F464464
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 346 | 535 | 744 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2773857933|2774902763 |
| Length | 872 |
| Sequence | DGAAGGVDEGQPGSCRRDASGPPSDASSGLARSPLPAMAMAGHGGXRRGNDHDDAGYDDTRYDDARYDTRYSEGGGYPETAYRDGGRDRGEHTAAQHDRAERGTTGQSGAERDAGGQDAPASSPPSLLVDTAELERLVNGSHHDPHHILGAHPHGDWTIVRALRPDAVGVVVITENERFECTRLHTAGVFAVALPTGAVPGYRLEVQYCDATHVVDDPYRHLPTLGEMDLHLIGEGRHEQLWKALGARVRRYPDSTGTAEVSGVGFAXWAPNARGVRVVGDFDFWDGRAYPMRSLGATGVWELFVPGIGAGCRYKYEILGFDGVWRQKADPLALHTENPPATASVVFESDYTWSDEAWLARRRRTAWHAMPISVYEVHLGSWRRGLSYRQLATELVAHVREMGFTHVELLPVAEHPFGGSWGYQVSAYYAPTSRFGDPDDFRYLVDQLHQAGIGVIVDWVPAHFPRDVWALGRFDGTPLYEHPDPRRGEQPDWGTYVFDFGRPEVRNFLVANAVYWFEEFHIDGLRVDAVASMLYLDYSRAEGEWIPNIHGGRENLDAVSFLQETNATVYRRVPGVMMIAEESTAWPGVTRPTHLGGLGFGFKWNMGWMHDTLDYLSRAPVFRVYHHHQMTFSMMYAYSENFVLPLSHDEVVHXKGSLLRKMPGDRWQQLANLRALYGYMWAHPGKQLLFMGGEFAQEAEWSEARSLDWWHLDDPDHRGVATLLKDLNGAYRATPALWERDISPEGFSWIDANDAENNVFSFLRWAADPTADPAGGPAGGPAASTATSGRVLACVTNFSGVPHTGYQLGLPFAGRWRELINTDATEYAGSGLGNLGSVLAVEATRHNQPASVTLTLPALSTLWLCYEGAAQN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 2 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 3 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 4 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 5 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 6 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 7 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 8 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 9 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 10 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 11 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 12 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 13 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 14 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 15 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 16 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 17 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 18 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 19 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 20 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 21 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 22 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 23 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 24 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 25 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 26 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 27 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 28 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 29 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 212 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 220 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 224 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 225 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 241 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 244 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 345 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 346 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.93 |
| Metatranscriptomes | 1.59 |
| Isolates | 5.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.71 |
| Nodule | 2.3 |
| Rhizoplane | 5.48 |
| Rhizosphere | 84.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10000801 | 3300005327 | Bacteria | 26940 |
| 2 | Ga0070658_10001237 | 3300005327 | Bacteria | 21904 |
| 3 | Ga0070658_10035027 | 3300005327 | Bacteria | 4042 |
| 4 | Ga0070683_100002373 | 3300005329 | Bacteria | 14950 |
| 5 | Ga0070683_100046666 | 3300005329 | Bacteria | 4003 |
| 6 | Ga0070683_100051744 | 3300005329 | Bacteria | 3803 |
| 7 | Ga0070690_100000330 | 3300005330 | Bacteria | 24199 |
| 8 | Ga0070670_100028489 | 3300005331 | Bacteria | 4807 |
| 9 | Ga0070677_10000074 | 3300005333 | Bacteria | 31454 |
| 10 | Ga0068869_100000496 | 3300005334 | Bacteria | 21863 |
| 11 | Ga0068869_100001048 | 3300005334 | Bacteria | 16110 |
| 12 | Ga0070666_10002219 | 3300005335 | Bacteria | 11744 |
| 13 | Ga0070666_10002930 | 3300005335 | Bacteria | 10319 |
| 14 | Ga0070682_100001669 | 3300005337 | Bacteria | 12348 |
| 15 | Ga0068868_100000319 | 3300005338 | Bacteria | 32296 |
| 16 | Ga0070660_100000981 | 3300005339 | Bacteria | 19095 |
| 17 | Ga0070689_100001499 | 3300005340 | Bacteria | 14880 |
| 18 | Ga0070687_100000001 | 3300005343 | Bacteria | 110332 |
| 19 | Ga0070661_100000069 | 3300005344 | Bacteria | 83366 |
| 20 | Ga0070661_100032950 | 3300005344 | Bacteria | 3753 |
| 21 | Ga0070692_10005633 | 3300005345 | Bacteria | 5369 |
| 22 | Ga0070668_100001308 | 3300005347 | Bacteria | 17812 |
| 23 | Ga0070669_100001342 | 3300005353 | Bacteria | 17727 |
| 24 | Ga0070675_100000424 | 3300005354 | Bacteria | 28747 |
| 25 | Ga0070671_100010605 | 3300005355 | Bacteria | 7398 |
| 26 | Ga0070671_100010643 | 3300005355 | Bacteria | 7383 |
| 27 | Ga0070674_100002261 | 3300005356 | Bacteria | 10628 |
| 28 | Ga0070673_100003308 | 3300005364 | Bacteria | 10013 |
| 29 | Ga0070659_100000761 | 3300005366 | Bacteria | 23410 |
| 30 | Ga0070659_100001237 | 3300005366 | Bacteria | 18542 |
| 31 | Ga0070667_100003402 | 3300005367 | Bacteria | 13547 |
| 32 | Ga0070667_100011129 | 3300005367 | Bacteria | 7441 |
| 33 | Ga0070667_100049214 | 3300005367 | Bacteria | 3549 |
| 34 | Ga0070709_10000636 | 3300005434 | Bacteria | 20015 |
| 35 | Ga0070709_10008912 | 3300005434 | Bacteria | 5523 |
| 36 | Ga0070709_10015554 | 3300005434 | Bacteria | 4332 |
| 37 | Ga0070714_100000106 | 3300005435 | Bacteria | 70067 |
| 38 | Ga0070713_100031239 | 3300005436 | Bacteria | 4240 |
| 39 | Ga0070713_100041209 | 3300005436 | Bacteria | 3761 |
| 40 | Ga0070710_10000359 | 3300005437 | Bacteria | 21439 |
| 41 | Ga0070711_100003675 | 3300005439 | Bacteria | 8980 |
| 42 | Ga0070705_100000880 | 3300005440 | Bacteria | 16799 |
| 43 | Ga0070700_100000032 | 3300005441 | Bacteria | 114995 |
| 44 | Ga0070708_100004383 | 3300005445 | Bacteria | 11086 |
| 45 | Ga0070663_100006471 | 3300005455 | Bacteria | 7049 |
| 46 | Ga0070663_100006716 | 3300005455 | Bacteria | 6942 |
| 47 | Ga0070663_100009689 | 3300005455 | Bacteria | 5976 |
| 48 | Ga0070678_100001632 | 3300005456 | Bacteria | 12002 |
| 49 | Ga0070678_100004156 | 3300005456 | Bacteria | 8161 |
| 50 | Ga0070662_100000847 | 3300005457 | Bacteria | 18783 |
| 51 | Ga0070681_10000009 | 3300005458 | Bacteria | 146582 |
| 52 | Ga0068867_100015425 | 3300005459 | Bacteria | 5419 |
| 53 | Ga0070685_10004058 | 3300005466 | Bacteria | 7396 |
| 54 | Ga0070706_100003956 | 3300005467 | Bacteria | 14432 |
| 55 | Ga0070706_100005676 | 3300005467 | Bacteria | 11865 |
| 56 | Ga0070706_100051660 | 3300005467 | Bacteria | 3794 |
| 57 | Ga0070707_100000256 | 3300005468 | Bacteria | 53538 |
| 58 | Ga0070707_100005079 | 3300005468 | Bacteria | 12333 |
| 59 | Ga0070698_100000292 | 3300005471 | Bacteria | 50989 |
| 60 | Ga0070698_100000333 | 3300005471 | Bacteria | 48484 |
| 61 | Ga0070698_100002789 | 3300005471 | Bacteria | 19238 |
| 62 | Ga0070698_100006885 | 3300005471 | Bacteria | 12316 |
| 63 | Ga0070698_100027060 | 3300005471 | Bacteria | 5963 |
| 64 | Ga0070699_100011216 | 3300005518 | Bacteria | 7743 |
| 65 | Ga0070679_100000107 | 3300005530 | Bacteria | 65501 |
| 66 | Ga0070679_100044375 | 3300005530 | Bacteria | 4429 |
| 67 | Ga0068853_100000106 | 3300005539 | Bacteria | 56375 |
| 68 | Ga0068853_100066537 | 3300005539 | Bacteria | 3129 |
| 69 | Ga0070672_100003652 | 3300005543 | Bacteria | 9994 |
| 70 | Ga0070686_100000313 | 3300005544 | Bacteria | 31975 |
| 71 | Ga0070695_100007897 | 3300005545 | Bacteria | 6298 |
| 72 | Ga0070693_100001131 | 3300005547 | Bacteria | 11958 |
| 73 | Ga0070665_100006766 | 3300005548 | Bacteria | 11651 |
| 74 | Ga0068855_100006655 | 3300005563 | Bacteria | 14037 |
| 75 | Ga0070664_100001951 | 3300005564 | Bacteria | 16596 |
| 76 | Ga0070664_100011125 | 3300005564 | Bacteria | 7297 |
| 77 | Ga0068857_100010932 | 3300005577 | Bacteria | 7900 |
| 78 | Ga0068854_100001733 | 3300005578 | Bacteria | 13306 |
| 79 | Ga0068856_100000478 | 3300005614 | Bacteria | 44261 |
| 80 | Ga0068856_100016752 | 3300005614 | Bacteria | 7100 |
| 81 | Ga0068856_100023338 | 3300005614 | Bacteria | 6014 |
| 82 | Ga0070702_100001528 | 3300005615 | Bacteria | 9527 |
| 83 | Ga0068852_100001697 | 3300005616 | Bacteria | 15015 |
| 84 | Ga0068852_100005201 | 3300005616 | Bacteria | 9280 |
| 85 | Ga0068852_100015733 | 3300005616 | Bacteria | 5880 |
| 86 | Ga0068859_100000861 | 3300005617 | Bacteria | 30912 |
| 87 | Ga0068859_100028711 | 3300005617 | Bacteria | 5578 |
| 88 | Ga0068859_100112361 | 3300005617 | Bacteria | 2787 |
| 89 | Ga0068864_100003341 | 3300005618 | Bacteria | 13261 |
| 90 | Ga0068866_10000470 | 3300005718 | Bacteria | 18469 |
| 91 | Ga0068861_100006435 | 3300005719 | Bacteria | 8002 |
| 92 | Ga0068851_10000340 | 3300005834 | Bacteria | 21099 |
| 93 | Ga0068870_10000085 | 3300005840 | Bacteria | 30429 |
| 94 | Ga0068870_10005205 | 3300005840 | Bacteria | 5664 |
| 95 | Ga0068863_100000471 | 3300005841 | Bacteria | 41177 |
| 96 | Ga0068863_100000697 | 3300005841 | Bacteria | 33736 |
| 97 | Ga0068863_100003940 | 3300005841 | Bacteria | 14667 |
| 98 | Ga0068858_100000032 | 3300005842 | Bacteria | 142794 |
| 99 | Ga0068858_100008158 | 3300005842 | Bacteria | 10067 |
| 100 | Ga0068858_100033012 | 3300005842 | Bacteria | 4807 |
| 101 | Ga0068860_100001788 | 3300005843 | Bacteria | 22892 |
| 102 | Ga0068862_100000025 | 3300005844 | Bacteria | 197313 |
| 103 | Ga0068862_100007334 | 3300005844 | Bacteria | 9158 |
| 104 | Ga0081455_10013968 | 3300005937 | Bacteria | 7893 |
| 105 | Ga0081540_1000162 | 3300005983 | Bacteria | 68999 |
| 106 | Ga0081540_1000250 | 3300005983 | Bacteria | 56639 |
| 107 | Ga0081540_1000470 | 3300005983 | Bacteria | 39784 |
| 108 | Ga0081540_1000939 | 3300005983 | Bacteria | 26205 |
| 109 | Ga0081539_10037163 | 3300005985 | Bacteria | 2903 |
| 110 | Ga0070717_10019169 | 3300006028 | Bacteria | 5361 |
| 111 | Ga0075363_100016552 | 3300006048 | Bacteria | 3643 |
| 112 | Ga0070715_10002273 | 3300006163 | Bacteria | 5842 |
| 113 | Ga0070716_100006426 | 3300006173 | Bacteria | 5740 |
| 114 | Ga0070716_100019306 | 3300006173 | Bacteria | 3561 |
| 115 | Ga0070716_100021851 | 3300006173 | Bacteria | 3375 |
| 116 | Ga0068871_100019675 | 3300006358 | Bacteria | 5158 |
| 117 | Ga0075428_100049902 | 3300006844 | Bacteria | 4591 |
| 118 | Ga0075430_100057171 | 3300006846 | Bacteria | 3281 |
| 119 | Ga0075433_10009007 | 3300006852 | Bacteria | 7970 |
| 120 | Ga0075434_100047739 | 3300006871 | Bacteria | 4248 |
| 121 | Ga0075429_100058487 | 3300006880 | Bacteria | 3357 |
| 122 | Ga0075436_100006150 | 3300006914 | Bacteria | 8240 |
| 123 | Ga0075436_100009887 | 3300006914 | Bacteria | 6524 |
| 124 | Ga0097620_100000861 | 3300006931 | Bacteria | 30912 |
| 125 | Ga0097620_100028711 | 3300006931 | Bacteria | 5578 |
| 126 | Ga0097620_100112361 | 3300006931 | Bacteria | 2787 |
| 127 | Ga0075435_100016314 | 3300007076 | Bacteria | 5599 |
| 128 | Ga0105251_10010655 | 3300009011 | Bacteria | 5310 |
| 129 | Ga0105240_10017695 | 3300009093 | Bacteria | 9597 |
| 130 | Ga0105245_10001442 | 3300009098 | Bacteria | 21578 |
| 131 | Ga0105245_10027732 | 3300009098 | Bacteria | 4990 |
| 132 | Ga0105247_10000199 | 3300009101 | Bacteria | 58949 |
| 133 | Ga0105247_10001144 | 3300009101 | Bacteria | 19661 |
| 134 | Ga0105247_10002920 | 3300009101 | Bacteria | 11372 |
| 135 | Ga0114129_10008499 | 3300009147 | Bacteria | 14634 |
| 136 | Ga0105243_10002605 | 3300009148 | Bacteria | 15039 |
| 137 | Ga0105243_10073198 | 3300009148 | Bacteria | 2776 |
| 138 | Ga0105241_10004557 | 3300009174 | Bacteria | 10251 |
| 139 | Ga0105241_10014214 | 3300009174 | Bacteria | 5831 |
| 140 | Ga0105241_10039580 | 3300009174 | Bacteria | 3557 |
| 141 | Ga0105242_10000388 | 3300009176 | Bacteria | 34963 |
| 142 | Ga0105248_10000044 | 3300009177 | Bacteria | 166533 |
| 143 | Ga0105248_10000603 | 3300009177 | Bacteria | 40905 |
| 144 | Ga0105248_10031957 | 3300009177 | Bacteria | 5882 |
| 145 | Ga0105248_10099456 | 3300009177 | Bacteria | 3278 |
| 146 | Ga0105237_10000276 | 3300009545 | Bacteria | 71919 |
| 147 | Ga0105238_10000302 | 3300009551 | Bacteria | 53964 |
| 148 | Ga0105249_10001178 | 3300009553 | Bacteria | 23152 |
| 149 | Ga0105239_10000686 | 3300010375 | Bacteria | 48254 |
| 150 | Ga0105239_10102606 | 3300010375 | Bacteria | 3165 |
| 151 | Ga0105246_10001043 | 3300011119 | Bacteria | 15978 |
| 152 | Ga0105246_10004714 | 3300011119 | Bacteria | 8301 |
| 153 | Ga0157371_10000234 | 3300013102 | Bacteria | 79682 |
| 154 | Ga0157369_10000365 | 3300013105 | Bacteria | 60316 |
| 155 | Ga0157369_10000755 | 3300013105 | Bacteria | 41695 |
| 156 | Ga0157369_10038585 | 3300013105 | Bacteria | 5223 |
| 157 | Ga0157369_10041708 | 3300013105 | Bacteria | 5008 |
| 158 | Ga0157369_10064360 | 3300013105 | Bacteria | 3949 |
| 159 | Ga0157374_10012474 | 3300013296 | Bacteria | 7396 |
| 160 | Ga0157378_10000488 | 3300013297 | Bacteria | 37515 |
| 161 | Ga0157378_10010038 | 3300013297 | Bacteria | 8252 |
| 162 | Ga0163162_10001380 | 3300013306 | Bacteria | 22602 |
| 163 | Ga0157372_10000057 | 3300013307 | Bacteria | 125915 |
| 164 | Ga0157372_10057691 | 3300013307 | Bacteria | 4340 |
| 165 | Ga0157375_10018083 | 3300013308 | Bacteria | 6385 |
| 166 | Ga0163163_10007989 | 3300014325 | Bacteria | 9362 |
| 167 | Ga0182008_10008911 | 3300014497 | Bacteria | 5442 |
| 168 | Ga0157377_10000288 | 3300014745 | Bacteria | 24011 |
| 169 | Ga0157379_10000247 | 3300014968 | Bacteria | 42343 |
| 170 | Ga0157376_10000866 | 3300014969 | Bacteria | 19857 |
| 171 | Ga0197907_10937645 | 3300020069 | Bacteria | 4551 |
| 172 | Ga0206349_1910650 | 3300020075 | Bacteria | 4343 |
| 173 | Ga0206350_10028680 | 3300020080 | Bacteria | 4336 |
| 174 | Ga0206353_10006789 | 3300020082 | Bacteria | 4966 |
| 175 | Ga0206353_11070430 | 3300020082 | Bacteria | 3620 |
| 176 | Ga0213876_10001728 | 3300021384 | Bacteria | 13275 |
| 177 | Ga0213875_10000125 | 3300021388 | Bacteria | 85515 |
| 178 | Ga0213875_10003958 | 3300021388 | Bacteria | 8270 |
| 179 | Ga0224712_10001523 | 3300022467 | Bacteria | 5377 |
| 180 | Ga0224712_10001825 | 3300022467 | Bacteria | 5093 |
| 181 | Ga0224712_10016615 | 3300022467 | Bacteria | 2422 |
| 182 | Ga0224712_10018270 | 3300022467 | Bacteria | 2341 |
| 183 | Ga0207697_10001817 | 3300025315 | Bacteria | 11447 |
| 184 | Ga0207656_10002698 | 3300025321 | Bacteria | 6022 |
| 185 | Ga0207692_10022331 | 3300025898 | Bacteria | 2910 |
| 186 | Ga0207710_10000082 | 3300025900 | Bacteria | 138091 |
| 187 | Ga0207710_10000120 | 3300025900 | Bacteria | 96124 |
| 188 | Ga0207710_10001028 | 3300025900 | Bacteria | 14541 |
| 189 | Ga0207710_10007989 | 3300025900 | Bacteria | 4473 |
| 190 | Ga0207688_10000003 | 3300025901 | Bacteria | 78666 |
| 191 | Ga0207688_10002421 | 3300025901 | Bacteria | 10057 |
| 192 | Ga0207685_10002014 | 3300025905 | Bacteria | 4518 |
| 193 | Ga0207699_10006407 | 3300025906 | Bacteria | 5696 |
| 194 | Ga0207699_10012710 | 3300025906 | Bacteria | 4286 |
| 195 | Ga0207645_10000022 | 3300025907 | Bacteria | 103273 |
| 196 | Ga0207645_10016955 | 3300025907 | Bacteria | 4812 |
| 197 | Ga0207643_10000011 | 3300025908 | Bacteria | 150819 |
| 198 | Ga0207643_10000047 | 3300025908 | Bacteria | 79590 |
| 199 | Ga0207705_10001467 | 3300025909 | Bacteria | 18803 |
| 200 | Ga0207705_10033227 | 3300025909 | Bacteria | 3685 |
| 201 | Ga0207684_10003975 | 3300025910 | Bacteria | 14150 |
| 202 | Ga0207684_10032201 | 3300025910 | Bacteria | 4459 |
| 203 | Ga0207654_10002775 | 3300025911 | Bacteria | 8894 |
| 204 | Ga0207707_10000458 | 3300025912 | Bacteria | 42371 |
| 205 | Ga0207707_10018376 | 3300025912 | Bacteria | 6094 |
| 206 | Ga0207671_10012428 | 3300025914 | Bacteria | 6845 |
| 207 | Ga0207693_10005784 | 3300025915 | Bacteria | 10256 |
| 208 | Ga0207663_10008102 | 3300025916 | Bacteria | 5477 |
| 209 | Ga0207660_10000649 | 3300025917 | Bacteria | 23431 |
| 210 | Ga0207660_10003517 | 3300025917 | Bacteria | 10203 |
| 211 | Ga0207660_10003721 | 3300025917 | Bacteria | 9939 |
| 212 | Ga0207662_10000004 | 3300025918 | Bacteria | 128333 |
| 213 | Ga0207662_10012551 | 3300025918 | Bacteria | 4721 |
| 214 | Ga0207657_10000055 | 3300025919 | Bacteria | 105424 |
| 215 | Ga0207652_10000118 | 3300025921 | Bacteria | 87541 |
| 216 | Ga0207652_10001553 | 3300025921 | Bacteria | 20238 |
| 217 | Ga0207652_10016234 | 3300025921 | Bacteria | 6075 |
| 218 | Ga0207646_10000950 | 3300025922 | Bacteria | 37311 |
| 219 | Ga0207646_10001124 | 3300025922 | Bacteria | 34128 |
| 220 | Ga0207646_10024626 | 3300025922 | Bacteria | 5512 |
| 221 | Ga0207646_10038921 | 3300025922 | Bacteria | 4280 |
| 222 | Ga0207694_10098631 | 3300025924 | Bacteria | 2313 |
| 223 | Ga0207650_10000213 | 3300025925 | Bacteria | 66054 |
| 224 | Ga0207650_10002188 | 3300025925 | Bacteria | 13659 |
| 225 | Ga0207659_10000392 | 3300025926 | Bacteria | 26368 |
| 226 | Ga0207687_10006723 | 3300025927 | Bacteria | 7586 |
| 227 | Ga0207687_10045044 | 3300025927 | Bacteria | 3048 |
| 228 | Ga0207700_10008492 | 3300025928 | Bacteria | 6369 |
| 229 | Ga0207700_10020123 | 3300025928 | Bacteria | 4524 |
| 230 | Ga0207664_10000047 | 3300025929 | Bacteria | 139122 |
| 231 | Ga0207664_10002163 | 3300025929 | Bacteria | 12926 |
| 232 | Ga0207664_10009935 | 3300025929 | Bacteria | 6704 |
| 233 | Ga0207664_10014714 | 3300025929 | Bacteria | 5660 |
| 234 | Ga0207664_10016582 | 3300025929 | Bacteria | 5379 |
| 235 | Ga0207644_10006599 | 3300025931 | Bacteria | 7561 |
| 236 | Ga0207644_10006863 | 3300025931 | Bacteria | 7416 |
| 237 | Ga0207690_10000222 | 3300025932 | Bacteria | 42867 |
| 238 | Ga0207690_10007808 | 3300025932 | Bacteria | 6351 |
| 239 | Ga0207706_10000152 | 3300025933 | Bacteria | 76168 |
| 240 | Ga0207709_10008172 | 3300025935 | Bacteria | 5794 |
| 241 | Ga0207670_10000208 | 3300025936 | Bacteria | 38511 |
| 242 | Ga0207669_10000264 | 3300025937 | Bacteria | 23890 |
| 243 | Ga0207704_10000425 | 3300025938 | Bacteria | 18940 |
| 244 | Ga0207665_10000685 | 3300025939 | Bacteria | 22900 |
| 245 | Ga0207665_10010256 | 3300025939 | Bacteria | 6154 |
| 246 | Ga0207665_10031285 | 3300025939 | Bacteria | 3520 |
| 247 | Ga0207691_10000457 | 3300025940 | Bacteria | 40411 |
| 248 | Ga0207691_10023642 | 3300025940 | Bacteria | 5787 |
| 249 | Ga0207711_10000034 | 3300025941 | Bacteria | 190060 |
| 250 | Ga0207711_10001044 | 3300025941 | Bacteria | 26495 |
| 251 | Ga0207711_10007649 | 3300025941 | Bacteria | 9038 |
| 252 | Ga0207689_10000245 | 3300025942 | Bacteria | 48509 |
| 253 | Ga0207689_10002053 | 3300025942 | Bacteria | 19016 |
| 254 | Ga0207661_10001366 | 3300025944 | Bacteria | 16371 |
| 255 | Ga0207661_10007732 | 3300025944 | Bacteria | 7651 |
| 256 | Ga0207679_10001077 | 3300025945 | Bacteria | 17367 |
| 257 | Ga0207679_10001188 | 3300025945 | Bacteria | 16563 |
| 258 | Ga0207679_10008686 | 3300025945 | Bacteria | 6476 |
| 259 | Ga0207679_10008905 | 3300025945 | Bacteria | 6406 |
| 260 | Ga0207651_10000377 | 3300025960 | Bacteria | 18977 |
| 261 | Ga0207712_10001866 | 3300025961 | Bacteria | 13847 |
| 262 | Ga0207640_10026838 | 3300025981 | Bacteria | 3502 |
| 263 | Ga0207658_10011306 | 3300025986 | Bacteria | 6077 |
| 264 | Ga0207658_10032879 | 3300025986 | Bacteria | 3696 |
| 265 | Ga0207677_10000407 | 3300026023 | Bacteria | 29633 |
| 266 | Ga0207703_10000015 | 3300026035 | Bacteria | 287079 |
| 267 | Ga0207703_10001767 | 3300026035 | Bacteria | 19297 |
| 268 | Ga0207703_10007913 | 3300026035 | Bacteria | 8406 |
| 269 | Ga0207639_10002454 | 3300026041 | Bacteria | 12438 |
| 270 | Ga0207678_10013620 | 3300026067 | Bacteria | 7142 |
| 271 | Ga0207678_10041230 | 3300026067 | Bacteria | 4003 |
| 272 | Ga0207708_10003774 | 3300026075 | Bacteria | 11165 |
| 273 | Ga0207702_10002814 | 3300026078 | Bacteria | 16279 |
| 274 | Ga0207702_10003518 | 3300026078 | Bacteria | 14274 |
| 275 | Ga0207702_10006521 | 3300026078 | Bacteria | 10040 |
| 276 | Ga0207702_10015965 | 3300026078 | Bacteria | 6217 |
| 277 | Ga0207641_10001668 | 3300026088 | Bacteria | 21620 |
| 278 | Ga0207641_10002042 | 3300026088 | Bacteria | 19228 |
| 279 | Ga0207641_10002896 | 3300026088 | Bacteria | 15524 |
| 280 | Ga0207648_10000094 | 3300026089 | Bacteria | 84345 |
| 281 | Ga0207676_10002096 | 3300026095 | Bacteria | 14429 |
| 282 | Ga0207674_10000942 | 3300026116 | Bacteria | 37985 |
| 283 | Ga0207674_10007503 | 3300026116 | Bacteria | 12718 |
| 284 | Ga0207675_100000004 | 3300026118 | Bacteria | 210328 |
| 285 | Ga0207675_100038085 | 3300026118 | Bacteria | 4487 |
| 286 | Ga0207683_10000007 | 3300026121 | Bacteria | 175543 |
| 287 | Ga0207683_10000518 | 3300026121 | Bacteria | 35644 |
| 288 | Ga0207698_10001879 | 3300026142 | Bacteria | 12284 |
| 289 | Ga0207698_10017775 | 3300026142 | Bacteria | 4833 |
| 290 | Ga0207428_10003971 | 3300027907 | Bacteria | 14187 |
| 291 | Ga0268266_10001966 | 3300028379 | Bacteria | 23058 |
| 292 | Ga0268265_10000112 | 3300028380 | Bacteria | 101717 |
| 293 | Ga0268265_10002022 | 3300028380 | Bacteria | 15916 |
| 294 | Ga0268264_10000729 | 3300028381 | Bacteria | 37671 |
| 295 | Ga0265337_1000031 | 3300028556 | Bacteria | 64194 |
| 296 | Ga0265337_1009950 | 3300028556 | Bacteria | 3358 |
| 297 | Ga0265319_1003749 | 3300028563 | Bacteria | 7798 |
| 298 | Ga0265334_10000333 | 3300028573 | Bacteria | 25219 |
| 299 | Ga0265334_10001544 | 3300028573 | Bacteria | 11102 |
| 300 | Ga0265318_10006271 | 3300028577 | Bacteria | 5494 |
| 301 | Ga0265336_10000933 | 3300028666 | Bacteria | 14806 |
| 302 | Ga0265336_10001667 | 3300028666 | Bacteria | 9819 |
| 303 | Ga0265338_10000233 | 3300028800 | Bacteria | 103593 |
| 304 | Ga0265338_10034428 | 3300028800 | Bacteria | 4895 |
| 305 | Ga0265324_10002086 | 3300029957 | Bacteria | 10579 |
| 306 | Ga0307511_10000032 | 3300030521 | Bacteria | 105861 |
| 307 | Ga0265320_10002847 | 3300031240 | Bacteria | 11869 |
| 308 | Ga0265325_10001214 | 3300031241 | Bacteria | 18340 |
| 309 | Ga0265340_10014868 | 3300031247 | Bacteria | 4052 |
| 310 | Ga0265340_10039304 | 3300031247 | Bacteria | 2335 |
| 311 | Ga0307513_10000711 | 3300031456 | Bacteria | 47813 |
| 312 | Ga0316579_10019126 | 3300031691 | Bacteria | 3022 |
| 313 | Ga0265314_10002928 | 3300031711 | Bacteria | 16943 |
| 314 | Ga0265342_10004391 | 3300031712 | Bacteria | 11133 |
| 315 | Ga0316576_10000140 | 3300031727 | Bacteria | 28201 |
| 316 | Ga0316576_10000368 | 3300031727 | Bacteria | 20413 |
| 317 | Ga0316577_10033530 | 3300031733 | Bacteria | 2868 |
| 318 | Ga0307407_10008241 | 3300031903 | Bacteria | 4773 |
| 319 | Ga0307409_100047312 | 3300031995 | Bacteria | 3264 |
| 320 | Ga0316583_10000069 | 3300032133 | Bacteria | 21277 |
| 321 | Ga0316585_10009741 | 3300032137 | Bacteria | 2811 |
| 322 | Ga0373945_0006935 | 3300035116 | Bacteria | 3662 |
| 323 | Ga0373953_0001691 | 3300035117 | Bacteria | 6487 |
| 324 | Ga0373956_0011544 | 3300035119 | Bacteria | 3643 |
| 325 | Ga0373946_0000372 | 3300035171 | Bacteria | 14528 |
| 326 | Ga0316574_0000932 | 3300035398 | Bacteria | 13036 |
| 327 | Ga0316574_0039750 | 3300035398 | Bacteria | 2894 |
| 328 | Ga0316574_0057652 | 3300035398 | Bacteria | 2432 |
| 329 | Ga0373935_0002764 | 3300035692 | Bacteria | 10090 |
| 330 | Ga0373927_0014896 | 3300035695 | Bacteria | 5143 |
| 331 | Ga0373947_0024902 | 3300035725 | Bacteria | 3490 |
| 332 | Ga0373937_0033566 | 3300036401 | Bacteria | 4661 |
| 333 | Ga0373937_0045593 | 3300036401 | Bacteria | 4006 |
| 334 | Ga0316582_0080541 | 3300036647 | Bacteria | 2125 |
| 335 | Ga0316584_0034838 | 3300036712 | Bacteria | 3733 |
| 336 | Ga0316584_0038360 | 3300036712 | Bacteria | 3563 |
| 337 | Ga0373925_0000259 | 3300037068 | Bacteria | 55034 |
| 338 | Ga0373925_0005725 | 3300037068 | Bacteria | 9242 |
| 339 | Ga0373925_0049842 | 3300037068 | Bacteria | 3122 |
| 340 | Ga0395899_0002340 | 3300037312 | Bacteria | 15435 |
| 341 | Ga0316581_0006698 | 3300037588 | Bacteria | 3061 |
| 342 | Ga0436364_0732570 | 3300037853 | Bacteria | 62691 |
| 343 | Ga0436364_1191161 | 3300037853 | Bacteria | 9219 |
| 344 | Ga0436364_1286697 | 3300037853 | Bacteria | 6945 |
| 345 | Ga0400485_16978 | 3300038735 | Bacteria | 25355 |
| 346 | Ga0400486_03657 | 3300038742 | Bacteria | 72353 |
| 347 | Ga0436365_1343494 | 3300039437 | Bacteria | 4588 |
| 348 | Ga0436365_1397287 | 3300039437 | Bacteria | 8052 |
| 349 | Ga0436365_1876162 | 3300039437 | Bacteria | 22108 |
| 350 | Ga0436365_1876513 | 3300039437 | Bacteria | 3309 |
| 351 | Ga0439448_0004301 | 3300042005 | Bacteria | 4015 |
| 352 | Ga0439463_009295 | 3300042016 | Bacteria | 2418 |
| 353 | Ga0451577_0019727 | 3300042876 | Bacteria | 6197 |
| 354 | Ga0466969_0001218 | 3300044656 | Bacteria | 13885 |
| 355 | Ga0466969_0015827 | 3300044656 | Bacteria | 3953 |
| 356 | Ga0466966_0000550 | 3300044684 | Bacteria | 23876 |
| 357 | Ga0466966_0001592 | 3300044684 | Bacteria | 14587 |
| 358 | Ga0466961_0005153 | 3300044693 | Bacteria | 8221 |
| 359 | Ga0466961_0007726 | 3300044693 | Bacteria | 6846 |
| 360 | Ga0466961_0039043 | 3300044693 | Bacteria | 3044 |
| 361 | Ga0466963_0013145 | 3300044694 | Bacteria | 5079 |
| 362 | Ga0466963_0038399 | 3300044694 | Bacteria | 3130 |
| 363 | Ga0466963_0042000 | 3300044694 | Bacteria | 3001 |
| 364 | Ga0466957_0005956 | 3300044842 | Bacteria | 6874 |
| 365 | Ga0466957_0005992 | 3300044842 | Bacteria | 6855 |
| 366 | Ga0466957_0025051 | 3300044842 | Bacteria | 3534 |
| 367 | Ga0466960_0001422 | 3300044901 | Bacteria | 8713 |
| 368 | Ga0466960_0019673 | 3300044901 | Bacteria | 2978 |
| 369 | Ga0466959_0001869 | 3300045049 | Bacteria | 13238 |
| 370 | Ga0466959_0003841 | 3300045049 | Bacteria | 9963 |
| 371 | Ga0451576_0010150 | 3300045051 | Bacteria | 10835 |
| 372 | Ga0466958_0001919 | 3300045836 | Bacteria | 10172 |
| 373 | Ga0466958_0004261 | 3300045836 | Bacteria | 7523 |
| 374 | Ga0466958_0018312 | 3300045836 | Bacteria | 4063 |
| 375 | Ga0466958_0044907 | 3300045836 | Bacteria | 2664 |
| 376 | Ga0466967_0021513 | 3300045976 | Bacteria | 5242 |
| 377 | Ga0466967_0027849 | 3300045976 | Bacteria | 4708 |
| 378 | Ga0466967_0039055 | 3300045976 | Bacteria | 4077 |
| 379 | Ga0466967_0068658 | 3300045976 | Bacteria | 3166 |
| 380 | Ga0495592_0014671 | 3300046454 | Bacteria | 5948 |
| 381 | Ga0495592_0057656 | 3300046454 | Bacteria | 2866 |
| 382 | Ga0495603_0027490 | 3300046455 | Bacteria | 3433 |
| 383 | Ga0495603_0034409 | 3300046455 | Bacteria | 3046 |
| 384 | Ga0495629_0017495 | 3300046459 | Bacteria | 5137 |
| 385 | Ga0495641_0012884 | 3300046461 | Bacteria | 4639 |
| 386 | Ga0495651_0002082 | 3300046462 | Bacteria | 15417 |
| 387 | Ga0495651_0022964 | 3300046462 | Bacteria | 4850 |
| 388 | Ga0495651_0056838 | 3300046462 | Bacteria | 3004 |
| 389 | Ga0495653_0001312 | 3300046463 | Bacteria | 19277 |
| 390 | Ga0495653_0069720 | 3300046463 | Bacteria | 2632 |
| 391 | Ga0495580_0003931 | 3300046472 | Bacteria | 12541 |
| 392 | Ga0495582_0000493 | 3300046473 | Bacteria | 21575 |
| 393 | Ga0495662_0004106 | 3300046476 | Bacteria | 7335 |
| 394 | Ga0495664_0006890 | 3300046477 | Bacteria | 6290 |
| 395 | Ga0495618_0019004 | 3300046514 | Bacteria | 4223 |
| 396 | Ga0495618_0019029 | 3300046514 | Bacteria | 4221 |
| 397 | Ga0495648_0011396 | 3300046524 | Bacteria | 6699 |
| 398 | Ga0495652_0005857 | 3300046529 | Bacteria | 11505 |
| 399 | Ga0495665_0001587 | 3300046531 | Bacteria | 12157 |
| 400 | Ga0495665_0020589 | 3300046531 | Bacteria | 3542 |
| 401 | Ga0495586_0004142 | 3300046535 | Bacteria | 7772 |
| 402 | Ga0495587_0005669 | 3300046536 | Bacteria | 8139 |
| 403 | Ga0495587_0016671 | 3300046536 | Bacteria | 4570 |
| 404 | Ga0495645_0009882 | 3300046543 | Bacteria | 6677 |
| 405 | Ga0495645_0051697 | 3300046543 | Bacteria | 2989 |
| 406 | Ga0495667_0010935 | 3300046559 | Bacteria | 6132 |
| 407 | Ga0495667_0025243 | 3300046559 | Bacteria | 4005 |
| 408 | Ga0495667_0028127 | 3300046559 | Bacteria | 3784 |
| 409 | Ga0495667_0033281 | 3300046559 | Bacteria | 3450 |
| 410 | Ga0495634_0029120 | 3300046642 | Bacteria | 3825 |
| 411 | Ga0495635_0001276 | 3300046663 | Bacteria | 16810 |
| 412 | Ga0495635_0011485 | 3300046663 | Bacteria | 6209 |
| 413 | Ga0495635_0016587 | 3300046663 | Bacteria | 5145 |
| 414 | Ga0495635_0021089 | 3300046663 | Bacteria | 4540 |
| 415 | Ga0495657_0013222 | 3300046675 | Bacteria | 6097 |
| 416 | Ga0495657_0059771 | 3300046675 | Bacteria | 2527 |
| 417 | Ga0495599_0023036 | 3300046678 | Bacteria | 3890 |
| 418 | Ga0495599_0043372 | 3300046678 | Bacteria | 2822 |
| 419 | Ga0495624_0004583 | 3300046690 | Bacteria | 10091 |
| 420 | Ga0495624_0006516 | 3300046690 | Bacteria | 8275 |
| 421 | Ga0495624_0052301 | 3300046690 | Bacteria | 2581 |
| 422 | Ga0495600_0007906 | 3300046809 | Bacteria | 6516 |
| 423 | Ga0495581_0005557 | 3300047315 | Bacteria | 7304 |
| 424 | Ga0495674_0003948 | 3300047319 | Bacteria | 14392 |
| 425 | Ga0495674_0021595 | 3300047319 | Bacteria | 5951 |
| 426 | Ga0495674_0079150 | 3300047319 | Bacteria | 2823 |
| 427 | Ga0495672_0031132 | 3300047320 | Bacteria | 3334 |
| 428 | Ga0495676_0002514 | 3300047321 | Bacteria | 16325 |
| 429 | Ga0495680_0002758 | 3300047322 | Bacteria | 17724 |
| 430 | Ga0495680_0016612 | 3300047322 | Bacteria | 6315 |
| 431 | Ga0495680_0029307 | 3300047322 | Bacteria | 4507 |
| 432 | Ga0495675_0020785 | 3300047444 | Bacteria | 4177 |
| 433 | Ga0495684_0007239 | 3300047471 | Bacteria | 8609 |
| 434 | Ga0495684_0010896 | 3300047471 | Bacteria | 7030 |
| 435 | Ga0495684_0020382 | 3300047471 | Bacteria | 5109 |
| 436 | Ga0495684_0075653 | 3300047471 | Bacteria | 2557 |
| 437 | Ga0495684_0091503 | 3300047471 | Bacteria | 2304 |
| 438 | Ga0495593_0009493 | 3300047673 | Bacteria | 5644 |
| 439 | Ga0495593_0011142 | 3300047673 | Bacteria | 5171 |
| 440 | Ga0495602_0003227 | 3300048088 | Bacteria | 16830 |
| 441 | Ga0495602_0082832 | 3300048088 | Bacteria | 2690 |
| 442 | Ga0496100_0007750 | 3300048903 | Bacteria | 5949 |
| 443 | Ga0496102_0002119 | 3300048905 | Bacteria | 17067 |
| 444 | Ga0496102_0015452 | 3300048905 | Bacteria | 6649 |
| 445 | Ga0496102_0114179 | 3300048905 | Bacteria | 2520 |
| 446 | Ga0496104_0002450 | 3300048907 | Bacteria | 15977 |
| 447 | Ga0496104_0009485 | 3300048907 | Bacteria | 8661 |
| 448 | Ga0496104_0024373 | 3300048907 | Bacteria | 5565 |
| 449 | Ga0496104_0036069 | 3300048907 | Bacteria | 4619 |
| 450 | Ga0496104_0043005 | 3300048907 | Bacteria | 4242 |
| 451 | Ga0496105_0001355 | 3300048908 | Bacteria | 17212 |
| 452 | Ga0496105_0005746 | 3300048908 | Bacteria | 9448 |
| 453 | Ga0496105_0015933 | 3300048908 | Bacteria | 5995 |
| 454 | Ga0496105_0017160 | 3300048908 | Bacteria | 5798 |
| 455 | Ga0496106_0002569 | 3300048909 | Bacteria | 13512 |
| 456 | Ga0496108_0023644 | 3300048911 | Bacteria | 5058 |
| 457 | Ga0496108_0062639 | 3300048911 | Bacteria | 3132 |
| 458 | Ga0496109_0009580 | 3300048912 | Bacteria | 8261 |
| 459 | Ga0496109_0038868 | 3300048912 | Bacteria | 4305 |
| 460 | Ga0496110_0015571 | 3300048913 | Bacteria | 6333 |
| 461 | Ga0496110_0020528 | 3300048913 | Bacteria | 5578 |
| 462 | Ga0496111_0000725 | 3300048914 | Bacteria | 17585 |
| 463 | Ga0496111_0000804 | 3300048914 | Bacteria | 16837 |
| 464 | Ga0496111_0027288 | 3300048914 | Bacteria | 4038 |
| 465 | Ga0496112_0009675 | 3300048915 | Bacteria | 8699 |
| 466 | Ga0496112_0039804 | 3300048915 | Bacteria | 4594 |
| 467 | Ga0496113_0055887 | 3300048916 | Bacteria | 2961 |
| 468 | Ga0496114_0006175 | 3300048917 | Bacteria | 9430 |
| 469 | Ga0496114_0009177 | 3300048917 | Bacteria | 7841 |
| 470 | Ga0496114_0013169 | 3300048917 | Bacteria | 6629 |
| 471 | Ga0496114_0070696 | 3300048917 | Bacteria | 2932 |
| 472 | Ga0496115_0062316 | 3300048918 | Bacteria | 3008 |
| 473 | Ga0496116_0000381 | 3300048919 | Bacteria | 65986 |
| 474 | Ga0496118_0000236 | 3300048921 | Bacteria | 97321 |
| 475 | Ga0496118_0006770 | 3300048921 | Bacteria | 12462 |
| 476 | Ga0496119_0002723 | 3300048922 | Bacteria | 19055 |
| 477 | Ga0496119_0011055 | 3300048922 | Bacteria | 7524 |
| 478 | Ga0496119_0024375 | 3300048922 | Bacteria | 4258 |
| 479 | Ga0496120_0000365 | 3300048923 | Bacteria | 73526 |
| 480 | Ga0496121_0018809 | 3300048924 | Bacteria | 6941 |
| 481 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 482 | Ga0496126_0000529 | 3300048929 | Bacteria | 73936 |
| 483 | Ga0496126_0016940 | 3300048929 | Bacteria | 7272 |
| 484 | Ga0501032_0003034 | 3300049569 | Bacteria | 13016 |
| 485 | Ga0501032_0056445 | 3300049569 | Bacteria | 2640 |
| 486 | Ga0501033_0014619 | 3300049570 | Bacteria | 5961 |
| 487 | Ga0501034_0003557 | 3300049571 | Bacteria | 17711 |
| 488 | Ga0501034_0005252 | 3300049571 | Bacteria | 14213 |
| 489 | Ga0501034_0005796 | 3300049571 | Bacteria | 13435 |
| 490 | Ga0501036_0009172 | 3300049572 | Bacteria | 8135 |
| 491 | Ga0501036_0036136 | 3300049572 | Bacteria | 4180 |
| 492 | Ga0501037_0001079 | 3300049573 | Bacteria | 20226 |
| 493 | Ga0501037_0012781 | 3300049573 | Bacteria | 6185 |
| 494 | Ga0501038_0045817 | 3300049574 | Bacteria | 3795 |
| 495 | Ga0501038_0050464 | 3300049574 | Bacteria | 3594 |
| 496 | Ga0501040_0033779 | 3300049576 | Bacteria | 3467 |
| 497 | Ga0501041_0020735 | 3300049577 | Bacteria | 3932 |
| 498 | Ga0501043_0001189 | 3300049579 | Bacteria | 22891 |
| 499 | Ga0501043_0007809 | 3300049579 | Bacteria | 8457 |
| 500 | Ga0501046_0001119 | 3300049580 | Bacteria | 26186 |
| 501 | Ga0501047_0000031 | 3300049581 | Bacteria | 215903 |
| 502 | Ga0501047_0003260 | 3300049581 | Bacteria | 15389 |
| 503 | Ga0501047_0003811 | 3300049581 | Bacteria | 14173 |
| 504 | Ga0501047_0062617 | 3300049581 | Bacteria | 3588 |
| 505 | Ga0501048_0003279 | 3300049582 | Bacteria | 12334 |
| 506 | Ga0501048_0004538 | 3300049582 | Bacteria | 10568 |
| 507 | Ga0501048_0039159 | 3300049582 | Bacteria | 3401 |
| 508 | Ga0501070_0001404 | 3300049586 | Bacteria | 21565 |
| 509 | Ga0501071_0011367 | 3300049587 | Bacteria | 5997 |
| 510 | Ga0501072_0015173 | 3300049588 | Bacteria | 5907 |
| 511 | Ga0501074_0030814 | 3300049590 | Bacteria | 3886 |
| 512 | Ga0501074_0042935 | 3300049590 | Bacteria | 3272 |
| 513 | Ga0501075_0013240 | 3300049591 | Bacteria | 5884 |
| 514 | Ga0501077_0017199 | 3300049593 | Bacteria | 4561 |
| 515 | Ga0501079_0057352 | 3300049741 | Bacteria | 3005 |
| 516 | Ga0501080_0110244 | 3300049742 | Bacteria | 2551 |
| 517 | Ga0501081_0022993 | 3300049743 | Bacteria | 4174 |
| 518 | Ga0501035_0002105 | 3300049822 | Bacteria | 19784 |
| 519 | Ga0501044_0001501 | 3300049823 | Bacteria | 27346 |
| 520 | nmdc:mga0yw44_25700_c1 | 3300050492 | Bacteria | 3353 |
| 521 | nmdc:mga05p37_16596_c1 | 3300050507 | Bacteria | 8870 |
| 522 | nmdc:mga09592_45905_c1 | 3300050508 | Bacteria | 3679 |
| 523 | nmdc:mga08y16_18653_c1 | 3300050511 | Bacteria | 7307 |
| 524 | nmdc:mga0n895_6584_c1 | 3300050512 | Bacteria | 9885 |
| 525 | nmdc:mga0n895_90077_c1 | 3300050512 | Bacteria | 3069 |
| 526 | nmdc:mga0rr50_26275_c1 | 3300050513 | Bacteria | 4060 |
| 527 | nmdc:mga08x19_24473_c1 | 3300050514 | Bacteria | 3753 |
| 528 | nmdc:mga0a205_30290_c1 | 3300050515 | Bacteria | 5180 |
| 529 | nmdc:mga0a205_8924_c1 | 3300050515 | Bacteria | 9138 |
| 530 | Ga0495612_0004251 | 3300053078 | Bacteria | 5945 |
| 531 | Ga0495619_0001215 | 3300053085 | Bacteria | 16882 |
| 532 | Ga0500616_0000562 | 3300053153 | Bacteria | 45732 |
| 533 | Ga0500645_000013 | 3300053730 | Bacteria | 154598 |
| 534 | Ga0466962_0018562 | 3300061719 | Bacteria | 3346 |
| 535 | Ga0530510_0007037 | 3300061734 | Bacteria | 7834 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036647 | Ga0316582_0080541 | Ga0316582_0080541_30_1748 | 569 |
| 2 | 3300037588 | Ga0316581_0006698 | Ga0316581_0006698_1314_3032 | 569 |
| 3 | 3300045836 | Ga0466958_0004261 | Ga0466958_0004261_27_1838 | 585 |
| 4 | 3300049741 | Ga0501079_0057352 | Ga0501079_0057352_23_1924 | 618 |
| 5 | 3300031247 | Ga0265340_10014868 | Ga0265340_100148683 | 635 |
| 6 | 3300047320 | Ga0495672_0031132 | Ga0495672_0031132_40_1995 | 642 |
| 7 | 3300042016 | Ga0439463_009295 | Ga0439463_009295_356_2407 | 665 |
| 8 | 3300005985 | Ga0081539_10037163 | Ga0081539_100371633 | 667 |
| 9 | 3300048917 | Ga0496114_0070696 | Ga0496114_0070696_49_2079 | 670 |
| 10 | 3300005471 | Ga0070698_100006885 | Ga0070698_1000068856 | 683 |
| 11 | 3300025922 | Ga0207646_10024626 | Ga0207646_100246266 | 683 |
| 12 | 3300005471 | Ga0070698_100000292 | Ga0070698_1000002925 | 685 |
| 13 | 3300009148 | Ga0105243_10073198 | Ga0105243_100731983 | 687 |
| 14 | 3300009174 | Ga0105241_10039580 | Ga0105241_100395803 | 687 |
| 15 | 3300025940 | Ga0207691_10023642 | Ga0207691_100236423 | 687 |
| 16 | 3300044842 | Ga0466957_0005956 | Ga0466957_0005956_4611_6782 | 687 |
| 17 | 3300045836 | Ga0466958_0001919 | Ga0466958_0001919_4982_7153 | 687 |
| 18 | 3300045976 | Ga0466967_0039055 | Ga0466967_0039055_452_2623 | 687 |
| 19 | 3300005434 | Ga0070709_10008912 | Ga0070709_100089123 | 688 |
| 20 | 3300025898 | Ga0207692_10022331 | Ga0207692_100223312 | 688 |
| 21 | 3300035117 | Ga0373953_0001691 | Ga0373953_0001691_2877_5099 | 688 |
| 22 | 3300035119 | Ga0373956_0011544 | Ga0373956_0011544_146_2368 | 688 |
| 23 | 3300037068 | Ga0373925_0049842 | Ga0373925_0049842_126_2360 | 688 |
| 24 | 3300046463 | Ga0495653_0069720 | Ga0495653_0069720_267_2489 | 688 |
| 25 | 3300046675 | Ga0495657_0059771 | Ga0495657_0059771_143_2365 | 688 |
| 26 | 3300039437 | Ga0436365_1876513 | Ga0436365_1876513_296_2503 | 689 |
| 27 | 3300006844 | Ga0075428_100049902 | Ga0075428_1000499022 | 690 |
| 28 | 3300021388 | Ga0213875_10000125 | Ga0213875_1000012561 | 692 |
| 29 | 3300037068 | Ga0373925_0000259 | Ga0373925_0000259_41918_44110 | 692 |
| 30 | 3300037853 | Ga0436364_0732570 | Ga0436364_0732570_32447_34975 | 692 |
| 31 | 3300028556 | Ga0265337_1000031 | Ga0265337_100003153 | 693 |
| 32 | 3300028563 | Ga0265319_1003749 | Ga0265319_10037492 | 693 |
| 33 | 3300028573 | Ga0265334_10000333 | Ga0265334_1000033311 | 693 |
| 34 | 3300028666 | Ga0265336_10000933 | Ga0265336_1000093310 | 693 |
| 35 | 3300028800 | Ga0265338_10000233 | Ga0265338_1000023380 | 693 |
| 36 | 3300029957 | Ga0265324_10002086 | Ga0265324_100020862 | 693 |
| 37 | 3300031240 | Ga0265320_10002847 | Ga0265320_100028473 | 693 |
| 38 | 3300031241 | Ga0265325_10001214 | Ga0265325_100012145 | 693 |
| 39 | 3300031247 | Ga0265340_10039304 | Ga0265340_100393042 | 693 |
| 40 | 3300031711 | Ga0265314_10002928 | Ga0265314_1000292812 | 693 |
| 41 | 3300031712 | Ga0265342_10004391 | Ga0265342_100043915 | 693 |
| 42 | 3300039437 | Ga0436365_1343494 | Ga0436365_1343494_247_2481 | 693 |
| 43 | 3300037312 | Ga0395899_0002340 | Ga0395899_0002340_226_2442 | 694 |
| 44 | 3300013105 | Ga0157369_10041708 | Ga0157369_100417082 | 695 |
| 45 | 3300020069 | Ga0197907_10937645 | Ga0197907_109376453 | 695 |
| 46 | 3300020075 | Ga0206349_1910650 | Ga0206349_19106503 | 695 |
| 47 | 3300020080 | Ga0206350_10028680 | Ga0206350_100286802 | 695 |
| 48 | 3300022467 | Ga0224712_10001523 | Ga0224712_100015233 | 695 |
| 49 | 3300049571 | Ga0501034_0005796 | Ga0501034_0005796_5035_7242 | 695 |
| 50 | 3300005366 | Ga0070659_100000761 | Ga0070659_10000076115 | 696 |
| 51 | 3300025932 | Ga0207690_10000222 | Ga0207690_1000022230 | 696 |
| 52 | 3300005329 | Ga0070683_100051744 | Ga0070683_1000517442 | 697 |
| 53 | 3300048929 | Ga0496126_0000529 | Ga0496126_0000529_37883_40177 | 697 |
| 54 | 3300005367 | Ga0070667_100011129 | Ga0070667_1000111294 | 698 |
| 55 | 3300025922 | Ga0207646_10038921 | Ga0207646_100389214 | 698 |
| 56 | 3300025986 | Ga0207658_10011306 | Ga0207658_100113062 | 698 |
| 57 | 3300013105 | Ga0157369_10000755 | Ga0157369_1000075535 | 699 |
| 58 | 3300044693 | Ga0466961_0005153 | Ga0466961_0005153_734_2998 | 699 |
| 59 | 3300031995 | Ga0307409_100047312 | Ga0307409_1000473121 | 700 |
| 60 | 3300046462 | Ga0495651_0022964 | Ga0495651_0022964_21_2285 | 700 |
| 61 | 3300048919 | Ga0496116_0000381 | Ga0496116_0000381_13022_15298 | 700 |
| 62 | 3300048921 | Ga0496118_0006770 | Ga0496118_0006770_8424_10700 | 700 |
| 63 | 3300048922 | Ga0496119_0002723 | Ga0496119_0002723_6537_8813 | 700 |
| 64 | 3300006846 | Ga0075430_100057171 | Ga0075430_1000571712 | 701 |
| 65 | 3300044694 | Ga0466963_0038399 | Ga0466963_0038399_40_2235 | 701 |
| 66 | 3300044901 | Ga0466960_0001422 | Ga0466960_0001422_5344_7539 | 701 |
| 67 | 3300049742 | Ga0501080_0110244 | Ga0501080_0110244_292_2511 | 701 |
| 68 | 3300005327 | Ga0070658_10001237 | Ga0070658_100012372 | 702 |
| 69 | 3300025909 | Ga0207705_10001467 | Ga0207705_100014678 | 702 |
| 70 | 3300036401 | Ga0373937_0045593 | Ga0373937_0045593_763_3108 | 702 |
| 71 | 3300044693 | Ga0466961_0039043 | Ga0466961_0039043_496_2775 | 702 |
| 72 | 3300046472 | Ga0495580_0003931 | Ga0495580_0003931_5646_7991 | 702 |
| 73 | 3300046535 | Ga0495586_0004142 | Ga0495586_0004142_2753_5122 | 702 |
| 74 | 3300047471 | Ga0495684_0010896 | Ga0495684_0010896_2749_5094 | 702 |
| 75 | 3300005327 | Ga0070658_10035027 | Ga0070658_100350272 | 703 |
| 76 | 3300005437 | Ga0070710_10000359 | Ga0070710_1000035914 | 703 |
| 77 | 3300006173 | Ga0070716_100006426 | Ga0070716_1000064263 | 703 |
| 78 | 3300025929 | Ga0207664_10009935 | Ga0207664_100099352 | 703 |
| 79 | 3300025939 | Ga0207665_10010256 | Ga0207665_100102563 | 703 |
| 80 | 3300046476 | Ga0495662_0004106 | Ga0495662_0004106_1027_3396 | 703 |
| 81 | 3300048088 | Ga0495602_0082832 | Ga0495602_0082832_82_2610 | 703 |
| 82 | 3300005842 | Ga0068858_100000032 | Ga0068858_10000003255 | 704 |
| 83 | 3300026035 | Ga0207703_10000015 | Ga0207703_1000001554 | 704 |
| 84 | 3300048916 | Ga0496113_0055887 | Ga0496113_0055887_440_2587 | 704 |
| 85 | 3300005617 | Ga0068859_100112361 | Ga0068859_1001123612 | 705 |
| 86 | 3300006931 | Ga0097620_100112361 | Ga0097620_1001123612 | 705 |
| 87 | 3300009101 | Ga0105247_10001144 | Ga0105247_100011442 | 705 |
| 88 | 3300013307 | Ga0157372_10000057 | Ga0157372_1000005757 | 705 |
| 89 | 3300022467 | Ga0224712_10018270 | Ga0224712_100182701 | 705 |
| 90 | 3300025900 | Ga0207710_10000082 | Ga0207710_1000008254 | 705 |
| 91 | 3300025906 | Ga0207699_10006407 | Ga0207699_100064073 | 705 |
| 92 | 3300026078 | Ga0207702_10006521 | Ga0207702_100065215 | 705 |
| 93 | 3300046559 | Ga0495667_0025243 | Ga0495667_0025243_700_3243 | 705 |
| 94 | 3300048922 | Ga0496119_0024375 | Ga0496119_0024375_1693_4071 | 705 |
| 95 | 3300048924 | Ga0496121_0018809 | Ga0496121_0018809_3460_5838 | 705 |
| 96 | 3300005434 | Ga0070709_10000636 | Ga0070709_1000063614 | 706 |
| 97 | 3300005937 | Ga0081455_10013968 | Ga0081455_100139688 | 706 |
| 98 | 3300005983 | Ga0081540_1000250 | Ga0081540_100025017 | 706 |
| 99 | 3300025918 | Ga0207662_10012551 | Ga0207662_100125512 | 706 |
| 100 | 3300025928 | Ga0207700_10020123 | Ga0207700_100201232 | 706 |
| 101 | 3300035116 | Ga0373945_0006935 | Ga0373945_0006935_581_2959 | 706 |
| 102 | 3300035171 | Ga0373946_0000372 | Ga0373946_0000372_12135_14513 | 706 |
| 103 | 3300035692 | Ga0373935_0002764 | Ga0373935_0002764_6339_8717 | 706 |
| 104 | 3300035695 | Ga0373927_0014896 | Ga0373927_0014896_2338_4716 | 706 |
| 105 | 3300037853 | Ga0436364_1191161 | Ga0436364_1191161_472_2949 | 706 |
| 106 | 3300046455 | Ga0495603_0027490 | Ga0495603_0027490_707_3064 | 706 |
| 107 | 3300046473 | Ga0495582_0000493 | Ga0495582_0000493_19101_21458 | 706 |
| 108 | 3300046477 | Ga0495664_0006890 | Ga0495664_0006890_3738_6116 | 706 |
| 109 | 3300046531 | Ga0495665_0020589 | Ga0495665_0020589_450_2828 | 706 |
| 110 | 3300046559 | Ga0495667_0033281 | Ga0495667_0033281_859_3237 | 706 |
| 111 | 3300046642 | Ga0495634_0029120 | Ga0495634_0029120_899_3256 | 706 |
| 112 | 3300046663 | Ga0495635_0011485 | Ga0495635_0011485_2716_5094 | 706 |
| 113 | 3300046678 | Ga0495599_0023036 | Ga0495599_0023036_1249_3627 | 706 |
| 114 | 3300046690 | Ga0495624_0004583 | Ga0495624_0004583_5531_7909 | 706 |
| 115 | 3300047315 | Ga0495581_0005557 | Ga0495581_0005557_2646_5003 | 706 |
| 116 | 3300047319 | Ga0495674_0003948 | Ga0495674_0003948_176_2554 | 706 |
| 117 | 3300047321 | Ga0495676_0002514 | Ga0495676_0002514_825_3203 | 706 |
| 118 | 3300047471 | Ga0495684_0075653 | Ga0495684_0075653_37_2415 | 706 |
| 119 | 3300053078 | Ga0495612_0004251 | Ga0495612_0004251_1586_3943 | 706 |
| 120 | 3300005616 | Ga0068852_100005201 | Ga0068852_1000052012 | 707 |
| 121 | 3300005841 | Ga0068863_100000471 | Ga0068863_10000047134 | 707 |
| 122 | 3300022467 | Ga0224712_10001825 | Ga0224712_100018253 | 707 |
| 123 | 3300026067 | Ga0207678_10041230 | Ga0207678_100412303 | 707 |
| 124 | 3300026088 | Ga0207641_10001668 | Ga0207641_100016682 | 707 |
| 125 | 3300026142 | Ga0207698_10001879 | Ga0207698_100018793 | 707 |
| 126 | 3300046459 | Ga0495629_0017495 | Ga0495629_0017495_2150_4471 | 707 |
| 127 | 3300046461 | Ga0495641_0012884 | Ga0495641_0012884_1210_3531 | 707 |
| 128 | 3300047673 | Ga0495593_0011142 | Ga0495593_0011142_434_2755 | 707 |
| 129 | 3300048929 | Ga0496126_0016940 | Ga0496126_0016940_4870_7101 | 707 |
| 130 | 3300049590 | Ga0501074_0030814 | Ga0501074_0030814_1664_3832 | 707 |
| 131 | 3300005614 | Ga0068856_100023338 | Ga0068856_1000233382 | 708 |
| 132 | 3300009098 | Ga0105245_10027732 | Ga0105245_100277322 | 708 |
| 133 | 3300010375 | Ga0105239_10102606 | Ga0105239_101026062 | 708 |
| 134 | 3300046454 | Ga0495592_0057656 | Ga0495592_0057656_358_2595 | 708 |
| 135 | 3300046462 | Ga0495651_0056838 | Ga0495651_0056838_598_2835 | 708 |
| 136 | 3300046514 | Ga0495618_0019029 | Ga0495618_0019029_1657_3894 | 708 |
| 137 | 3300046536 | Ga0495587_0005669 | Ga0495587_0005669_1247_3484 | 708 |
| 138 | 3300046543 | Ga0495645_0009882 | Ga0495645_0009882_3554_5791 | 708 |
| 139 | 3300046559 | Ga0495667_0028127 | Ga0495667_0028127_1378_3615 | 708 |
| 140 | 3300046663 | Ga0495635_0021089 | Ga0495635_0021089_1455_3692 | 708 |
| 141 | 3300046678 | Ga0495599_0043372 | Ga0495599_0043372_474_2711 | 708 |
| 142 | 3300046690 | Ga0495624_0052301 | Ga0495624_0052301_112_2349 | 708 |
| 143 | 3300047322 | Ga0495680_0016612 | Ga0495680_0016612_3909_6146 | 708 |
| 144 | 3300048907 | Ga0496104_0043005 | Ga0496104_0043005_172_2616 | 708 |
| 145 | 3300048917 | Ga0496114_0006175 | Ga0496114_0006175_4894_7422 | 708 |
| 146 | 3300048917 | Ga0496114_0009177 | Ga0496114_0009177_2139_4583 | 708 |
| 147 | 3300049576 | Ga0501040_0033779 | Ga0501040_0033779_363_2561 | 708 |
| 148 | 3300049577 | Ga0501041_0020735 | Ga0501041_0020735_495_2693 | 708 |
| 149 | 3300049581 | Ga0501047_0000031 | Ga0501047_0000031_81280_83436 | 708 |
| 150 | 3300049582 | Ga0501048_0039159 | Ga0501048_0039159_1048_3246 | 708 |
| 151 | 3300049587 | Ga0501071_0011367 | Ga0501071_0011367_1735_3933 | 708 |
| 152 | 3300049588 | Ga0501072_0015173 | Ga0501072_0015173_2130_4328 | 708 |
| 153 | 3300049590 | Ga0501074_0042935 | Ga0501074_0042935_335_2533 | 708 |
| 154 | 3300049591 | Ga0501075_0013240 | Ga0501075_0013240_892_3090 | 708 |
| 155 | 3300049593 | Ga0501077_0017199 | Ga0501077_0017199_1316_3514 | 708 |
| 156 | 3300049743 | Ga0501081_0022993 | Ga0501081_0022993_916_3114 | 708 |
| 157 | 3300061734 | Ga0530510_0007037 | Ga0530510_0007037_4484_6682 | 708 |
| 158 | 3300005435 | Ga0070714_100000106 | Ga0070714_10000010624 | 709 |
| 159 | 3300005564 | Ga0070664_100011125 | Ga0070664_1000111253 | 709 |
| 160 | 3300020082 | Ga0206353_10006789 | Ga0206353_100067893 | 709 |
| 161 | 3300025929 | Ga0207664_10000047 | Ga0207664_1000004768 | 709 |
| 162 | 3300025944 | Ga0207661_10001366 | Ga0207661_1000136615 | 709 |
| 163 | 3300025945 | Ga0207679_10008905 | Ga0207679_100089054 | 709 |
| 164 | 3300031727 | Ga0316576_10000140 | Ga0316576_1000014020 | 709 |
| 165 | 3300035398 | Ga0316574_0039750 | Ga0316574_0039750_113_2272 | 709 |
| 166 | 3300046524 | Ga0495648_0011396 | Ga0495648_0011396_925_3324 | 709 |
| 167 | 3300049569 | Ga0501032_0003034 | Ga0501032_0003034_2422_4584 | 709 |
| 168 | 3300049570 | Ga0501033_0014619 | Ga0501033_0014619_1745_3907 | 709 |
| 169 | 3300049571 | Ga0501034_0003557 | Ga0501034_0003557_8758_10920 | 709 |
| 170 | 3300049572 | Ga0501036_0036136 | Ga0501036_0036136_1513_3690 | 709 |
| 171 | 3300049573 | Ga0501037_0012781 | Ga0501037_0012781_614_2776 | 709 |
| 172 | 3300049579 | Ga0501043_0007809 | Ga0501043_0007809_4098_6260 | 709 |
| 173 | 3300049580 | Ga0501046_0001119 | Ga0501046_0001119_8249_10411 | 709 |
| 174 | 3300049581 | Ga0501047_0003260 | Ga0501047_0003260_8434_10596 | 709 |
| 175 | 3300049582 | Ga0501048_0004538 | Ga0501048_0004538_8169_10331 | 709 |
| 176 | 3300049586 | Ga0501070_0001404 | Ga0501070_0001404_8433_10595 | 709 |
| 177 | 3300049822 | Ga0501035_0002105 | Ga0501035_0002105_8405_10567 | 709 |
| 178 | 3300049823 | Ga0501044_0001501 | Ga0501044_0001501_8433_10595 | 709 |
| 179 | 3300005617 | Ga0068859_100028711 | Ga0068859_1000287114 | 710 |
| 180 | 3300006931 | Ga0097620_100028711 | Ga0097620_1000287114 | 710 |
| 181 | 3300013105 | Ga0157369_10038585 | Ga0157369_100385855 | 710 |
| 182 | 3300020082 | Ga0206353_11070430 | Ga0206353_110704302 | 710 |
| 183 | 3300049569 | Ga0501032_0056445 | Ga0501032_0056445_206_2383 | 710 |
| 184 | 3300049574 | Ga0501038_0050464 | Ga0501038_0050464_1187_3364 | 710 |
| 185 | 3300049581 | Ga0501047_0062617 | Ga0501047_0062617_174_2351 | 710 |
| 186 | iso_pu_bacteria | 2839986021 | 2839986417 | 710 |
| 187 | 3300005445 | Ga0070708_100004383 | Ga0070708_1000043839 | 711 |
| 188 | 3300005467 | Ga0070706_100005676 | Ga0070706_1000056763 | 711 |
| 189 | 3300005467 | Ga0070706_100051660 | Ga0070706_1000516603 | 711 |
| 190 | 3300005468 | Ga0070707_100005079 | Ga0070707_1000050794 | 711 |
| 191 | 3300005471 | Ga0070698_100002789 | Ga0070698_10000278913 | 711 |
| 192 | 3300006028 | Ga0070717_10019169 | Ga0070717_100191693 | 711 |
| 193 | 3300025910 | Ga0207684_10003975 | Ga0207684_100039754 | 711 |
| 194 | 3300025922 | Ga0207646_10000950 | Ga0207646_1000095021 | 711 |
| 195 | 3300035725 | Ga0373947_0024902 | Ga0373947_0024902_1015_3225 | 711 |
| 196 | 3300037068 | Ga0373925_0005725 | Ga0373925_0005725_1293_3503 | 711 |
| 197 | 3300046454 | Ga0495592_0014671 | Ga0495592_0014671_970_3195 | 711 |
| 198 | 3300046462 | Ga0495651_0002082 | Ga0495651_0002082_10282_12507 | 711 |
| 199 | 3300046463 | Ga0495653_0001312 | Ga0495653_0001312_16205_18430 | 711 |
| 200 | 3300046514 | Ga0495618_0019004 | Ga0495618_0019004_1801_4026 | 711 |
| 201 | 3300046529 | Ga0495652_0005857 | Ga0495652_0005857_6859_9084 | 711 |
| 202 | 3300046543 | Ga0495645_0051697 | Ga0495645_0051697_383_2608 | 711 |
| 203 | 3300046559 | Ga0495667_0010935 | Ga0495667_0010935_2439_4664 | 711 |
| 204 | 3300046663 | Ga0495635_0001276 | Ga0495635_0001276_11399_13624 | 711 |
| 205 | 3300046809 | Ga0495600_0007906 | Ga0495600_0007906_3732_5957 | 711 |
| 206 | 3300047319 | Ga0495674_0021595 | Ga0495674_0021595_1302_3527 | 711 |
| 207 | 3300047322 | Ga0495680_0002758 | Ga0495680_0002758_15153_17378 | 711 |
| 208 | 3300047471 | Ga0495684_0007239 | Ga0495684_0007239_4638_6863 | 711 |
| 209 | 3300047471 | Ga0495684_0091503 | Ga0495684_0091503_73_2283 | 711 |
| 210 | 3300048088 | Ga0495602_0003227 | Ga0495602_0003227_2417_4642 | 711 |
| 211 | iso_pu_bacteria | 2558860280 | 2559429432 | 711 |
| 212 | iso_pu_bacteria | 2738541274 | 2738707743 | 711 |
| 213 | iso_pu_bacteria | 2738543028 | 2739334083 | 711 |
| 214 | iso_pu_bacteria | 2852677369 | 2852680186 | 711 |
| 215 | 3300005518 | Ga0070699_100011216 | Ga0070699_1000112163 | 712 |
| 216 | 3300006358 | Ga0068871_100019675 | Ga0068871_1000196753 | 712 |
| 217 | 3300009177 | Ga0105248_10099456 | Ga0105248_100994562 | 712 |
| 218 | 3300013297 | Ga0157378_10010038 | Ga0157378_100100385 | 712 |
| 219 | 3300025924 | Ga0207694_10098631 | Ga0207694_100986312 | 712 |
| 220 | 3300026121 | Ga0207683_10000518 | Ga0207683_1000051830 | 712 |
| 221 | 3300036401 | Ga0373937_0033566 | Ga0373937_0033566_789_3089 | 712 |
| 222 | 3300046536 | Ga0495587_0016671 | Ga0495587_0016671_2016_4316 | 712 |
| 223 | 3300046663 | Ga0495635_0016587 | Ga0495635_0016587_264_2564 | 712 |
| 224 | 3300046675 | Ga0495657_0013222 | Ga0495657_0013222_1681_3981 | 712 |
| 225 | 3300047322 | Ga0495680_0029307 | Ga0495680_0029307_1166_3466 | 712 |
| 226 | 3300047471 | Ga0495684_0020382 | Ga0495684_0020382_654_2954 | 712 |
| 227 | 3300048903 | Ga0496100_0007750 | Ga0496100_0007750_2653_4833 | 712 |
| 228 | 3300048907 | Ga0496104_0024373 | Ga0496104_0024373_1406_3586 | 712 |
| 229 | 3300048908 | Ga0496105_0017160 | Ga0496105_0017160_1180_3360 | 712 |
| 230 | 3300048917 | Ga0496114_0013169 | Ga0496114_0013169_246_2426 | 712 |
| 231 | 3300005335 | Ga0070666_10002219 | Ga0070666_100022192 | 713 |
| 232 | 3300005367 | Ga0070667_100049214 | Ga0070667_1000492142 | 713 |
| 233 | 3300005434 | Ga0070709_10015554 | Ga0070709_100155542 | 713 |
| 234 | 3300005539 | Ga0068853_100066537 | Ga0068853_1000665372 | 713 |
| 235 | 3300005841 | Ga0068863_100000697 | Ga0068863_1000006975 | 713 |
| 236 | 3300006163 | Ga0070715_10002273 | Ga0070715_100022735 | 713 |
| 237 | 3300006173 | Ga0070716_100019306 | Ga0070716_1000193062 | 713 |
| 238 | 3300009177 | Ga0105248_10000044 | Ga0105248_1000004494 | 713 |
| 239 | 3300025905 | Ga0207685_10002014 | Ga0207685_100020142 | 713 |
| 240 | 3300025906 | Ga0207699_10012710 | Ga0207699_100127102 | 713 |
| 241 | 3300025915 | Ga0207693_10005784 | Ga0207693_100057845 | 713 |
| 242 | 3300025916 | Ga0207663_10008102 | Ga0207663_100081023 | 713 |
| 243 | 3300025928 | Ga0207700_10008492 | Ga0207700_100084923 | 713 |
| 244 | 3300025929 | Ga0207664_10002163 | Ga0207664_100021635 | 713 |
| 245 | 3300025939 | Ga0207665_10000685 | Ga0207665_100006858 | 713 |
| 246 | 3300025941 | Ga0207711_10000034 | Ga0207711_10000034117 | 713 |
| 247 | 3300025986 | Ga0207658_10032879 | Ga0207658_100328792 | 713 |
| 248 | 3300026088 | Ga0207641_10002042 | Ga0207641_1000204213 | 713 |
| 249 | 3300030521 | Ga0307511_10000032 | Ga0307511_100000329 | 713 |
| 250 | 3300037853 | Ga0436364_1286697 | Ga0436364_1286697_3020_5416 | 713 |
| 251 | 3300044656 | Ga0466969_0001218 | Ga0466969_0001218_2118_4286 | 713 |
| 252 | 3300044656 | Ga0466969_0015827 | Ga0466969_0015827_278_2446 | 713 |
| 253 | 3300044684 | Ga0466966_0000550 | Ga0466966_0000550_4866_7034 | 713 |
| 254 | 3300045049 | Ga0466959_0001869 | Ga0466959_0001869_6532_8700 | 713 |
| 255 | 3300046531 | Ga0495665_0001587 | Ga0495665_0001587_8730_11051 | 713 |
| 256 | 3300046690 | Ga0495624_0006516 | Ga0495624_0006516_5069_7390 | 713 |
| 257 | 3300047319 | Ga0495674_0079150 | Ga0495674_0079150_173_2692 | 713 |
| 258 | 3300047444 | Ga0495675_0020785 | Ga0495675_0020785_1296_3617 | 713 |
| 259 | 3300048907 | Ga0496104_0009485 | Ga0496104_0009485_1608_3827 | 713 |
| 260 | 3300048908 | Ga0496105_0001355 | Ga0496105_0001355_2525_4744 | 713 |
| 261 | 3300048912 | Ga0496109_0038868 | Ga0496109_0038868_616_2973 | 713 |
| 262 | 3300048915 | Ga0496112_0039804 | Ga0496112_0039804_2250_4469 | 713 |
| 263 | 3300048918 | Ga0496115_0062316 | Ga0496115_0062316_568_2787 | 713 |
| 264 | 3300053085 | Ga0495619_0001215 | Ga0495619_0001215_5679_8000 | 713 |
| 265 | 3300061719 | Ga0466962_0018562 | Ga0466962_0018562_492_2660 | 713 |
| 266 | iso_pu_bacteria | 2517572101 | 2517760497 | 713 |
| 267 | 3300005467 | Ga0070706_100003956 | Ga0070706_1000039565 | 714 |
| 268 | 3300006048 | Ga0075363_100016552 | Ga0075363_1000165522 | 714 |
| 269 | 3300021384 | Ga0213876_10001728 | Ga0213876_100017281 | 714 |
| 270 | 3300035398 | Ga0316574_0057652 | Ga0316574_0057652_165_2360 | 714 |
| 271 | 3300038735 | Ga0400485_16978 | Ga0400485_16978_6787_8961 | 714 |
| 272 | 3300038742 | Ga0400486_03657 | Ga0400486_03657_44012_46186 | 714 |
| 273 | 3300039437 | Ga0436365_1397287 | Ga0436365_1397287_4118_6313 | 714 |
| 274 | 3300044694 | Ga0466963_0013145 | Ga0466963_0013145_1543_3732 | 714 |
| 275 | 3300044694 | Ga0466963_0042000 | Ga0466963_0042000_20_2293 | 714 |
| 276 | 3300044842 | Ga0466957_0025051 | Ga0466957_0025051_1117_3306 | 714 |
| 277 | 3300045836 | Ga0466958_0044907 | Ga0466958_0044907_401_2590 | 714 |
| 278 | 3300045976 | Ga0466967_0027849 | Ga0466967_0027849_205_2400 | 714 |
| 279 | 3300045976 | Ga0466967_0068658 | Ga0466967_0068658_458_2647 | 714 |
| 280 | 3300048908 | Ga0496105_0015933 | Ga0496105_0015933_806_3340 | 714 |
| 281 | 3300048912 | Ga0496109_0009580 | Ga0496109_0009580_3704_6238 | 714 |
| 282 | 3300048914 | Ga0496111_0000725 | Ga0496111_0000725_80_2614 | 714 |
| 283 | 3300048921 | Ga0496118_0000236 | Ga0496118_0000236_11901_14096 | 714 |
| 284 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_704740_707013 | 714 |
| 285 | 3300049571 | Ga0501034_0005252 | Ga0501034_0005252_393_2594 | 714 |
| 286 | 3300049572 | Ga0501036_0009172 | Ga0501036_0009172_1196_3397 | 714 |
| 287 | 3300049573 | Ga0501037_0001079 | Ga0501037_0001079_9990_12191 | 714 |
| 288 | 3300049574 | Ga0501038_0045817 | Ga0501038_0045817_236_2437 | 714 |
| 289 | 3300049579 | Ga0501043_0001189 | Ga0501043_0001189_10590_12791 | 714 |
| 290 | 3300049581 | Ga0501047_0003811 | Ga0501047_0003811_10568_12769 | 714 |
| 291 | 3300049582 | Ga0501048_0003279 | Ga0501048_0003279_6636_8837 | 714 |
| 292 | 3300053730 | Ga0500645_000013 | Ga0500645_000013_140448_142643 | 714 |
| 293 | iso_pu_bacteria | 2643221613 | 2644083514 | 714 |
| 294 | iso_pu_bacteria | 2643221721 | 2644664290 | 714 |
| 295 | iso_pu_bacteria | 2687453737 | 2689959782 | 714 |
| 296 | iso_pu_bacteria | 2929212328 | 2929216884 | 714 |
| 297 | iso_pu_bacteria | 2935890801 | 2935892891 | 714 |
| 298 | iso_pu_bacteria | 8002784119 | 8002789596 | 714 |
| 299 | 3300005436 | Ga0070713_100041209 | Ga0070713_1000412092 | 715 |
| 300 | 3300005439 | Ga0070711_100003675 | Ga0070711_1000036756 | 715 |
| 301 | 3300005455 | Ga0070663_100009689 | Ga0070663_1000096892 | 715 |
| 302 | 3300005614 | Ga0068856_100016752 | Ga0068856_1000167523 | 715 |
| 303 | 3300005617 | Ga0068859_100000861 | Ga0068859_10000086111 | 715 |
| 304 | 3300005844 | Ga0068862_100000025 | Ga0068862_10000002511 | 715 |
| 305 | 3300006931 | Ga0097620_100000861 | Ga0097620_10000086115 | 715 |
| 306 | 3300025929 | Ga0207664_10014714 | Ga0207664_100147143 | 715 |
| 307 | 3300025929 | Ga0207664_10016582 | Ga0207664_100165823 | 715 |
| 308 | 3300025939 | Ga0207665_10031285 | Ga0207665_100312851 | 715 |
| 309 | 3300026078 | Ga0207702_10015965 | Ga0207702_100159652 | 715 |
| 310 | 3300026118 | Ga0207675_100038085 | Ga0207675_1000380852 | 715 |
| 311 | 3300028380 | Ga0268265_10000112 | Ga0268265_1000011287 | 715 |
| 312 | 3300028666 | Ga0265336_10001667 | Ga0265336_100016674 | 715 |
| 313 | 3300031456 | Ga0307513_10000711 | Ga0307513_1000071132 | 715 |
| 314 | 3300036712 | Ga0316584_0034838 | Ga0316584_0034838_940_3132 | 715 |
| 315 | 3300039437 | Ga0436365_1876162 | Ga0436365_1876162_3034_5232 | 715 |
| 316 | 3300044684 | Ga0466966_0001592 | Ga0466966_0001592_3100_5307 | 715 |
| 317 | 3300044693 | Ga0466961_0007726 | Ga0466961_0007726_80_2287 | 715 |
| 318 | 3300044842 | Ga0466957_0005992 | Ga0466957_0005992_45_2252 | 715 |
| 319 | 3300044901 | Ga0466960_0019673 | Ga0466960_0019673_255_2711 | 715 |
| 320 | 3300045049 | Ga0466959_0003841 | Ga0466959_0003841_2184_4391 | 715 |
| 321 | 3300045836 | Ga0466958_0018312 | Ga0466958_0018312_192_2399 | 715 |
| 322 | 3300047673 | Ga0495593_0009493 | Ga0495593_0009493_2877_5225 | 715 |
| 323 | 3300048913 | Ga0496110_0020528 | Ga0496110_0020528_893_3427 | 715 |
| 324 | 3300048922 | Ga0496119_0011055 | Ga0496119_0011055_49_2259 | 715 |
| 325 | 3300050492 | nmdc:mga0yw44_25700_c1 | nmdc:mga0yw44_25700_c1_1130_3328 | 715 |
| 326 | iso_pu_bacteria | 2687453743 | 2689995653 | 715 |
| 327 | iso_pu_bacteria | 2751185734 | 2753070576 | 715 |
| 328 | iso_pu_bacteria | 2795385470 | 2795786359 | 715 |
| 329 | iso_pu_bacteria | 8002775197 | 8002775291 | 715 |
| 330 | 3300005468 | Ga0070707_100000256 | Ga0070707_10000025644 | 716 |
| 331 | 3300005471 | Ga0070698_100000333 | Ga0070698_10000033339 | 716 |
| 332 | 3300006914 | Ga0075436_100006150 | Ga0075436_1000061502 | 716 |
| 333 | 3300006914 | Ga0075436_100009887 | Ga0075436_1000098872 | 716 |
| 334 | 3300009147 | Ga0114129_10008499 | Ga0114129_100084997 | 716 |
| 335 | 3300013105 | Ga0157369_10064360 | Ga0157369_100643602 | 716 |
| 336 | 3300025910 | Ga0207684_10032201 | Ga0207684_100322012 | 716 |
| 337 | 3300025917 | Ga0207660_10003721 | Ga0207660_100037213 | 716 |
| 338 | 3300025921 | Ga0207652_10001553 | Ga0207652_100015535 | 716 |
| 339 | 3300025922 | Ga0207646_10001124 | Ga0207646_1000112429 | 716 |
| 340 | 3300046455 | Ga0495603_0034409 | Ga0495603_0034409_687_2969 | 716 |
| 341 | 3300048911 | Ga0496108_0023644 | Ga0496108_0023644_132_2342 | 716 |
| 342 | 3300048914 | Ga0496111_0027288 | Ga0496111_0027288_20_2230 | 716 |
| 343 | 3300050507 | nmdc:mga05p37_16596_c1 | nmdc:mga05p37_16596_c1_6100_8598 | 716 |
| 344 | 3300050511 | nmdc:mga08y16_18653_c1 | nmdc:mga08y16_18653_c1_2109_4607 | 716 |
| 345 | 3300050512 | nmdc:mga0n895_90077_c1 | nmdc:mga0n895_90077_c1_147_2564 | 716 |
| 346 | 3300050513 | nmdc:mga0rr50_26275_c1 | nmdc:mga0rr50_26275_c1_653_3151 | 716 |
| 347 | 3300050514 | nmdc:mga08x19_24473_c1 | nmdc:mga08x19_24473_c1_971_3388 | 716 |
| 348 | 3300050515 | nmdc:mga0a205_8924_c1 | nmdc:mga0a205_8924_c1_1244_3742 | 716 |
| 349 | iso_pu_bacteria | 2508501039 | 2508672549 | 716 |
| 350 | iso_pu_bacteria | 2675902999 | 2676202210 | 716 |
| 351 | iso_pu_bacteria | 2773857921 | 2774846786 | 716 |
| 352 | iso_pu_bacteria | 2835188231 | 2835189656 | 716 |
| 353 | iso_pu_bacteria | 2902799365 | 2902801968 | 716 |
| 354 | 3300005334 | Ga0068869_100001048 | Ga0068869_1000010483 | 717 |
| 355 | 3300005337 | Ga0070682_100001669 | Ga0070682_1000016695 | 717 |
| 356 | 3300005344 | Ga0070661_100032950 | Ga0070661_1000329502 | 717 |
| 357 | 3300005345 | Ga0070692_10005633 | Ga0070692_100056333 | 717 |
| 358 | 3300005355 | Ga0070671_100010643 | Ga0070671_1000106433 | 717 |
| 359 | 3300005455 | Ga0070663_100006716 | Ga0070663_1000067163 | 717 |
| 360 | 3300005456 | Ga0070678_100004156 | Ga0070678_1000041562 | 717 |
| 361 | 3300005471 | Ga0070698_100027060 | Ga0070698_1000270603 | 717 |
| 362 | 3300005530 | Ga0070679_100044375 | Ga0070679_1000443752 | 717 |
| 363 | 3300005547 | Ga0070693_100001131 | Ga0070693_10000113110 | 717 |
| 364 | 3300005548 | Ga0070665_100006766 | Ga0070665_1000067667 | 717 |
| 365 | 3300005615 | Ga0070702_100001528 | Ga0070702_1000015284 | 717 |
| 366 | 3300005616 | Ga0068852_100015733 | Ga0068852_1000157332 | 717 |
| 367 | 3300005840 | Ga0068870_10005205 | Ga0068870_100052053 | 717 |
| 368 | 3300005842 | Ga0068858_100008158 | Ga0068858_1000081585 | 717 |
| 369 | 3300006173 | Ga0070716_100021851 | Ga0070716_1000218511 | 717 |
| 370 | 3300006852 | Ga0075433_10009007 | Ga0075433_100090074 | 717 |
| 371 | 3300006871 | Ga0075434_100047739 | Ga0075434_1000477392 | 717 |
| 372 | 3300007076 | Ga0075435_100016314 | Ga0075435_1000163143 | 717 |
| 373 | 3300009011 | Ga0105251_10010655 | Ga0105251_100106552 | 717 |
| 374 | 3300009174 | Ga0105241_10004557 | Ga0105241_100045575 | 717 |
| 375 | 3300009177 | Ga0105248_10031957 | Ga0105248_100319572 | 717 |
| 376 | 3300011119 | Ga0105246_10004714 | Ga0105246_100047143 | 717 |
| 377 | 3300014497 | Ga0182008_10008911 | Ga0182008_100089113 | 717 |
| 378 | 3300021388 | Ga0213875_10003958 | Ga0213875_100039588 | 717 |
| 379 | 3300022467 | Ga0224712_10016615 | Ga0224712_100166151 | 717 |
| 380 | 3300025900 | Ga0207710_10007989 | Ga0207710_100079893 | 717 |
| 381 | 3300025901 | Ga0207688_10002421 | Ga0207688_100024213 | 717 |
| 382 | 3300025907 | Ga0207645_10016955 | Ga0207645_100169552 | 717 |
| 383 | 3300025908 | Ga0207643_10000047 | Ga0207643_1000004764 | 717 |
| 384 | 3300025909 | Ga0207705_10033227 | Ga0207705_100332272 | 717 |
| 385 | 3300025911 | Ga0207654_10002775 | Ga0207654_100027754 | 717 |
| 386 | 3300025912 | Ga0207707_10018376 | Ga0207707_100183762 | 717 |
| 387 | 3300025917 | Ga0207660_10003517 | Ga0207660_100035177 | 717 |
| 388 | 3300025921 | Ga0207652_10016234 | Ga0207652_100162343 | 717 |
| 389 | 3300025925 | Ga0207650_10002188 | Ga0207650_100021882 | 717 |
| 390 | 3300025927 | Ga0207687_10006723 | Ga0207687_100067234 | 717 |
| 391 | 3300025931 | Ga0207644_10006599 | Ga0207644_100065993 | 717 |
| 392 | 3300025942 | Ga0207689_10002053 | Ga0207689_100020533 | 717 |
| 393 | 3300025944 | Ga0207661_10007732 | Ga0207661_100077323 | 717 |
| 394 | 3300025945 | Ga0207679_10008686 | Ga0207679_100086863 | 717 |
| 395 | 3300026035 | Ga0207703_10007913 | Ga0207703_100079133 | 717 |
| 396 | 3300026078 | Ga0207702_10002814 | Ga0207702_100028148 | 717 |
| 397 | 3300026095 | Ga0207676_10002096 | Ga0207676_100020966 | 717 |
| 398 | 3300026116 | Ga0207674_10007503 | Ga0207674_100075032 | 717 |
| 399 | 3300026142 | Ga0207698_10017775 | Ga0207698_100177753 | 717 |
| 400 | 3300027907 | Ga0207428_10003971 | Ga0207428_1000397110 | 717 |
| 401 | 3300031691 | Ga0316579_10019126 | Ga0316579_100191262 | 717 |
| 402 | 3300031727 | Ga0316576_10000368 | Ga0316576_1000036814 | 717 |
| 403 | 3300031733 | Ga0316577_10033530 | Ga0316577_100335302 | 717 |
| 404 | 3300032133 | Ga0316583_10000069 | Ga0316583_100000696 | 717 |
| 405 | 3300032137 | Ga0316585_10009741 | Ga0316585_100097412 | 717 |
| 406 | 3300035398 | Ga0316574_0000932 | Ga0316574_0000932_31_2232 | 717 |
| 407 | 3300036712 | Ga0316584_0038360 | Ga0316584_0038360_938_3139 | 717 |
| 408 | 3300042005 | Ga0439448_0004301 | Ga0439448_0004301_595_2961 | 717 |
| 409 | 3300045976 | Ga0466967_0021513 | Ga0466967_0021513_2270_4471 | 717 |
| 410 | 3300048905 | Ga0496102_0015452 | Ga0496102_0015452_1155_3521 | 717 |
| 411 | 3300048907 | Ga0496104_0036069 | Ga0496104_0036069_1876_4242 | 717 |
| 412 | 3300048908 | Ga0496105_0005746 | Ga0496105_0005746_5314_7680 | 717 |
| 413 | 3300048909 | Ga0496106_0002569 | Ga0496106_0002569_3701_6067 | 717 |
| 414 | 3300048913 | Ga0496110_0015571 | Ga0496110_0015571_1759_4125 | 717 |
| 415 | 3300048914 | Ga0496111_0000804 | Ga0496111_0000804_8233_10599 | 717 |
| 416 | 3300050512 | nmdc:mga0n895_6584_c1 | nmdc:mga0n895_6584_c1_6293_8659 | 717 |
| 417 | 3300050515 | nmdc:mga0a205_30290_c1 | nmdc:mga0a205_30290_c1_1361_3727 | 717 |
| 418 | 3300053153 | Ga0500616_0000562 | Ga0500616_0000562_36819_39023 | 717 |
| 419 | iso_pu_bacteria | 2671180195 | 2671840179 | 717 |
| 420 | iso_pu_bacteria | 2773857922 | 2774858335 | 717 |
| 421 | iso_pu_bacteria | 2917736166 | 2917739285 | 717 |
| 422 | 3300005436 | Ga0070713_100031239 | Ga0070713_1000312393 | 718 |
| 423 | 3300005545 | Ga0070695_100007897 | Ga0070695_1000078972 | 718 |
| 424 | iso_pu_bacteria | 2895880812 | 2895889509 | 718 |
| 425 | iso_pu_bacteria | 2897561785 | 2897564404 | 718 |
| 426 | 3300031903 | Ga0307407_10008241 | Ga0307407_100082412 | 719 |
| 427 | 3300005458 | Ga0070681_10000009 | Ga0070681_1000000978 | 720 |
| 428 | 3300005530 | Ga0070679_100000107 | Ga0070679_1000001076 | 720 |
| 429 | 3300006880 | Ga0075429_100058487 | Ga0075429_1000584872 | 720 |
| 430 | 3300025912 | Ga0207707_10000458 | Ga0207707_1000045824 | 720 |
| 431 | 3300025917 | Ga0207660_10000649 | Ga0207660_100006499 | 720 |
| 432 | 3300025921 | Ga0207652_10000118 | Ga0207652_1000011824 | 720 |
| 433 | 3300028573 | Ga0265334_10001544 | Ga0265334_100015442 | 720 |
| 434 | 3300028800 | Ga0265338_10034428 | Ga0265338_100344282 | 720 |
| 435 | 3300048905 | Ga0496102_0114179 | Ga0496102_0114179_128_2308 | 720 |
| 436 | 3300050508 | nmdc:mga09592_45905_c1 | nmdc:mga09592_45905_c1_1372_3570 | 720 |
| 437 | iso_pu_bacteria | 2506783011 | 2506868381 | 720 |
| 438 | iso_pu_bacteria | 2773857933 | 2774902763 | 720 |
| 439 | iso_pu_bacteria | 2870782633 | 2870783874 | 720 |
| 440 | 3300005441 | Ga0070700_100000032 | Ga0070700_10000003246 | 721 |
| 441 | 3300009101 | Ga0105247_10000199 | Ga0105247_100001996 | 721 |
| 442 | 3300009177 | Ga0105248_10000603 | Ga0105248_1000060336 | 721 |
| 443 | 3300025900 | Ga0207710_10000120 | Ga0207710_1000012051 | 721 |
| 444 | 3300025941 | Ga0207711_10007649 | Ga0207711_100076492 | 721 |
| 445 | 3300028556 | Ga0265337_1009950 | Ga0265337_10099502 | 721 |
| 446 | 3300028577 | Ga0265318_10006271 | Ga0265318_100062712 | 721 |
| 447 | 3300048907 | Ga0496104_0002450 | Ga0496104_0002450_13245_15785 | 721 |
| 448 | 3300048923 | Ga0496120_0000365 | Ga0496120_0000365_21642_24185 | 721 |
| 449 | iso_pu_bacteria | 2842134933 | 2842140151 | 721 |
| 450 | iso_pu_bacteria | 2932398195 | 2932399387 | 721 |
| 451 | 3300005983 | Ga0081540_1000162 | Ga0081540_100016232 | 734 |
| 452 | 3300005983 | Ga0081540_1000470 | Ga0081540_100047012 | 735 |
| 453 | 3300005329 | Ga0070683_100046666 | Ga0070683_1000466661 | 736 |
| 454 | 3300025945 | Ga0207679_10001188 | Ga0207679_100011887 | 736 |
| 455 | 3300042876 | Ga0451577_0019727 | Ga0451577_0019727_285_2495 | 736 |
| 456 | 3300045051 | Ga0451576_0010150 | Ga0451576_0010150_7747_9957 | 736 |
| 457 | 3300005327 | Ga0070658_10000801 | Ga0070658_100008012 | 739 |
| 458 | 3300005329 | Ga0070683_100002373 | Ga0070683_1000023734 | 739 |
| 459 | 3300005330 | Ga0070690_100000330 | Ga0070690_1000003305 | 739 |
| 460 | 3300005331 | Ga0070670_100028489 | Ga0070670_1000284893 | 739 |
| 461 | 3300005333 | Ga0070677_10000074 | Ga0070677_1000007412 | 739 |
| 462 | 3300005334 | Ga0068869_100000496 | Ga0068869_1000004964 | 739 |
| 463 | 3300005335 | Ga0070666_10002930 | Ga0070666_100029307 | 739 |
| 464 | 3300005338 | Ga0068868_100000319 | Ga0068868_1000003192 | 739 |
| 465 | 3300005339 | Ga0070660_100000981 | Ga0070660_10000098111 | 739 |
| 466 | 3300005340 | Ga0070689_100001499 | Ga0070689_1000014993 | 739 |
| 467 | 3300005343 | Ga0070687_100000001 | Ga0070687_10000000163 | 739 |
| 468 | 3300005344 | Ga0070661_100000069 | Ga0070661_1000000696 | 739 |
| 469 | 3300005347 | Ga0070668_100001308 | Ga0070668_10000130811 | 739 |
| 470 | 3300005353 | Ga0070669_100001342 | Ga0070669_1000013424 | 739 |
| 471 | 3300005354 | Ga0070675_100000424 | Ga0070675_10000042415 | 739 |
| 472 | 3300005355 | Ga0070671_100010605 | Ga0070671_1000106053 | 739 |
| 473 | 3300005356 | Ga0070674_100002261 | Ga0070674_1000022616 | 739 |
| 474 | 3300005364 | Ga0070673_100003308 | Ga0070673_1000033083 | 739 |
| 475 | 3300005366 | Ga0070659_100001237 | Ga0070659_1000012374 | 739 |
| 476 | 3300005367 | Ga0070667_100003402 | Ga0070667_1000034024 | 739 |
| 477 | 3300005440 | Ga0070705_100000880 | Ga0070705_1000008807 | 739 |
| 478 | 3300005455 | Ga0070663_100006471 | Ga0070663_1000064713 | 739 |
| 479 | 3300005456 | Ga0070678_100001632 | Ga0070678_1000016327 | 739 |
| 480 | 3300005457 | Ga0070662_100000847 | Ga0070662_10000084711 | 739 |
| 481 | 3300005459 | Ga0068867_100015425 | Ga0068867_1000154253 | 739 |
| 482 | 3300005466 | Ga0070685_10004058 | Ga0070685_100040584 | 739 |
| 483 | 3300005539 | Ga0068853_100000106 | Ga0068853_10000010647 | 739 |
| 484 | 3300005543 | Ga0070672_100003652 | Ga0070672_1000036524 | 739 |
| 485 | 3300005544 | Ga0070686_100000313 | Ga0070686_10000031315 | 739 |
| 486 | 3300005563 | Ga0068855_100006655 | Ga0068855_1000066558 | 739 |
| 487 | 3300005564 | Ga0070664_100001951 | Ga0070664_1000019514 | 739 |
| 488 | 3300005577 | Ga0068857_100010932 | Ga0068857_1000109322 | 739 |
| 489 | 3300005578 | Ga0068854_100001733 | Ga0068854_1000017334 | 739 |
| 490 | 3300005614 | Ga0068856_100000478 | Ga0068856_1000004785 | 739 |
| 491 | 3300005616 | Ga0068852_100001697 | Ga0068852_1000016973 | 739 |
| 492 | 3300005618 | Ga0068864_100003341 | Ga0068864_1000033416 | 739 |
| 493 | 3300005718 | Ga0068866_10000470 | Ga0068866_100004703 | 739 |
| 494 | 3300005719 | Ga0068861_100006435 | Ga0068861_1000064353 | 739 |
| 495 | 3300005834 | Ga0068851_10000340 | Ga0068851_1000034012 | 739 |
| 496 | 3300005840 | Ga0068870_10000085 | Ga0068870_100000852 | 739 |
| 497 | 3300005841 | Ga0068863_100003940 | Ga0068863_1000039406 | 739 |
| 498 | 3300005842 | Ga0068858_100033012 | Ga0068858_1000330122 | 739 |
| 499 | 3300005843 | Ga0068860_100001788 | Ga0068860_1000017884 | 739 |
| 500 | 3300005844 | Ga0068862_100007334 | Ga0068862_1000073342 | 739 |
| 501 | 3300005983 | Ga0081540_1000939 | Ga0081540_100093912 | 739 |
| 502 | 3300009093 | Ga0105240_10017695 | Ga0105240_100176955 | 739 |
| 503 | 3300009098 | Ga0105245_10001442 | Ga0105245_100014426 | 739 |
| 504 | 3300009101 | Ga0105247_10002920 | Ga0105247_100029206 | 739 |
| 505 | 3300009148 | Ga0105243_10002605 | Ga0105243_100026056 | 739 |
| 506 | 3300009174 | Ga0105241_10014214 | Ga0105241_100142144 | 739 |
| 507 | 3300009176 | Ga0105242_10000388 | Ga0105242_1000038823 | 739 |
| 508 | 3300009545 | Ga0105237_10000276 | Ga0105237_1000027631 | 739 |
| 509 | 3300009551 | Ga0105238_10000302 | Ga0105238_1000030232 | 739 |
| 510 | 3300009553 | Ga0105249_10001178 | Ga0105249_100011784 | 739 |
| 511 | 3300010375 | Ga0105239_10000686 | Ga0105239_1000068633 | 739 |
| 512 | 3300011119 | Ga0105246_10001043 | Ga0105246_100010435 | 739 |
| 513 | 3300013102 | Ga0157371_10000234 | Ga0157371_1000023447 | 739 |
| 514 | 3300013105 | Ga0157369_10000365 | Ga0157369_1000036532 | 739 |
| 515 | 3300013296 | Ga0157374_10012474 | Ga0157374_100124744 | 739 |
| 516 | 3300013297 | Ga0157378_10000488 | Ga0157378_1000048831 | 739 |
| 517 | 3300013306 | Ga0163162_10001380 | Ga0163162_1000138017 | 739 |
| 518 | 3300013307 | Ga0157372_10057691 | Ga0157372_100576912 | 739 |
| 519 | 3300013308 | Ga0157375_10018083 | Ga0157375_100180832 | 739 |
| 520 | 3300014325 | Ga0163163_10007989 | Ga0163163_100079895 | 739 |
| 521 | 3300014745 | Ga0157377_10000288 | Ga0157377_100002882 | 739 |
| 522 | 3300014968 | Ga0157379_10000247 | Ga0157379_1000024731 | 739 |
| 523 | 3300014969 | Ga0157376_10000866 | Ga0157376_1000086613 | 739 |
| 524 | 3300025315 | Ga0207697_10001817 | Ga0207697_100018176 | 739 |
| 525 | 3300025321 | Ga0207656_10002698 | Ga0207656_100026984 | 739 |
| 526 | 3300025900 | Ga0207710_10001028 | Ga0207710_100010284 | 739 |
| 527 | 3300025901 | Ga0207688_10000003 | Ga0207688_1000000327 | 739 |
| 528 | 3300025907 | Ga0207645_10000022 | Ga0207645_1000002275 | 739 |
| 529 | 3300025908 | Ga0207643_10000011 | Ga0207643_1000001197 | 739 |
| 530 | 3300025914 | Ga0207671_10012428 | Ga0207671_100124284 | 739 |
| 531 | 3300025918 | Ga0207662_10000004 | Ga0207662_1000000489 | 739 |
| 532 | 3300025919 | Ga0207657_10000055 | Ga0207657_1000005523 | 739 |
| 533 | 3300025925 | Ga0207650_10000213 | Ga0207650_1000021346 | 739 |
| 534 | 3300025926 | Ga0207659_10000392 | Ga0207659_1000039212 | 739 |
| 535 | 3300025927 | Ga0207687_10045044 | Ga0207687_100450442 | 739 |
| 536 | 3300025931 | Ga0207644_10006863 | Ga0207644_100068634 | 739 |
| 537 | 3300025932 | Ga0207690_10007808 | Ga0207690_100078084 | 739 |
| 538 | 3300025933 | Ga0207706_10000152 | Ga0207706_1000015231 | 739 |
| 539 | 3300025935 | Ga0207709_10008172 | Ga0207709_100081722 | 739 |
| 540 | 3300025936 | Ga0207670_10000208 | Ga0207670_100002085 | 739 |
| 541 | 3300025937 | Ga0207669_10000264 | Ga0207669_100002647 | 739 |
| 542 | 3300025938 | Ga0207704_10000425 | Ga0207704_100004254 | 739 |
| 543 | 3300025940 | Ga0207691_10000457 | Ga0207691_1000045734 | 739 |
| 544 | 3300025941 | Ga0207711_10001044 | Ga0207711_1000104412 | 739 |
| 545 | 3300025942 | Ga0207689_10000245 | Ga0207689_100002454 | 739 |
| 546 | 3300025945 | Ga0207679_10001077 | Ga0207679_1000107710 | 739 |
| 547 | 3300025960 | Ga0207651_10000377 | Ga0207651_100003774 | 739 |
| 548 | 3300025961 | Ga0207712_10001866 | Ga0207712_100018664 | 739 |
| 549 | 3300025981 | Ga0207640_10026838 | Ga0207640_100268382 | 739 |
| 550 | 3300026023 | Ga0207677_10000407 | Ga0207677_100004071 | 739 |
| 551 | 3300026035 | Ga0207703_10001767 | Ga0207703_1000176711 | 739 |
| 552 | 3300026041 | Ga0207639_10002454 | Ga0207639_100024544 | 739 |
| 553 | 3300026067 | Ga0207678_10013620 | Ga0207678_100136204 | 739 |
| 554 | 3300026075 | Ga0207708_10003774 | Ga0207708_100037744 | 739 |
| 555 | 3300026078 | Ga0207702_10003518 | Ga0207702_100035184 | 739 |
| 556 | 3300026088 | Ga0207641_10002896 | Ga0207641_1000289611 | 739 |
| 557 | 3300026089 | Ga0207648_10000094 | Ga0207648_1000009444 | 739 |
| 558 | 3300026116 | Ga0207674_10000942 | Ga0207674_1000094219 | 739 |
| 559 | 3300026118 | Ga0207675_100000004 | Ga0207675_10000000498 | 739 |
| 560 | 3300026121 | Ga0207683_10000007 | Ga0207683_1000000771 | 739 |
| 561 | 3300028379 | Ga0268266_10001966 | Ga0268266_100019664 | 739 |
| 562 | 3300028380 | Ga0268265_10002022 | Ga0268265_1000202211 | 739 |
| 563 | 3300028381 | Ga0268264_10000729 | Ga0268264_1000072931 | 739 |
| 564 | 3300048905 | Ga0496102_0002119 | Ga0496102_0002119_14390_16609 | 739 |
| 565 | 3300048911 | Ga0496108_0062639 | Ga0496108_0062639_878_3097 | 739 |
| 566 | 3300048915 | Ga0496112_0009675 | Ga0496112_0009675_4078_6297 | 739 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5e6z-assembly3.cif.gz_C | crystal structure of ecoli branching enzyme with beta cyclodextrin | 0.97 | 120 | 732 |
| 5e70-assembly3.cif.gz_C | crystal structure of ecoli branching enzyme with gamma cyclodextrin | 0.9696 | 120 | 732 |
| 1m7x-assembly2.cif.gz_B | the x-ray crystallographic structure of branching enzyme | 0.9688 | 122 | 732 |
| 5e6y-assembly2.cif.gz_B | crystal structure of e.coli branching enzyme in complex with alpha cyclodextrin | 0.9673 | 120 | 732 |
| 1m7x-assembly3.cif.gz_C | the x-ray crystallographic structure of branching enzyme | 0.9672 | 120 | 732 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P07762_230_612_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9799 | 238 | 616 | 3.20.20.80 |
| af_P07762_103_221_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9795 | 105 | 224 | 2.60.40.10 |
| af_P07762_103_221_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9715 | 105 | 224 | 2.60.40.10 |
| af_P07762_230_612_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9672 | 238 | 616 | 3.20.20.80 |
| 3k1dA03 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.9672 | 629 | 732 | 2.60.40.1180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A8BXL6-F1-model_v4 | 1,4-alpha-glucan branching enzyme | 0.9964 | 485 | 593 |
GO:0003844
GO:0005829 GO:0005978 |
| AF-A0A529PXB5-F1-model_v4 | 1,4-alpha-glucan branching enzyme | 0.9926 | 477 | 579 |
GO:0003844
GO:0005829 GO:0005978 |
| AF-A0A367M0P4-F1-model_v4 | 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) | 0.9917 | 480 | 685 |
GO:0003844
GO:0005829 GO:0005978 GO:0043169 |
| AF-A0A7X5N0R0-F1-model_v4 | 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) | 0.9904 | 323 | 613 |
GO:0003844
GO:0005829 GO:0005978 |
| AF-T1DHB5-F1-model_v4 | Glycogen branching enzyme | 0.9904 | 489 | 732 |
GO:0003844
GO:0005829 GO:0005978 GO:0043169 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar