027614 Bacteria 6498
119 Ga0209974_10020176 3300027876 Bacteria 2210
120 Ga0268265_10808321 3300028380 Bacteria 914
121 Ga0268264_10028245 3300028381 Bacteria 4587
122 Ga0316178_1100236 3300030735 Bacteria 17770
123 Ga0307408_100001237 3300031548 Bacteria 19178
124 Ga0307408_100005313 3300031548 Bacteria 8626
125 Ga0307405_10104871 3300031731 Bacteria 1903
126 Ga0307405_10343442 3300031731 Bacteria 1149
127 Ga0307406_10661634 3300031901 Bacteria 868
128 Ga0307412_10043174 3300031911 Bacteria 2934
129 Ga0307411_10035891 3300032005 Bacteria 3101
130 Ga0395905_0006954 3300037471 Bacteria 11305
131 Ga0439438_000292 3300041405 Bacteria 22487
132 Ga0439438_000826 3300041405 Bacteria 13851
133 Ga0439447_005596 3300041407 Bacteria 4157
134 Ga0439466_0000770 3300041411 Bacteria 12140
135 Ga0439466_0003280 3300041411 Bacteria 6303
136 Ga0439432_001340 3300042006 Bacteria 9320
137 Ga0439432_003687 3300042006 Bacteria 5668
138 Ga0439451_000014 3300042009 Bacteria 42560
139 Ga0439451_001878 3300042009 Bacteria 4194
140 Ga0439451_004135 3300042009 Bacteria 2946
141 Ga0439452_000198 3300042010 Bacteria 43963
142 Ga0439452_000355 3300042010 Bacteria 28112
143 Ga0439463_000496 3300042016 Bacteria 10997
144 Ga0439463_000546 3300042016 Bacteria 10548
145 Ga0439463_002161 3300042016 Bacteria 5080
146 Ga0439463_002372 3300042016 Bacteria 4799
147 Ga0439463_005119 3300042016 Bacteria 3263
148 Ga0450911_000155 3300042115 Bacteria 27707
149 Ga0450911_006345 3300042115 Bacteria 1768
150 Ga0450900_000072 3300042136 Bacteria 5031
151 Ga0450903_015187 3300042138 Bacteria 1214
152 Ga0450904_000887 3300042139 Bacteria 4867
153 Ga0450906_000034 3300042145 Bacteria 21936
154 Ga0450908_031229 3300042184 Bacteria 925
155 Ga0439460_0000080 3300042461 Bacteria 14889
156 Ga0439460_0003531 3300042461 Bacteria 3780
157 Ga0439460_0046645 3300042461 Bacteria 1288
158 Ga0439440_0000005 3300042993 Bacteria 31981
159 Ga0466978_0312335 3300044671 Unclassified 883
160 Ga0466957_0219247 3300044842 Bacteria 1256
161 Ga0466967_0374407 3300045976 Bacteria 1382
162 Ga0495617_018191 3300046452 Bacteria 2376
163 Ga0495617_030973 3300046452 Bacteria 1798
164 Ga0495627_000058 3300046453 Bacteria 143802
165 Ga0495627_000134 3300046453 Bacteria 88155
166 Ga0495627_000169 3300046453 Bacteria 74332
167 Ga0495627_006395 3300046453 Bacteria 4620
168 Ga0495590_0010728 3300046457 Bacteria 3434
169 Ga0495590_0108756 3300046457 Bacteria 988
170 Ga0495591_000040 3300046458 Bacteria 155841
171 Ga0495591_000078 3300046458 Bacteria 109382
172 Ga0495591_000906 3300046458 Bacteria 20625
173 Ga0495591_002439 3300046458 Bacteria 10345
174 Ga0495591_002699 3300046458 Bacteria 9627
175 Ga0495629_0021044 3300046459 Bacteria 4654
176 Ga0495629_0025925 3300046459 Bacteria 4165
177 Ga0495629_0075647 3300046459 Bacteria 2351
178 Ga0495651_0074929 3300046462 Bacteria 2567
179 Ga0495653_0355902 3300046463 Bacteria 940
180 Ga0495650_0000388 3300046471 Bacteria 75543
181 Ga0495650_0004420 3300046471 Bacteria 9642
182 Ga0495650_0005056 3300046471 Bacteria 8730
183 Ga0495650_0007552 3300046471 Bacteria 6512
184 Ga0495650_0014920 3300046471 Bacteria 4010
185 Ga0495580_0004548 3300046472 Bacteria 11645
186 Ga0495580_0005234 3300046472 Bacteria 10781
187 Ga0495580_0008357 3300046472 Bacteria 8233
188 Ga0495580_0052884 3300046472 Bacteria 2867
189 Ga0495580_0110658 3300046472 Bacteria 1908
190 Ga0495582_0086513 3300046473 Bacteria 1744
191 Ga0495605_0000007 3300046474 Bacteria 358289
192 Ga0495605_0000017 3300046474 Bacteria 273775
193 Ga0495605_0001122 3300046474 Bacteria 17813
194 Ga0495605_0001446 3300046474 Bacteria 15562
195 Ga0495605_0001706 3300046474 Bacteria 14091
196 Ga0495605_0003690 3300046474 Bacteria 9089
197 Ga0495605_0014594 3300046474 Bacteria 4296
198 Ga0495605_0019100 3300046474 Bacteria 3667
199 Ga0495605_0034876 3300046474 Bacteria 2545
200 Ga0495605_0091818 3300046474 Bacteria 1406
201 Ga0495605_0107856 3300046474 Bacteria 1273
202 Ga0495639_0000020 3300046475 Bacteria 73983
203 Ga0495639_0002251 3300046475 Bacteria 8470
204 Ga0495662_0071705 3300046476 Bacteria 1679
205 Ga0495664_0003274 3300046477 Bacteria 8803
206 Ga0495664_0012857 3300046477 Bacteria 4741
207 Ga0495664_0128498 3300046477 Bacteria 1534
208 Ga0495584_0001338 3300046491 Bacteria 14929
209 Ga0495584_0004876 3300046491 Bacteria 7170
210 Ga0495584_0131801 3300046491 Bacteria 1268
211 Ga0495585_0000900 3300046492 Bacteria 25180
212 Ga0495585_0062181 3300046492 Bacteria 2051
213 Ga0495585_0076862 3300046492 Unclassified 1813
214 Ga0495585_0209215 3300046492 Bacteria 989
215 Ga0495594_0011357 3300046499 Bacteria 4626
216 Ga0495594_0052918 3300046499 Bacteria 2235
217 Ga0495596_0008778 3300046500 Bacteria 4474
218 Ga0495607_0000022 3300046501 Bacteria 162516
219 Ga0495607_0000171 3300046501 Bacteria 68792
220 Ga0495607_0000588 3300046501 Bacteria 35433
221 Ga0495607_0000882 3300046501 Bacteria 27974
222 Ga0495607_0002164 3300046501 Bacteria 16364
223 Ga0495607_0002976 3300046501 Bacteria 13280
224 Ga0495607_0004047 3300046501 Bacteria 10990
225 Ga0495607_0005383 3300046501 Bacteria 9183
226 Ga0495607_0007023 3300046501 Bacteria 7830
227 Ga0495607_0025425 3300046501 Bacteria 3682
228 Ga0495607_0044748 3300046501 Bacteria 2608
229 Ga0495607_0058789 3300046501 Bacteria 2196
230 Ga0495607_0063128 3300046501 Bacteria 2097
231 Ga0495607_0139122 3300046501 Bacteria 1254
232 Ga0495607_0253261 3300046501 Bacteria 846
233 Ga0495583_0000007 3300046506 Bacteria 434661
234 Ga0495583_0000499 3300046506 Bacteria 56843
235 Ga0495583_0000692 3300046506 Bacteria 43669
236 Ga0495583_0001320 3300046506 Bacteria 25760
237 Ga0495583_0002912 3300046506 Bacteria 13839
238 Ga0495583_0003049 3300046506 Bacteria 13316
239 Ga0495583_0003189 3300046506 Bacteria 12862
240 Ga0495583_0007816 3300046506 Bacteria 6644
241 Ga0495606_0000362 3300046507 Bacteria 77675
242 Ga0495606_0003398 3300046507 Bacteria 16909
243 Ga0495606_0003680 3300046507 Bacteria 16053
244 Ga0495606_0005555 3300046507 Bacteria 12021
245 Ga0495606_0023465 3300046507 Bacteria 4468
246 Ga0495606_0024645 3300046507 Bacteria 4329
247 Ga0495610_0012720 3300046512 Bacteria 5043
248 Ga0495610_0016838 3300046512 Bacteria 4189
249 Ga0495610_0041749 3300046512 Bacteria 2300
250 Ga0495616_0013026 3300046513 Bacteria 4703
251 Ga0495616_0092327 3300046513 Bacteria 1431
252 Ga0495618_0242429 3300046514 Bacteria 1133
253 Ga0495620_0000129 3300046515 Bacteria 61499
254 Ga0495620_0002500 3300046515 Bacteria 10653
255 Ga0495620_0002804 3300046515 Bacteria 10018
256 Ga0495620_0004982 3300046515 Bacteria 7443
257 Ga0495620_0034599 3300046515 Bacteria 2280
258 Ga0495620_0049998 3300046515 Bacteria 1785
259 Ga0495628_0011932 3300046516 Bacteria 7329
260 Ga0495628_0012253 3300046516 Bacteria 7228
261 Ga0495630_0001333 3300046517 Bacteria 16949
262 Ga0495630_0008836 3300046517 Bacteria 7234
263 Ga0495631_0001552 3300046518 Bacteria 13825
264 Ga0495631_0003595 3300046518 Bacteria 8455
265 Ga0495631_0006038 3300046518 Bacteria 6296
266 Ga0495631_0012025 3300046518 Bacteria 4241
267 Ga0495631_0042775 3300046518 Bacteria 2000
268 Ga0495632_0000190 3300046519 Bacteria 62298
269 Ga0495632_0000744 3300046519 Bacteria 29345
270 Ga0495632_0014017 3300046519 Bacteria 4550
271 Ga0495632_0016640 3300046519 Bacteria 4083
272 Ga0495632_0020023 3300046519 Bacteria 3633
273 Ga0495632_0026074 3300046519 Bacteria 3082
274 Ga0495632_0027784 3300046519 Bacteria 2958
275 Ga0495632_0088530 3300046519 Bacteria 1470
276 Ga0495632_0174059 3300046519 Bacteria 987
277 Ga0495637_0000043 3300046520 Bacteria 112526
278 Ga0495637_0000094 3300046520 Bacteria 70119
279 Ga0495637_0000550 3300046520 Bacteria 26965
280 Ga0495637_0005142 3300046520 Bacteria 6706
281 Ga0495637_0005190 3300046520 Bacteria 6671
282 Ga0495637_0007587 3300046520 Bacteria 5367
283 Ga0495637_0018164 3300046520 Bacteria 3267
284 Ga0495637_0038100 3300046520 Bacteria 2083
285 Ga0495637_0061286 3300046520 Bacteria 1542
286 Ga0495643_0001156 3300046522 Bacteria 25856
287 Ga0495643_0003060 3300046522 Bacteria 12567
288 Ga0495643_0014244 3300046522 Bacteria 4735
289 Ga0495643_0085379 3300046522 Bacteria 1636
290 Ga0495644_0016796 3300046523 Bacteria 2800
291 Ga0495648_0000218 3300046524 Bacteria 65786
292 Ga0495648_0002815 3300046524 Bacteria 15648
293 Ga0495648_0010286 3300046524 Bacteria 7140
294 Ga0495648_0015403 3300046524 Bacteria 5553
295 Ga0495648_0015431 3300046524 Bacteria 5548
296 Ga0495648_0064432 3300046524 Bacteria 2159
297 Ga0495666_0003235 3300046526 Bacteria 8209
298 Ga0495666_0008068 3300046526 Bacteria 5279
299 Ga0495666_0057913 3300046526 Bacteria 1855
300 Ga0495666_0076510 3300046526 Bacteria 1586
301 Ga0495652_0025653 3300046529 Bacteria 5210
302 Ga0495652_0237918 3300046529 Bacteria 1357
303 Ga0495654_0000445 3300046530 Bacteria 35088
304 Ga0495654_0001646 3300046530 Bacteria 15120
305 Ga0495654_0002906 3300046530 Bacteria 10737
306 Ga0495654_0004403 3300046530 Bacteria 8371
307 Ga0495654_0010769 3300046530 Bacteria 4969
308 Ga0495654_0045726 3300046530 Bacteria 2159
309 Ga0495665_0067945 3300046531 Bacteria 1879
310 Ga0495665_0183978 3300046531 Bacteria 1085
311 Ga0495586_0006087 3300046535 Bacteria 6450
312 Ga0495587_0005780 3300046536 Bacteria 8056
313 Ga0495587_0107892 3300046536 Bacteria 1601
314 Ga0495609_0000004 3300046538 Bacteria 697346
315 Ga0495609_0000045 3300046538 Bacteria 159595
316 Ga0495609_0000623 3300046538 Bacteria 27545
317 Ga0495609_0003821 3300046538 Bacteria 8468
318 Ga0495609_0020622 3300046538 Bacteria 3044
319 Ga0495597_0000002 3300046542 Bacteria 420382
320 Ga0495597_0000460 3300046542 Bacteria 34777
321 Ga0495597_0003694 3300046542 Bacteria 8780
322 Ga0495597_0010727 3300046542 Bacteria 4467
323 Ga0495645_0066308 3300046543 Bacteria 2609
324 Ga0495645_0089661 3300046543 Bacteria 2199
325 Ga0495622_0000240 3300046557 Bacteria 42783
326 Ga0495622_0021909 3300046557 Bacteria 2976
327 Ga0495633_0000020 3300046558 Bacteria 227180
328 Ga0495656_0002432 3300046615 Bacteria 6181
329 Ga0495656_0022651 3300046615 Unclassified 2463
330 Ga0495668_0015011 3300046616 Bacteria 4531
331 Ga0495668_0078471 3300046616 Bacteria 1813
332 Ga0495611_0000723 3300046648 Bacteria 18594
333 Ga0495611_0001882 3300046648 Bacteria 9992
334 Ga0495611_0008019 3300046648 Bacteria 4485
335 Ga0495611_0008600 3300046648 Bacteria 4318
336 Ga0495611_0013031 3300046648 Bacteria 3536
337 Ga0495625_0000070 3300046660 Bacteria 167336
338 Ga0495625_0003869 3300046660 Bacteria 14464
339 Ga0495625_0049318 3300046660 Bacteria 3027
340 Ga0495625_0089323 3300046660 Bacteria 2133
341 Ga0495635_0000131 3300046663 Bacteria 45264
342 Ga0495635_0038080 3300046663 Bacteria 3329
343 Ga0495659_0000094 3300046664 Bacteria 39086
344 Ga0495661_0000009 3300046665 Bacteria 291327
345 Ga0495661_0000042 3300046665 Bacteria 150599
346 Ga0495661_0000512 3300046665 Bacteria 40328
347 Ga0495661_0015509 3300046665 Bacteria 5084
348 Ga0495661_0020167 3300046665 Bacteria 4357
349 Ga0495661_0058635 3300046665 Bacteria 2294
350 Ga0495661_0087762 3300046665 Bacteria 1777
351 Ga0495661_0126734 3300046665 Bacteria 1404
352 Ga0495588_0017571 3300046674 Bacteria 3477
353 Ga0495599_0063073 3300046678 Bacteria 2315
354 Ga0495599_0210096 3300046678 Bacteria 1194
355 Ga0495623_0007224 3300046679 Bacteria 7209
356 Ga0495646_0000801 3300046680 Bacteria 17555
357 Ga0495646_0035542 3300046680 Bacteria 3090
358 Ga0495669_0001978 3300046684 Bacteria 8409
359 Ga0495613_0031286 3300046689 Bacteria 3952
360 Ga0495624_0007109 3300046690 Bacteria 7877
361 Ga0495624_0089898 3300046690 Bacteria 1894
362 Ga0495670_0014681 3300046691 Bacteria 3852
363 Ga0495670_0023599 3300046691 Bacteria 3035
364 Ga0495671_0002141 3300046692 Bacteria 12611
365 Ga0495671_0005974 3300046692 Bacteria 7077
366 Ga0495671_0037565 3300046692 Bacteria 2448
367 Ga0495649_0000335 3300046694 Bacteria 40508
368 Ga0495649_0044856 3300046694 Bacteria 2412
369 Ga0495649_0071000 3300046694 Bacteria 1866
370 Ga0495589_0001467 3300046794 Bacteria 13572
371 Ga0495589_0004997 3300046794 Bacteria 7022
372 Ga0495600_0002930 3300046809 Bacteria 9944
373 Ga0495600_0005165 3300046809 Bacteria 7847
374 Ga0495600_0093849 3300046809 Bacteria 1957
375 Ga0495660_0000111 3300046810 Bacteria 87624
376 Ga0495660_0000844 3300046810 Bacteria 22635
377 Ga0495660_0006406 3300046810 Bacteria 6965
378 Ga0495660_0018603 3300046810 Bacteria 3994
379 Ga0495660_0021744 3300046810 Bacteria 3668
380 Ga0495660_0036084 3300046810 Bacteria 2758
381 Ga0495581_0029843 3300047315 Bacteria 3161
382 Ga0495604_0016312 3300047317 Bacteria 5936
383 Ga0495604_0020609 3300047317 Bacteria 5265
384 Ga0495604_0138321 3300047317 Bacteria 1743
385 Ga0495604_0216898 3300047317 Bacteria 1319
386 Ga0495636_0000538 3300047318 Bacteria 13944
387 Ga0495636_0002277 3300047318 Bacteria 7369
388 Ga0495674_0000648 3300047319 Bacteria 32676
389 Ga0495674_0005119 3300047319 Bacteria 12593
390 Ga0495674_0013088 3300047319 Bacteria 7804
391 Ga0495674_0031010 3300047319 Bacteria 4858
392 Ga0495672_0009661 3300047320 Bacteria 6961
393 Ga0495672_0010392 3300047320 Bacteria 6635
394 Ga0495672_0011470 3300047320 Bacteria 6252
395 Ga0495672_0087070 3300047320 Bacteria 1726
396 Ga0495672_0115782 3300047320 Bacteria 1432
397 Ga0495672_0125282 3300047320 Bacteria 1359
398 Ga0495676_0000019 3300047321 Bacteria 167261
399 Ga0495676_0000378 3300047321 Bacteria 36410
400 Ga0495676_0171883 3300047321 Bacteria 1524
401 Ga0495676_0369534 3300047321 Bacteria 956
402 Ga0495680_0005232 3300047322 Bacteria 12250
403 Ga0495680_0104052 3300047322 Bacteria 2112
404 Ga0495683_0000003 3300047323 Bacteria 383992
405 Ga0495683_0000016 3300047323 Bacteria 191396
406 Ga0495683_0006255 3300047323 Bacteria 6514
407 Ga0495683_0036978 3300047323 Bacteria 2477
408 Ga0495687_001532 3300047443 Bacteria 21059
409 Ga0495687_021949 3300047443 Bacteria 3075
410 Ga0495675_0007871 3300047444 Bacteria 6585
411 Ga0495675_0035473 3300047444 Bacteria 3186
412 Ga0495675_0164434 3300047444 Bacteria 1365
413 Ga0495679_000066 3300047446 Bacteria 100641
414 Ga0495679_000847 3300047446 Bacteria 19430
415 Ga0495679_005253 3300047446 Bacteria 5775
416 Ga0495673_0000269 3300047469 Bacteria 71832
417 Ga0495673_0000282 3300047469 Bacteria 68654
418 Ga0495673_0002236 3300047469 Bacteria 13901
419 Ga0495673_0002846 3300047469 Bacteria 11775
420 Ga0495673_0005130 3300047469 Bacteria 7986
421 Ga0495673_0008343 3300047469 Bacteria 5837
422 Ga0495673_0008618 3300047469 Bacteria 5710
423 Ga0495673_0012430 3300047469 Bacteria 4515
424 Ga0495673_0018571 3300047469 Bacteria 3501
425 Ga0495673_0057001 3300047469 Bacteria 1688
426 Ga0495673_0075425 3300047469 Bacteria 1408
427 Ga0495673_0092837 3300047469 Bacteria 1231
428 Ga0495681_0002118 3300047470 Bacteria 14431
429 Ga0495681_0004288 3300047470 Bacteria 9767
430 Ga0495681_0015457 3300047470 Bacteria 4315
431 Ga0495681_0105835 3300047470 Bacteria 1224
432 Ga0495686_0037503 3300047472 Bacteria 3105
433 Ga0495686_0258215 3300047472 Bacteria 976
434 Ga0495593_0004607 3300047673 Bacteria 8196
435 Ga0495593_0013423 3300047673 Bacteria 4673
436 Ga0495602_0082036 3300048088 Bacteria 2708
437 Ga0495614_0016372 3300048089 Bacteria 3227
438 Ga0495626_0000080 3300048091 Bacteria 129112
439 Ga0495626_0000321 3300048091 Bacteria 50472
440 Ga0495626_0001238 3300048091 Bacteria 20977
441 Ga0495626_0011144 3300048091 Bacteria 4766
442 Ga0496100_0044395 3300048903 Bacteria 2847
443 Ga0496100_0213175 3300048903 Bacteria 1413
444 Ga0496101_0047321 3300048904 Bacteria 3087
445 Ga0496102_0151283 3300048905 Unclassified 2181
446 Ga0496102_0459142 3300048905 Bacteria 1195
447 Ga0496102_0720488 3300048905 Bacteria 920
448 Ga0496104_0207313 3300048907 Bacteria 1872
449 Ga0496104_0384813 3300048907 Bacteria 1315
450 Ga0496105_0345302 3300048908 Bacteria 1189
451 Ga0496106_0000079 3300048909 Bacteria 77180
452 Ga0496106_0016604 3300048909 Bacteria 5448
453 Ga0496108_0216103 3300048911 Bacteria 1665
454 Ga0496110_0012764 3300048913 Bacteria 6918
455 Ga0496111_0102875 3300048914 Bacteria 2100
456 Ga0496112_0297958 3300048915 Bacteria 1558
457 Ga0496113_0700001 3300048916 Bacteria 809
458 Ga0496116_0000427 3300048919 Bacteria 59167
459 Ga0496116_0008486 3300048919 Bacteria 8906
460 Ga0496116_0048492 3300048919 Bacteria 2850
461 Ga0496116_0063729 3300048919 Bacteria 2373
462 Ga0496117_0001069 3300048920 Bacteria 41544
463 Ga0496117_0018879 3300048920 Bacteria 5689
464 Ga0496117_0034027 3300048920 Bacteria 3846
465 Ga0496117_0062329 3300048920 Bacteria 2556
466 Ga0496118_0007488 3300048921 Bacteria 11553
467 Ga0496118_0014560 3300048921 Bacteria 7354
468 Ga0496118_0023235 3300048921 Bacteria 5391
469 Ga0496118_0068213 3300048921 Bacteria 2585
470 Ga0496121_0000437 3300048924 Bacteria 82376
471 Ga0496121_0000909 3300048924 Bacteria 53336
472 Ga0496121_0002139 3300048924 Bacteria 31028
473 Ga0496121_0004081 3300048924 Bacteria 20058
474 Ga0496121_0007211 3300048924 Bacteria 13462
475 Ga0496121_0013927 3300048924 Bacteria 8594
476 Ga0496121_0017872 3300048924 Bacteria 7197
477 Ga0496121_0115737 3300048924 Bacteria 2035
478 Ga0496121_0268705 3300048924 Bacteria 1173
479 Ga0496122_0000667 3300048925 Bacteria 69054
480 Ga0496122_0001640 3300048925 Bacteria 34724
481 Ga0496122_0001752 3300048925 Bacteria 33405
482 Ga0496122_0009386 3300048925 Bacteria 10323
483 Ga0496122_0042358 3300048925 Bacteria 3583
484 Ga0496122_0071850 3300048925 Bacteria 2463
485 Ga0496123_0000163 3300048926 Bacteria 133536
486 Ga0496123_0001351 3300048926 Bacteria 34576
487 Ga0496123_0014254 3300048926 Bacteria 6603
488 Ga0496123_0018290 3300048926 Bacteria 5581
489 Ga0496123_0045526 3300048926 Bacteria 2988
490 Ga0496123_0049874 3300048926 Bacteria 2802
491 Ga0496124_0000007 3300048927 Bacteria 883534
492 Ga0496124_0002066 3300048927 Bacteria 27210
493 Ga0496124_0002341 3300048927 Bacteria 25008
494 Ga0496124_0003850 3300048927 Bacteria 17960
495 Ga0496124_0012838 3300048927 Bacteria 8230
496 Ga0496124_0040202 3300048927 Bacteria 4048
497 Ga0496124_0085649 3300048927 Bacteria 2582
498 Ga0496126_0000242 3300048929 Bacteria 117707
499 Ga0496126_0000885 3300048929 Bacteria 52645
500 Ga0496126_0028428 3300048929 Bacteria 5329
501 Ga0496126_0077999 3300048929 Bacteria 2936
502 Ga0496126_0189789 3300048929 Bacteria 1741
503 Ga0495678_000007 3300049459 Bacteria 448039
504 Ga0495678_000303 3300049459 Bacteria 53487
505 Ga0495678_003456 3300049459 Bacteria 9788
506 Ga0495678_003892 3300049459 Bacteria 8957
507 Ga0495678_005361 3300049459 Bacteria 7103
508 Ga0495678_037520 3300049459 Bacteria 1968
509 Ga0495678_123001 3300049459 Bacteria 869
510 Ga0495682_0000051 3300049460 Bacteria 109996
511 Ga0495682_0003542 3300049460 Bacteria 6911
512 Ga0495682_0006536 3300049460 Bacteria 4711
513 Ga0495682_0012050 3300049460 Bacteria 3323
514 Ga0501319_000011 3300049535 Bacteria 7945
515 Ga0501235_014478 3300049669 Bacteria 1738
516 Ga0500618_002193 3300053125 Bacteria 7646
517 Ga0500573_0004057 3300053140 Bacteria 7660
518 2585292821 2582581311 Bacteria 6763856
519 2501071117 2501025501 Bacteria 7768574
520 2501078714 2501025502 Bacteria 9641094
521 2501414034 2501025504 Bacteria 8008976
522 2511089360 2510917013 Bacteria 9951648
523 2511094706 2510917014 Bacteria 8296963
524 2511104447 2510917015 Bacteria 7950052
525 2511324141 2511231016 Bacteria 6704427
526 2511355821 2511231021 Bacteria 7302637
527 2513555926 2513237082 Bacteria 8640282
528 2516017104 2515154189 Bacteria 9629850
529 2599971316 2599185307 Bacteria 6194719
530 2600027675 2599185317 Bacteria 6435722
531 2600356616 2600254930 Bacteria 6431253
532 2600810763 2600255067 Bacteria 6795583
533 2601624792 2600255283 Bacteria 6061572
534 2621300976 2619619299 Bacteria 6649820
535 2624481979 2623620443 Bacteria 6427864
536 2644282504 2643221650 Bacteria 7029547
537 2715750526 2713897148 Bacteria 5883533
538 2738688818 2738541271 Bacteria 5657310
539 2739264871 2738543016 Bacteria 5657564
540 2792836471 2791355137 Bacteria 9654227
541 2817489721 2816332298 Bacteria 6852809
542 2826584666 2826581358 Bacteria 5963467
543 2842331129 2842324504 Bacteria 9364110
544 2842355468 2842348783 Bacteria 9002918
545 2842457915 2842454564 Bacteria 8730687
546 2842816510 2842815866 Bacteria 5947510
547 2842850091 2842849001 Bacteria 5924277
548 2857543885 2857542790 Bacteria 5326616
549 2860340841 2860339153 Bacteria 6846989
550 2860340851 2860339153 Bacteria 6846989
551 2883093832 2883087390 Bacteria 9532701
552 2900636083 2900634093 Bacteria 10263517
553 2902683322 2902682994 Bacteria 8951596
554 2919388530 2919385768 Bacteria 5897293
555 2919490152 2919487758 Bacteria 5929766
556 2919701968 2919697872 Bacteria 6553725
557 2931396595 2931396565 Bacteria 7251677
558 2945935681 2945934425 Bacteria 7444609
559 2974289396 2974289157 Bacteria 6080362
560 3007615606 3007614139 Bacteria 6053559
561 3007624872 3007619802 Bacteria 6411688
562 642422939 641736151 Bacteria 7477263
563 642594064 642555112 Bacteria 8676562
564 642620457 642555113 Bacteria 8214658
565 8019782285 8019775933 Bacteria 6858656
566 MRS2a_Contig_7381
567 MRS2a_Contig_8530
568 MRS2a_Contig_9777
569 JGI24735J21928_10010979
570 JGI25162J39368_1000216
571 JGI25163J39215_1000422
572 JGI25164J39214_1000176
573 JGI25165J46597_1000306
574 rootH1_10069774
575 JGI25160J50197_1029645
576 Ga0055536_1000202
577 Ga0065714_10091474
578 Ga0065714_10133796
579 Ga0065712_10068210
580 Ga0070658_10491252
581 Ga0070676_10058900
582 Ga0070690_100083460
583 Ga0070670_100002657
584 Ga0070670_100106293
585 Ga0068869_100100353
586 Ga0070666_10071070
587 Ga0070660_100044536
588 Ga0070675_100089144
589 Ga0070667_100138695
590 Ga0070662_100059591
591 Ga0070662_100295519
592 Ga0070681_10749516
593 Ga0070672_100082651
594 Ga0068855_100249332
595 Ga0070664_100009019
596 Ga0068857_100106154
597 Ga0068854_100248003
598 Ga0068856_100036828
599 Ga0068852_100172943
600 Ga0068859_100124974
601 Ga0068864_100158645
602 Ga0068863_100045354
603 Ga0068860_100031611
604 Ga0068862_100281479
605 Ga0097621_100066710
606 Ga0097620_100124973
607 Ga0079104_1002868
608 Ga0105251_10005072
609 Ga0105251_10007371
610 Ga0105244_10000547
611 Ga0105244_10002169
612 Ga0105244_10002784
613 Ga0105244_10005981
614 Ga0105244_10006623
615 Ga0105244_10100368
616 Ga0105244_10100380
617 Ga0105250_10000802
618 Ga0105240_10423946
619 Ga0105243_10597356
620 Ga0105241_10046171
621 Ga0105239_10045370
622 Ga0105246_10091664
623 Ga0157373_10000705
624 Ga0157373_10004133
625 Ga0157373_10004773
626 Ga0157373_10011757
627 Ga0157373_10213034
628 Ga0157373_10416359
629 Ga0157371_10006831
630 Ga0157371_10041487
631 Ga0157370_10003320
632 Ga0157370_10012282
633 Ga0157369_10002104
634 Ga0157369_10023692
635 Ga0157369_10486539
636 Ga0163162_10000188
637 Ga0163162_10000307
638 Ga0157375_10130021
639 Ga0182008_10004199
640 Ga0182008_10008909
641 Ga0182008_10034396
642 Ga0157376_10128188
643 Ga0182006_1033133
644 Ga0182007_10000633
645 Ga0182007_10001455
646 Ga0182007_10013951
647 Ga0182007_10029106
648 Ga0182005_1023061
649 Ga0182005_1023614
650 Ga0163161_10000482
651 Ga0163161_10010145
652 Ga0163161_10213657
653 Ga0163161_10417132
654 Ga0209435_106156
655 Ga0209760_100011
656 Ga0207427_100008
657 Ga0209437_100014
658 Ga0209759_1000711
659 Ga0209233_1000008
660 Ga0209676_1000270
661 Ga0207426_1001782
662 Ga0207696_1000097
663 Ga0207655_1000706
664 Ga0207655_1000711
665 Ga0207655_1001196
666 Ga0207655_1002594
667 Ga0207655_1002966
668 Ga0207655_1005353
669 Ga0207713_1022484
670 Ga0207713_1032383
671 Ga0207680_10044008
672 Ga0207647_10057009
673 Ga0207695_10181236
674 Ga0207671_10242695
675 Ga0207657_10023926
676 Ga0207649_10086194
677 Ga0207650_10000186
678 Ga0207706_10068107
679 Ga0207691_10101520
680 Ga0207689_10337191
681 Ga0207674_10030426
682 Ga0209281_1001531
683 Ga0209970_1000551
684 Ga0209974_10020176
685 Ga0268265_10808321
686 Ga0268264_10028245
687 Ga0316178_1100236
688 Ga0307408_100001237
689 Ga0307408_100005313
690 Ga0307405_10104871
691 Ga0307405_10343442
692 Ga0307406_10661634
693 Ga0307412_10043174
694 Ga0307411_10035891
695 Ga0395905_0006954
696 Ga0439438_000292
697 Ga0439438_000826
698 Ga0439447_005596
699 Ga0439466_0000770
700 Ga0439466_0003280
701 Ga0439432_001340
702 Ga0439432_003687
703 Ga0439451_000014
704 Ga0439451_001878
705 Ga0439451_004135
706 Ga0439452_000198
707 Ga0439452_000355
708 Ga0439463_000496
709 Ga0439463_000546
710 Ga0439463_002161
711 Ga0439463_002372
712 Ga0439463_005119
713 Ga0450911_000155
714 Ga0450911_006345
715 Ga0450900_000072
716 Ga0450903_015187
717 Ga0450904_000887
718 Ga0450906_000034
719 Ga0450908_031229
720 Ga0439460_0000080
721 Ga0439460_0003531
722 Ga0439460_0046645
723 Ga0439440_0000005
724 Ga0466978_0312335
725 Ga0466957_0219247
726 Ga0466967_0374407
727 Ga0495617_018191
728 Ga0495617_030973
729 Ga0495627_000058
730 Ga0495627_000134
731 Ga0495627_000169
732 Ga0495627_006395
733 Ga0495590_0010728
734 Ga0495590_0108756
735 Ga0495591_000040
736 Ga0495591_000078
737 Ga0495591_000906
738 Ga0495591_002439
739 Ga0495591_002699
740 Ga0495629_0021044
741 Ga0495629_0025925
742 Ga0495629_0075647
743 Ga0495651_0074929
744 Ga0495653_0355902
745 Ga0495650_0000388
746 Ga0495650_0004420
747 Ga0495650_0005056
748 Ga0495650_0007552
749 Ga0495650_0014920
750 Ga0495580_0004548
751 Ga0495580_0005234
752 Ga0495580_0008357
753 Ga0495580_0052884
754 Ga0495580_0110658
755 Ga0495582_0086513
756 Ga0495605_0000007
757 Ga0495605_0000017
758 Ga0495605_0001122
759 Ga0495605_0001446
760 Ga0495605_0001706
761 Ga0495605_0003690
762 Ga0495605_0014594
763 Ga0495605_0019100
764 Ga0495605_0034876
765 Ga0495605_0091818
766 Ga0495605_0107856
767 Ga0495639_0000020
768 Ga0495639_0002251
769 Ga0495662_0071705
770 Ga0495664_0003274
771 Ga0495664_0012857
772 Ga0495664_0128498
773 Ga0495584_0001338
774 Ga0495584_0004876
775 Ga0495584_0131801
776 Ga0495585_0000900
777 Ga0495585_0062181
778 Ga0495585_0076862
779 Ga0495585_0209215
780 Ga0495594_0011357
781 Ga0495594_0052918
782 Ga0495596_0008778
783 Ga0495607_0000022
784 Ga0495607_0000171
785 Ga0495607_0000588
786 Ga0495607_0000882
787 Ga0495607_0002164
788 Ga0495607_0002976
789 Ga0495607_0004047
790 Ga0495607_0005383
791 Ga0495607_0007023
792 Ga0495607_0025425
793 Ga0495607_0044748
794 Ga0495607_0058789
795 Ga0495607_0063128
796 Ga0495607_0139122
797 Ga0495607_0253261
798 Ga0495583_0000007
799 Ga0495583_0000499
800 Ga0495583_0000692
801 Ga0495583_0001320
802 Ga0495583_0002912
803 Ga0495583_0003049
804 Ga0495583_0003189
805 Ga0495583_0007816
806 Ga0495606_0000362
807 Ga0495606_0003398
808 Ga0495606_0003680
809 Ga0495606_0005555
810 Ga0495606_0023465
811 Ga0495606_0024645
812 Ga0495610_0012720
813 Ga0495610_0016838
814 Ga0495610_0041749
815 Ga0495616_0013026
816 Ga0495616_0092327
817 Ga0495618_0242429
818 Ga0495620_0000129
819 Ga0495620_0002500
820 Ga0495620_0002804
821 Ga0495620_0004982
822 Ga0495620_0034599
823 Ga0495620_0049998
824 Ga0495628_0011932
825 Ga0495628_0012253
826 Ga0495630_0001333
827 Ga0495630_0008836
828 Ga0495631_0001552
829 Ga0495631_0003595
830 Ga0495631_0006038
831 Ga0495631_0012025
832 Ga0495631_0042775
833 Ga0495632_0000190
834 Ga0495632_0000744
835 Ga0495632_0014017
836 Ga0495632_0016640
837 Ga0495632_0020023
838 Ga0495632_0026074
839 Ga0495632_0027784
840 Ga0495632_0088530
841 Ga0495632_0174059
842 Ga0495637_0000043
843 Ga0495637_0000094
844 Ga0495637_0000550
845 Ga0495637_0005142
846 Ga0495637_0005190
847 Ga0495637_0007587
848 Ga0495637_0018164
849 Ga0495637_0038100
850 Ga0495637_0061286
851 Ga0495643_0001156
852 Ga0495643_0003060
853 Ga0495643_0014244
854 Ga0495643_0085379
855 Ga0495644_0016796
856 Ga0495648_0000218
857 Ga0495648_0002815
858 Ga0495648_0010286
859 Ga0495648_0015403
860 Ga0495648_0015431
861 Ga0495648_0064432
862 Ga0495666_0003235
863 Ga0495666_0008068
864 Ga0495666_0057913
865 Ga0495666_0076510
866 Ga0495652_0025653
867 Ga0495652_0237918
868 Ga0495654_0000445
869 Ga0495654_0001646
870 Ga0495654_0002906
871 Ga0495654_0004403
872 Ga0495654_0010769
873 Ga0495654_0045726
874 Ga0495665_0067945
875 Ga0495665_0183978
876 Ga0495586_0006087
877 Ga0495587_0005780
878 Ga0495587_0107892
879 Ga0495609_0000004
880 Ga0495609_0000045
881 Ga0495609_0000623
882 Ga0495609_0003821
883 Ga0495609_0020622
884 Ga0495597_0000002
885 Ga0495597_0000460
886 Ga0495597_0003694
887 Ga0495597_0010727
888 Ga0495645_0066308
889 Ga0495645_0089661
890 Ga0495622_0000240
891 Ga0495622_0021909
892 Ga0495633_0000020
893 Ga0495656_0002432
894 Ga0495656_0022651
895 Ga0495668_0015011
896 Ga0495668_0078471
897 Ga0495611_0000723
898 Ga0495611_0001882
899 Ga0495611_0008019
900 Ga0495611_0008600
901 Ga0495611_0013031
902 Ga0495625_0000070
903 Ga0495625_0003869
904 Ga0495625_0049318
905 Ga0495625_0089323
906 Ga0495635_0000131
907 Ga0495635_0038080
908 Ga0495659_0000094
909 Ga0495661_0000009
910 Ga0495661_0000042
911 Ga0495661_0000512
912 Ga0495661_0015509
913 Ga0495661_0020167
914 Ga0495661_0058635
915 Ga0495661_0087762
916 Ga0495661_0126734
917 Ga0495588_0017571
918 Ga0495599_0063073
919 Ga0495599_0210096
920 Ga0495623_0007224
921 Ga0495646_0000801
922 Ga0495646_0035542
923 Ga0495669_0001978
924 Ga0495613_0031286
925 Ga0495624_0007109
926 Ga0495624_0089898
927 Ga0495670_0014681
928 Ga0495670_0023599
929 Ga0495671_0002141
930 Ga0495671_0005974
931 Ga0495671_0037565
932 Ga0495649_0000335
933 Ga0495649_0044856
934 Ga0495649_0071000
935 Ga0495589_0001467
936 Ga0495589_0004997
937 Ga0495600_0002930
938 Ga0495600_0005165
939 Ga0495600_0093849
940 Ga0495660_0000111
941 Ga0495660_0000844
942 Ga0495660_0006406
943 Ga0495660_0018603
944 Ga0495660_0021744
945 Ga0495660_0036084
946 Ga0495581_0029843
947 Ga0495604_0016312
948 Ga0495604_0020609
949 Ga0495604_0138321
950 Ga0495604_0216898
951 Ga0495636_0000538
952 Ga0495636_0002277
953 Ga0495674_0000648
954 Ga0495674_0005119
955 Ga0495674_0013088
956 Ga0495674_0031010
957 Ga0495672_0009661
958 Ga0495672_0010392
959 Ga0495672_0011470
960 Ga0495672_0087070
961 Ga0495672_0115782
962 Ga0495672_0125282
963 Ga0495676_0000019
964 Ga0495676_0000378
965 Ga0495676_0171883
966 Ga0495676_0369534
967 Ga0495680_0005232
968 Ga0495680_0104052
969 Ga0495683_0000003
970 Ga0495683_0000016
971 Ga0495683_0006255
972 Ga0495683_0036978
973 Ga0495687_001532
974 Ga0495687_021949
975 Ga0495675_0007871
976 Ga0495675_0035473
977 Ga0495675_0164434
978 Ga0495679_000066
979 Ga0495679_000847
980 Ga0495679_005253
981 Ga0495673_0000269
982 Ga0495673_0000282
983 Ga0495673_0002236
984 Ga0495673_0002846
985 Ga0495673_0005130
986 Ga0495673_0008343
987 Ga0495673_0008618
988 Ga0495673_0012430
989 Ga0495673_0018571
990 Ga0495673_0057001
991 Ga0495673_0075425
992 Ga0495673_0092837
993 Ga0495681_0002118
994 Ga0495681_0004288
995 Ga0495681_0015457
996 Ga0495681_0105835
997 Ga0495686_0037503
998 Ga0495686_0258215
999 Ga0495593_0004607
1000 Ga0495593_0013423
1001 Ga0495602_0082036
1002 Ga0495614_0016372
1003 Ga0495626_0000080
1004 Ga0495626_0000321
1005 Ga0495626_0001238
1006 Ga0495626_0011144
1007 Ga0496100_0044395
1008 Ga0496100_0213175
1009 Ga0496101_0047321
1010 Ga0496102_0151283
1011 Ga0496102_0459142
1012 Ga0496102_0720488
1013 Ga0496104_0207313
1014 Ga0496104_0384813
1015 Ga0496105_0345302
1016 Ga0496106_0000079
1017 Ga0496106_0016604
1018 Ga0496108_0216103
1019 Ga0496110_0012764
1020 Ga0496111_0102875
1021 Ga0496112_0297958
1022 Ga0496113_0700001
1023 Ga0496116_0000427
1024 Ga0496116_0008486
1025 Ga0496116_0048492
1026 Ga0496116_0063729
1027 Ga0496117_0001069
1028 Ga0496117_0018879
1029 Ga0496117_0034027
1030 Ga0496117_0062329
1031 Ga0496118_0007488
1032 Ga0496118_0014560
1033 Ga0496118_0023235
1034 Ga0496118_0068213
1035 Ga0496121_0000437
1036 Ga0496121_0000909
1037 Ga0496121_0002139
1038 Ga0496121_0004081
1039 Ga0496121_0007211
1040 Ga0496121_0013927
1041 Ga0496121_0017872
1042 Ga0496121_0115737
1043 Ga0496121_0268705
1044 Ga0496122_0000667
1045 Ga0496122_0001640
1046 Ga0496122_0001752
1047 Ga0496122_0009386
1048 Ga0496122_0042358
1049 Ga0496122_0071850
1050 Ga0496123_0000163
1051 Ga0496123_0001351
1052 Ga0496123_0014254
1053 Ga0496123_0018290
1054 Ga0496123_0045526
1055 Ga0496123_0049874
1056 Ga0496124_0000007
1057 Ga0496124_0002066
1058 Ga0496124_0002341
1059 Ga0496124_0003850
1060 Ga0496124_0012838
1061 Ga0496124_0040202
1062 Ga0496124_0085649
1063 Ga0496126_0000242
1064 Ga0496126_0000885
1065 Ga0496126_0028428
1066 Ga0496126_0077999
1067 Ga0496126_0189789
1068 Ga0495678_000007
1069 Ga0495678_000303
1070 Ga0495678_003456
1071 Ga0495678_003892
1072 Ga0495678_005361
1073 Ga0495678_037520
1074 Ga0495678_123001
1075 Ga0495682_0000051
1076 Ga0495682_0003542
1077 Ga0495682_0006536
1078 Ga0495682_0012050
1079 Ga0501319_000011
1080 Ga0501235_014478
1081 Ga0500618_002193
1082 Ga0500573_0004057
1083 2585292821
1084 2501071117
1085 2501078714
1086 2501414034
1087 2511089360
1088 2511094706
1089 2511104447
1090 2511324141
1091 2511355821
1092 2513555926
1093 2516017104
1094 2599971316
1095 2600027675
1096 2600356616
1097 2600810763
1098 2601624792
1099 2621300976
1100 2624481979
1101 2644282504
1102 2715750526
1103 2738688818
1104 2739264871
1105 2792836471
1106 2817489721
1107 2826584666
1108 2842331129
1109 2842355468
1110 2842457915
1111 2842816510
1112 2842850091
1113 2857543885
1114 2860340841
1115 2860340851
1116 2883093832
1117 2900636083
1118 2902683322
1119 2919388530
1120 2919490152
1121 2919701968
1122 2931396595
1123 2945935681
1124 2974289396
1125 3007615606
1126 3007624872
1127 642422939
1128 642594064
1129 642620457
1130 8019782285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

1

189

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

5

211

0.91

PF08659

KR

KR domain

1

175

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cdh-assembly1.cif.gz_G architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9199 1 224
8g93-assembly1.cif.gz_A crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9182 2 234
3d5q-assembly3.cif.gz_C crystal structure of 11b-hsd1 in complex with triazole inhibitor 0.9171 2 221
8g9v-assembly3.cif.gz_F crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.917 2 230
3dwf-assembly1.cif.gz_B crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e 0.9163 2 221
ID Description Score Start End Superfamily
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 4 243 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9521 4 243 3.40.50.720
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9472 2 243 3.40.50.720
af_Q8N3Y7_32_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9359 2 239 3.40.50.720
af_P9WGR7_3_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9344 2 240 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M4FVC3-F1-model_v4 deleted 0.9989 1 168
AF-A0A3M3WRQ3-F1-model_v4 Integral membrane protein 0.9986 1 183 GO:0005886
GO:0016491
AF-A0A535H5X8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9963 3 183 GO:0016020
GO:0016491
AF-A0A423L5U2-F1-model_v4 Short-chain dehydrogenase 0.9957 1 246 GO:0016020
GO:0016491
AF-A0A2R7T8Q7-F1-model_v4 deleted 0.994 1 155

Map