F464464

General Info

Members Datasets Scaffolds Average Seq Length
566 346 535 744

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2773857933|2774902763
Length 872
Sequence DGAAGGVDEGQPGSCRRDASGPPSDASSGLARSPLPAMAMAGHGGXRRGNDHDDAGYDDTRYDDARYDTRYSEGGGYPETAYRDGGRDRGEHTAAQHDRAERGTTGQSGAERDAGGQDAPASSPPSLLVDTAELERLVNGSHHDPHHILGAHPHGDWTIVRALRPDAVGVVVITENERFECTRLHTAGVFAVALPTGAVPGYRLEVQYCDATHVVDDPYRHLPTLGEMDLHLIGEGRHEQLWKALGARVRRYPDSTGTAEVSGVGFAXWAPNARGVRVVGDFDFWDGRAYPMRSLGATGVWELFVPGIGAGCRYKYEILGFDGVWRQKADPLALHTENPPATASVVFESDYTWSDEAWLARRRRTAWHAMPISVYEVHLGSWRRGLSYRQLATELVAHVREMGFTHVELLPVAEHPFGGSWGYQVSAYYAPTSRFGDPDDFRYLVDQLHQAGIGVIVDWVPAHFPRDVWALGRFDGTPLYEHPDPRRGEQPDWGTYVFDFGRPEVRNFLVANAVYWFEEFHIDGLRVDAVASMLYLDYSRAEGEWIPNIHGGRENLDAVSFLQETNATVYRRVPGVMMIAEESTAWPGVTRPTHLGGLGFGFKWNMGWMHDTLDYLSRAPVFRVYHHHQMTFSMMYAYSENFVLPLSHDEVVHXKGSLLRKMPGDRWQQLANLRALYGYMWAHPGKQLLFMGGEFAQEAEWSEARSLDWWHLDDPDHRGVATLLKDLNGAYRATPALWERDISPEGFSWIDANDAENNVFSFLRWAADPTADPAGGPAGGPAASTATSGRVLACVTNFSGVPHTGYQLGLPFAGRWRELINTDATEYAGSGLGNLGSVLAVEATRHNQPASVTLTLPALSTLWLCYEGAAQN

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2508501039 Frankia saprophytica CN3 Isolate Nodule
3 2517572101 Frankia sp. DC12 Isolate Nodule
4 2558860280 Kutzneria sp. 744 Isolate Unclassified
5 2643221613 Oerskovia sp. Root22 Isolate Unclassified
6 2643221721 Oerskovia sp. Root918 Isolate Unclassified
7 2671180195 Frankia sp. CcI49 Isolate Nodule
8 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
9 2687453737 Frankia sp. BMG5.36 Isolate Nodule
10 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
11 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
12 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
13 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
14 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
15 2773857922 Frankia sp. CcI49 Isolate Nodule
16 2773857933 Frankia sp. BMG5.30 Isolate Nodule
17 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
18 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
19 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
20 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
21 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
22 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
23 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
24 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
25 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
26 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
27 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
28 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
29 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
205 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
206 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
207 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
208 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
220 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
224 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
225 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
241 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
345 8002775197 Frankia nepalensis CN7 Isolate Nodule
346 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.93
Metatranscriptomes 1.59
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 2.3
Rhizoplane 5.48
Rhizosphere 84.81
Stem 0
Stem Tuber 0
Unclassified 6.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000801 3300005327 Bacteria 26940
2 Ga0070658_10001237 3300005327 Bacteria 21904
3 Ga0070658_10035027 3300005327 Bacteria 4042
4 Ga0070683_100002373 3300005329 Bacteria 14950
5 Ga0070683_100046666 3300005329 Bacteria 4003
6 Ga0070683_100051744 3300005329 Bacteria 3803
7 Ga0070690_100000330 3300005330 Bacteria 24199
8 Ga0070670_100028489 3300005331 Bacteria 4807
9 Ga0070677_10000074 3300005333 Bacteria 31454
10 Ga0068869_100000496 3300005334 Bacteria 21863
11 Ga0068869_100001048 3300005334 Bacteria 16110
12 Ga0070666_10002219 3300005335 Bacteria 11744
13 Ga0070666_10002930 3300005335 Bacteria 10319
14 Ga0070682_100001669 3300005337 Bacteria 12348
15 Ga0068868_100000319 3300005338 Bacteria 32296
16 Ga0070660_100000981 3300005339 Bacteria 19095
17 Ga0070689_100001499 3300005340 Bacteria 14880
18 Ga0070687_100000001 3300005343 Bacteria 110332
19 Ga0070661_100000069 3300005344 Bacteria 83366
20 Ga0070661_100032950 3300005344 Bacteria 3753
21 Ga0070692_10005633 3300005345 Bacteria 5369
22 Ga0070668_100001308 3300005347 Bacteria 17812
23 Ga0070669_100001342 3300005353 Bacteria 17727
24 Ga0070675_100000424 3300005354 Bacteria 28747
25 Ga0070671_100010605 3300005355 Bacteria 7398
26 Ga0070671_100010643 3300005355 Bacteria 7383
27 Ga0070674_100002261 3300005356 Bacteria 10628
28 Ga0070673_100003308 3300005364 Bacteria 10013
29 Ga0070659_100000761 3300005366 Bacteria 23410
30 Ga0070659_100001237 3300005366 Bacteria 18542
31 Ga0070667_100003402 3300005367 Bacteria 13547
32 Ga0070667_100011129 3300005367 Bacteria 7441
33 Ga0070667_100049214 3300005367 Bacteria 3549
34 Ga0070709_10000636 3300005434 Bacteria 20015
35 Ga0070709_10008912 3300005434 Bacteria 5523
36 Ga0070709_10015554 3300005434 Bacteria 4332
37 Ga0070714_100000106 3300005435 Bacteria 70067
38 Ga0070713_100031239 3300005436 Bacteria 4240
39 Ga0070713_100041209 3300005436 Bacteria 3761
40 Ga0070710_10000359 3300005437 Bacteria 21439
41 Ga0070711_100003675 3300005439 Bacteria 8980
42 Ga0070705_100000880 3300005440 Bacteria 16799
43 Ga0070700_100000032 3300005441 Bacteria 114995
44 Ga0070708_100004383 3300005445 Bacteria 11086
45 Ga0070663_100006471 3300005455 Bacteria 7049
46 Ga0070663_100006716 3300005455 Bacteria 6942
47 Ga0070663_100009689 3300005455 Bacteria 5976
48 Ga0070678_100001632 3300005456 Bacteria 12002
49 Ga0070678_100004156 3300005456 Bacteria 8161
50 Ga0070662_100000847 3300005457 Bacteria 18783
51 Ga0070681_10000009 3300005458 Bacteria 146582
52 Ga0068867_100015425 3300005459 Bacteria 5419
53 Ga0070685_10004058 3300005466 Bacteria 7396
54 Ga0070706_100003956 3300005467 Bacteria 14432
55 Ga0070706_100005676 3300005467 Bacteria 11865
56 Ga0070706_100051660 3300005467 Bacteria 3794
57 Ga0070707_100000256 3300005468 Bacteria 53538
58 Ga0070707_100005079 3300005468 Bacteria 12333
59 Ga0070698_100000292 3300005471 Bacteria 50989
60 Ga0070698_100000333 3300005471 Bacteria 48484
61 Ga0070698_100002789 3300005471 Bacteria 19238
62 Ga0070698_100006885 3300005471 Bacteria 12316
63 Ga0070698_100027060 3300005471 Bacteria 5963
64 Ga0070699_100011216 3300005518 Bacteria 7743
65 Ga0070679_100000107 3300005530 Bacteria 65501
66 Ga0070679_100044375 3300005530 Bacteria 4429
67 Ga0068853_100000106 3300005539 Bacteria 56375
68 Ga0068853_100066537 3300005539 Bacteria 3129
69 Ga0070672_100003652 3300005543 Bacteria 9994
70 Ga0070686_100000313 3300005544 Bacteria 31975
71 Ga0070695_100007897 3300005545 Bacteria 6298
72 Ga0070693_100001131 3300005547 Bacteria 11958
73 Ga0070665_100006766 3300005548 Bacteria 11651
74 Ga0068855_100006655 3300005563 Bacteria 14037
75 Ga0070664_100001951 3300005564 Bacteria 16596
76 Ga0070664_100011125 3300005564 Bacteria 7297
77 Ga0068857_100010932 3300005577 Bacteria 7900
78 Ga0068854_100001733 3300005578 Bacteria 13306
79 Ga0068856_100000478 3300005614 Bacteria 44261
80 Ga0068856_100016752 3300005614 Bacteria 7100
81 Ga0068856_100023338 3300005614 Bacteria 6014
82 Ga0070702_100001528 3300005615 Bacteria 9527
83 Ga0068852_100001697 3300005616 Bacteria 15015
84 Ga0068852_100005201 3300005616 Bacteria 9280
85 Ga0068852_100015733 3300005616 Bacteria 5880
86 Ga0068859_100000861 3300005617 Bacteria 30912
87 Ga0068859_100028711 3300005617 Bacteria 5578
88 Ga0068859_100112361 3300005617 Bacteria 2787
89 Ga0068864_100003341 3300005618 Bacteria 13261
90 Ga0068866_10000470 3300005718 Bacteria 18469
91 Ga0068861_100006435 3300005719 Bacteria 8002
92 Ga0068851_10000340 3300005834 Bacteria 21099
93 Ga0068870_10000085 3300005840 Bacteria 30429
94 Ga0068870_10005205 3300005840 Bacteria 5664
95 Ga0068863_100000471 3300005841 Bacteria 41177
96 Ga0068863_100000697 3300005841 Bacteria 33736
97 Ga0068863_100003940 3300005841 Bacteria 14667
98 Ga0068858_100000032 3300005842 Bacteria 142794
99 Ga0068858_100008158 3300005842 Bacteria 10067
100 Ga0068858_100033012 3300005842 Bacteria 4807
101 Ga0068860_100001788 3300005843 Bacteria 22892
102 Ga0068862_100000025 3300005844 Bacteria 197313
103 Ga0068862_100007334 3300005844 Bacteria 9158
104 Ga0081455_10013968 3300005937 Bacteria 7893
105 Ga0081540_1000162 3300005983 Bacteria 68999
106 Ga0081540_1000250 3300005983 Bacteria 56639
107 Ga0081540_1000470 3300005983 Bacteria 39784
108 Ga0081540_1000939 3300005983 Bacteria 26205
109 Ga0081539_10037163 3300005985 Bacteria 2903
110 Ga0070717_10019169 3300006028 Bacteria 5361
111 Ga0075363_100016552 3300006048 Bacteria 3643
112 Ga0070715_10002273 3300006163 Bacteria 5842
113 Ga0070716_100006426 3300006173 Bacteria 5740
114 Ga0070716_100019306 3300006173 Bacteria 3561
115 Ga0070716_100021851 3300006173 Bacteria 3375
116 Ga0068871_100019675 3300006358 Bacteria 5158
117 Ga0075428_100049902 3300006844 Bacteria 4591
118 Ga0075430_100057171 3300006846 Bacteria 3281
119 Ga0075433_10009007 3300006852 Bacteria 7970
120 Ga0075434_100047739 3300006871 Bacteria 4248
121 Ga0075429_100058487 3300006880 Bacteria 3357
122 Ga0075436_100006150 3300006914 Bacteria 8240
123 Ga0075436_100009887 3300006914 Bacteria 6524
124 Ga0097620_100000861 3300006931 Bacteria 30912
125 Ga0097620_100028711 3300006931 Bacteria 5578
126 Ga0097620_100112361 3300006931 Bacteria 2787
127 Ga0075435_100016314 3300007076 Bacteria 5599
128 Ga0105251_10010655 3300009011 Bacteria 5310
129 Ga0105240_10017695 3300009093 Bacteria 9597
130 Ga0105245_10001442 3300009098 Bacteria 21578
131 Ga0105245_10027732 3300009098 Bacteria 4990
132 Ga0105247_10000199 3300009101 Bacteria 58949
133 Ga0105247_10001144 3300009101 Bacteria 19661
134 Ga0105247_10002920 3300009101 Bacteria 11372
135 Ga0114129_10008499 3300009147 Bacteria 14634
136 Ga0105243_10002605 3300009148 Bacteria 15039
137 Ga0105243_10073198 3300009148 Bacteria 2776
138 Ga0105241_10004557 3300009174 Bacteria 10251
139 Ga0105241_10014214 3300009174 Bacteria 5831
140 Ga0105241_10039580 3300009174 Bacteria 3557
141 Ga0105242_10000388 3300009176 Bacteria 34963
142 Ga0105248_10000044 3300009177 Bacteria 166533
143 Ga0105248_10000603 3300009177 Bacteria 40905
144 Ga0105248_10031957 3300009177 Bacteria 5882
145 Ga0105248_10099456 3300009177 Bacteria 3278
146 Ga0105237_10000276 3300009545 Bacteria 71919
147 Ga0105238_10000302 3300009551 Bacteria 53964
148 Ga0105249_10001178 3300009553 Bacteria 23152
149 Ga0105239_10000686 3300010375 Bacteria 48254
150 Ga0105239_10102606 3300010375 Bacteria 3165
151 Ga0105246_10001043 3300011119 Bacteria 15978
152 Ga0105246_10004714 3300011119 Bacteria 8301
153 Ga0157371_10000234 3300013102 Bacteria 79682
154 Ga0157369_10000365 3300013105 Bacteria 60316
155 Ga0157369_10000755 3300013105 Bacteria 41695
156 Ga0157369_10038585 3300013105 Bacteria 5223
157 Ga0157369_10041708 3300013105 Bacteria 5008
158 Ga0157369_10064360 3300013105 Bacteria 3949
159 Ga0157374_10012474 3300013296 Bacteria 7396
160 Ga0157378_10000488 3300013297 Bacteria 37515
161 Ga0157378_10010038 3300013297 Bacteria 8252
162 Ga0163162_10001380 3300013306 Bacteria 22602
163 Ga0157372_10000057 3300013307 Bacteria 125915
164 Ga0157372_10057691 3300013307 Bacteria 4340
165 Ga0157375_10018083 3300013308 Bacteria 6385
166 Ga0163163_10007989 3300014325 Bacteria 9362
167 Ga0182008_10008911 3300014497 Bacteria 5442
168 Ga0157377_10000288 3300014745 Bacteria 24011
169 Ga0157379_10000247 3300014968 Bacteria 42343
170 Ga0157376_10000866 3300014969 Bacteria 19857
171 Ga0197907_10937645 3300020069 Bacteria 4551
172 Ga0206349_1910650 3300020075 Bacteria 4343
173 Ga0206350_10028680 3300020080 Bacteria 4336
174 Ga0206353_10006789 3300020082 Bacteria 4966
175 Ga0206353_11070430 3300020082 Bacteria 3620
176 Ga0213876_10001728 3300021384 Bacteria 13275
177 Ga0213875_10000125 3300021388 Bacteria 85515
178 Ga0213875_10003958 3300021388 Bacteria 8270
179 Ga0224712_10001523 3300022467 Bacteria 5377
180 Ga0224712_10001825 3300022467 Bacteria 5093
181 Ga0224712_10016615 3300022467 Bacteria 2422
182 Ga0224712_10018270 3300022467 Bacteria 2341
183 Ga0207697_10001817 3300025315 Bacteria 11447
184 Ga0207656_10002698 3300025321 Bacteria 6022
185 Ga0207692_10022331 3300025898 Bacteria 2910
186 Ga0207710_10000082 3300025900 Bacteria 138091
187 Ga0207710_10000120 3300025900 Bacteria 96124
188 Ga0207710_10001028 3300025900 Bacteria 14541
189 Ga0207710_10007989 3300025900 Bacteria 4473
190 Ga0207688_10000003 3300025901 Bacteria 78666
191 Ga0207688_10002421 3300025901 Bacteria 10057
192 Ga0207685_10002014 3300025905 Bacteria 4518
193 Ga0207699_10006407 3300025906 Bacteria 5696
194 Ga0207699_10012710 3300025906 Bacteria 4286
195 Ga0207645_10000022 3300025907 Bacteria 103273
196 Ga0207645_10016955 3300025907 Bacteria 4812
197 Ga0207643_10000011 3300025908 Bacteria 150819
198 Ga0207643_10000047 3300025908 Bacteria 79590
199 Ga0207705_10001467 3300025909 Bacteria 18803
200 Ga0207705_10033227 3300025909 Bacteria 3685
201 Ga0207684_10003975 3300025910 Bacteria 14150
202 Ga0207684_10032201 3300025910 Bacteria 4459
203 Ga0207654_10002775 3300025911 Bacteria 8894
204 Ga0207707_10000458 3300025912 Bacteria 42371
205 Ga0207707_10018376 3300025912 Bacteria 6094
206 Ga0207671_10012428 3300025914 Bacteria 6845
207 Ga0207693_10005784 3300025915 Bacteria 10256
208 Ga0207663_10008102 3300025916 Bacteria 5477
209 Ga0207660_10000649 3300025917 Bacteria 23431
210 Ga0207660_10003517 3300025917 Bacteria 10203
211 Ga0207660_10003721 3300025917 Bacteria 9939
212 Ga0207662_10000004 3300025918 Bacteria 128333
213 Ga0207662_10012551 3300025918 Bacteria 4721
214 Ga0207657_10000055 3300025919 Bacteria 105424
215 Ga0207652_10000118 3300025921 Bacteria 87541
216 Ga0207652_10001553 3300025921 Bacteria 20238
217 Ga0207652_10016234 3300025921 Bacteria 6075
218 Ga0207646_10000950 3300025922 Bacteria 37311
219 Ga0207646_10001124 3300025922 Bacteria 34128
220 Ga0207646_10024626 3300025922 Bacteria 5512
221 Ga0207646_10038921 3300025922 Bacteria 4280
222 Ga0207694_10098631 3300025924 Bacteria 2313
223 Ga0207650_10000213 3300025925 Bacteria 66054
224 Ga0207650_10002188 3300025925 Bacteria 13659
225 Ga0207659_10000392 3300025926 Bacteria 26368
226 Ga0207687_10006723 3300025927 Bacteria 7586
227 Ga0207687_10045044 3300025927 Bacteria 3048
228 Ga0207700_10008492 3300025928 Bacteria 6369
229 Ga0207700_10020123 3300025928 Bacteria 4524
230 Ga0207664_10000047 3300025929 Bacteria 139122
231 Ga0207664_10002163 3300025929 Bacteria 12926
232 Ga0207664_10009935 3300025929 Bacteria 6704
233 Ga0207664_10014714 3300025929 Bacteria 5660
234 Ga0207664_10016582 3300025929 Bacteria 5379
235 Ga0207644_10006599 3300025931 Bacteria 7561
236 Ga0207644_10006863 3300025931 Bacteria 7416
237 Ga0207690_10000222 3300025932 Bacteria 42867
238 Ga0207690_10007808 3300025932 Bacteria 6351
239 Ga0207706_10000152 3300025933 Bacteria 76168
240 Ga0207709_10008172 3300025935 Bacteria 5794
241 Ga0207670_10000208 3300025936 Bacteria 38511
242 Ga0207669_10000264 3300025937 Bacteria 23890
243 Ga0207704_10000425 3300025938 Bacteria 18940
244 Ga0207665_10000685 3300025939 Bacteria 22900
245 Ga0207665_10010256 3300025939 Bacteria 6154
246 Ga0207665_10031285 3300025939 Bacteria 3520
247 Ga0207691_10000457 3300025940 Bacteria 40411
248 Ga0207691_10023642 3300025940 Bacteria 5787
249 Ga0207711_10000034 3300025941 Bacteria 190060
250 Ga0207711_10001044 3300025941 Bacteria 26495
251 Ga0207711_10007649 3300025941 Bacteria 9038
252 Ga0207689_10000245 3300025942 Bacteria 48509
253 Ga0207689_10002053 3300025942 Bacteria 19016
254 Ga0207661_10001366 3300025944 Bacteria 16371
255 Ga0207661_10007732 3300025944 Bacteria 7651
256 Ga0207679_10001077 3300025945 Bacteria 17367
257 Ga0207679_10001188 3300025945 Bacteria 16563
258 Ga0207679_10008686 3300025945 Bacteria 6476
259 Ga0207679_10008905 3300025945 Bacteria 6406
260 Ga0207651_10000377 3300025960 Bacteria 18977
261 Ga0207712_10001866 3300025961 Bacteria 13847
262 Ga0207640_10026838 3300025981 Bacteria 3502
263 Ga0207658_10011306 3300025986 Bacteria 6077
264 Ga0207658_10032879 3300025986 Bacteria 3696
265 Ga0207677_10000407 3300026023 Bacteria 29633
266 Ga0207703_10000015 3300026035 Bacteria 287079
267 Ga0207703_10001767 3300026035 Bacteria 19297
268 Ga0207703_10007913 3300026035 Bacteria 8406
269 Ga0207639_10002454 3300026041 Bacteria 12438
270 Ga0207678_10013620 3300026067 Bacteria 7142
271 Ga0207678_10041230 3300026067 Bacteria 4003
272 Ga0207708_10003774 3300026075 Bacteria 11165
273 Ga0207702_10002814 3300026078 Bacteria 16279
274 Ga0207702_10003518 3300026078 Bacteria 14274
275 Ga0207702_10006521 3300026078 Bacteria 10040
276 Ga0207702_10015965 3300026078 Bacteria 6217
277 Ga0207641_10001668 3300026088 Bacteria 21620
278 Ga0207641_10002042 3300026088 Bacteria 19228
279 Ga0207641_10002896 3300026088 Bacteria 15524
280 Ga0207648_10000094 3300026089 Bacteria 84345
281 Ga0207676_10002096 3300026095 Bacteria 14429
282 Ga0207674_10000942 3300026116 Bacteria 37985
283 Ga0207674_10007503 3300026116 Bacteria 12718
284 Ga0207675_100000004 3300026118 Bacteria 210328
285 Ga0207675_100038085 3300026118 Bacteria 4487
286 Ga0207683_10000007 3300026121 Bacteria 175543
287 Ga0207683_10000518 3300026121 Bacteria 35644
288 Ga0207698_10001879 3300026142 Bacteria 12284
289 Ga0207698_10017775 3300026142 Bacteria 4833
290 Ga0207428_10003971 3300027907 Bacteria 14187
291 Ga0268266_10001966 3300028379 Bacteria 23058
292 Ga0268265_10000112 3300028380 Bacteria 101717
293 Ga0268265_10002022 3300028380 Bacteria 15916
294 Ga0268264_10000729 3300028381 Bacteria 37671
295 Ga0265337_1000031 3300028556 Bacteria 64194
296 Ga0265337_1009950 3300028556 Bacteria 3358
297 Ga0265319_1003749 3300028563 Bacteria 7798
298 Ga0265334_10000333 3300028573 Bacteria 25219
299 Ga0265334_10001544 3300028573 Bacteria 11102
300 Ga0265318_10006271 3300028577 Bacteria 5494
301 Ga0265336_10000933 3300028666 Bacteria 14806
302 Ga0265336_10001667 3300028666 Bacteria 9819
303 Ga0265338_10000233 3300028800 Bacteria 103593
304 Ga0265338_10034428 3300028800 Bacteria 4895
305 Ga0265324_10002086 3300029957 Bacteria 10579
306 Ga0307511_10000032 3300030521 Bacteria 105861
307 Ga0265320_10002847 3300031240 Bacteria 11869
308 Ga0265325_10001214 3300031241 Bacteria 18340
309 Ga0265340_10014868 3300031247 Bacteria 4052
310 Ga0265340_10039304 3300031247 Bacteria 2335
311 Ga0307513_10000711 3300031456 Bacteria 47813
312 Ga0316579_10019126 3300031691 Bacteria 3022
313 Ga0265314_10002928 3300031711 Bacteria 16943
314 Ga0265342_10004391 3300031712 Bacteria 11133
315 Ga0316576_10000140 3300031727 Bacteria 28201
316 Ga0316576_10000368 3300031727 Bacteria 20413
317 Ga0316577_10033530 3300031733 Bacteria 2868
318 Ga0307407_10008241 3300031903 Bacteria 4773
319 Ga0307409_100047312 3300031995 Bacteria 3264
320 Ga0316583_10000069 3300032133 Bacteria 21277
321 Ga0316585_10009741 3300032137 Bacteria 2811
322 Ga0373945_0006935 3300035116 Bacteria 3662
323 Ga0373953_0001691 3300035117 Bacteria 6487
324 Ga0373956_0011544 3300035119 Bacteria 3643
325 Ga0373946_0000372 3300035171 Bacteria 14528
326 Ga0316574_0000932 3300035398 Bacteria 13036
327 Ga0316574_0039750 3300035398 Bacteria 2894
328 Ga0316574_0057652 3300035398 Bacteria 2432
329 Ga0373935_0002764 3300035692 Bacteria 10090
330 Ga0373927_0014896 3300035695 Bacteria 5143
331 Ga0373947_0024902 3300035725 Bacteria 3490
332 Ga0373937_0033566 3300036401 Bacteria 4661
333 Ga0373937_0045593 3300036401 Bacteria 4006
334 Ga0316582_0080541 3300036647 Bacteria 2125
335 Ga0316584_0034838 3300036712 Bacteria 3733
336 Ga0316584_0038360 3300036712 Bacteria 3563
337 Ga0373925_0000259 3300037068 Bacteria 55034
338 Ga0373925_0005725 3300037068 Bacteria 9242
339 Ga0373925_0049842 3300037068 Bacteria 3122
340 Ga0395899_0002340 3300037312 Bacteria 15435
341 Ga0316581_0006698 3300037588 Bacteria 3061
342 Ga0436364_0732570 3300037853 Bacteria 62691
343 Ga0436364_1191161 3300037853 Bacteria 9219
344 Ga0436364_1286697 3300037853 Bacteria 6945
345 Ga0400485_16978 3300038735 Bacteria 25355
346 Ga0400486_03657 3300038742 Bacteria 72353
347 Ga0436365_1343494 3300039437 Bacteria 4588
348 Ga0436365_1397287 3300039437 Bacteria 8052
349 Ga0436365_1876162 3300039437 Bacteria 22108
350 Ga0436365_1876513 3300039437 Bacteria 3309
351 Ga0439448_0004301 3300042005 Bacteria 4015
352 Ga0439463_009295 3300042016 Bacteria 2418
353 Ga0451577_0019727 3300042876 Bacteria 6197
354 Ga0466969_0001218 3300044656 Bacteria 13885
355 Ga0466969_0015827 3300044656 Bacteria 3953
356 Ga0466966_0000550 3300044684 Bacteria 23876
357 Ga0466966_0001592 3300044684 Bacteria 14587
358 Ga0466961_0005153 3300044693 Bacteria 8221
359 Ga0466961_0007726 3300044693 Bacteria 6846
360 Ga0466961_0039043 3300044693 Bacteria 3044
361 Ga0466963_0013145 3300044694 Bacteria 5079
362 Ga0466963_0038399 3300044694 Bacteria 3130
363 Ga0466963_0042000 3300044694 Bacteria 3001
364 Ga0466957_0005956 3300044842 Bacteria 6874
365 Ga0466957_0005992 3300044842 Bacteria 6855
366 Ga0466957_0025051 3300044842 Bacteria 3534
367 Ga0466960_0001422 3300044901 Bacteria 8713
368 Ga0466960_0019673 3300044901 Bacteria 2978
369 Ga0466959_0001869 3300045049 Bacteria 13238
370 Ga0466959_0003841 3300045049 Bacteria 9963
371 Ga0451576_0010150 3300045051 Bacteria 10835
372 Ga0466958_0001919 3300045836 Bacteria 10172
373 Ga0466958_0004261 3300045836 Bacteria 7523
374 Ga0466958_0018312 3300045836 Bacteria 4063
375 Ga0466958_0044907 3300045836 Bacteria 2664
376 Ga0466967_0021513 3300045976 Bacteria 5242
377 Ga0466967_0027849 3300045976 Bacteria 4708
378 Ga0466967_0039055 3300045976 Bacteria 4077
379 Ga0466967_0068658 3300045976 Bacteria 3166
380 Ga0495592_0014671 3300046454 Bacteria 5948
381 Ga0495592_0057656 3300046454 Bacteria 2866
382 Ga0495603_0027490 3300046455 Bacteria 3433
383 Ga0495603_0034409 3300046455 Bacteria 3046
384 Ga0495629_0017495 3300046459 Bacteria 5137
385 Ga0495641_0012884 3300046461 Bacteria 4639
386 Ga0495651_0002082 3300046462 Bacteria 15417
387 Ga0495651_0022964 3300046462 Bacteria 4850
388 Ga0495651_0056838 3300046462 Bacteria 3004
389 Ga0495653_0001312 3300046463 Bacteria 19277
390 Ga0495653_0069720 3300046463 Bacteria 2632
391 Ga0495580_0003931 3300046472 Bacteria 12541
392 Ga0495582_0000493 3300046473 Bacteria 21575
393 Ga0495662_0004106 3300046476 Bacteria 7335
394 Ga0495664_0006890 3300046477 Bacteria 6290
395 Ga0495618_0019004 3300046514 Bacteria 4223
396 Ga0495618_0019029 3300046514 Bacteria 4221
397 Ga0495648_0011396 3300046524 Bacteria 6699
398 Ga0495652_0005857 3300046529 Bacteria 11505
399 Ga0495665_0001587 3300046531 Bacteria 12157
400 Ga0495665_0020589 3300046531 Bacteria 3542
401 Ga0495586_0004142 3300046535 Bacteria 7772
402 Ga0495587_0005669 3300046536 Bacteria 8139
403 Ga0495587_0016671 3300046536 Bacteria 4570
404 Ga0495645_0009882 3300046543 Bacteria 6677
405 Ga0495645_0051697 3300046543 Bacteria 2989
406 Ga0495667_0010935 3300046559 Bacteria 6132
407 Ga0495667_0025243 3300046559 Bacteria 4005
408 Ga0495667_0028127 3300046559 Bacteria 3784
409 Ga0495667_0033281 3300046559 Bacteria 3450
410 Ga0495634_0029120 3300046642 Bacteria 3825
411 Ga0495635_0001276 3300046663 Bacteria 16810
412 Ga0495635_0011485 3300046663 Bacteria 6209
413 Ga0495635_0016587 3300046663 Bacteria 5145
414 Ga0495635_0021089 3300046663 Bacteria 4540
415 Ga0495657_0013222 3300046675 Bacteria 6097
416 Ga0495657_0059771 3300046675 Bacteria 2527
417 Ga0495599_0023036 3300046678 Bacteria 3890
418 Ga0495599_0043372 3300046678 Bacteria 2822
419 Ga0495624_0004583 3300046690 Bacteria 10091
420 Ga0495624_0006516 3300046690 Bacteria 8275
421 Ga0495624_0052301 3300046690 Bacteria 2581
422 Ga0495600_0007906 3300046809 Bacteria 6516
423 Ga0495581_0005557 3300047315 Bacteria 7304
424 Ga0495674_0003948 3300047319 Bacteria 14392
425 Ga0495674_0021595 3300047319 Bacteria 5951
426 Ga0495674_0079150 3300047319 Bacteria 2823
427 Ga0495672_0031132 3300047320 Bacteria 3334
428 Ga0495676_0002514 3300047321 Bacteria 16325
429 Ga0495680_0002758 3300047322 Bacteria 17724
430 Ga0495680_0016612 3300047322 Bacteria 6315
431 Ga0495680_0029307 3300047322 Bacteria 4507
432 Ga0495675_0020785 3300047444 Bacteria 4177
433 Ga0495684_0007239 3300047471 Bacteria 8609
434 Ga0495684_0010896 3300047471 Bacteria 7030
435 Ga0495684_0020382 3300047471 Bacteria 5109
436 Ga0495684_0075653 3300047471 Bacteria 2557
437 Ga0495684_0091503 3300047471 Bacteria 2304
438 Ga0495593_0009493 3300047673 Bacteria 5644
439 Ga0495593_0011142 3300047673 Bacteria 5171
440 Ga0495602_0003227 3300048088 Bacteria 16830
441 Ga0495602_0082832 3300048088 Bacteria 2690
442 Ga0496100_0007750 3300048903 Bacteria 5949
443 Ga0496102_0002119 3300048905 Bacteria 17067
444 Ga0496102_0015452 3300048905 Bacteria 6649
445 Ga0496102_0114179 3300048905 Bacteria 2520
446 Ga0496104_0002450 3300048907 Bacteria 15977
447 Ga0496104_0009485 3300048907 Bacteria 8661
448 Ga0496104_0024373 3300048907 Bacteria 5565
449 Ga0496104_0036069 3300048907 Bacteria 4619
450 Ga0496104_0043005 3300048907 Bacteria 4242
451 Ga0496105_0001355 3300048908 Bacteria 17212
452 Ga0496105_0005746 3300048908 Bacteria 9448
453 Ga0496105_0015933 3300048908 Bacteria 5995
454 Ga0496105_0017160 3300048908 Bacteria 5798
455 Ga0496106_0002569 3300048909 Bacteria 13512
456 Ga0496108_0023644 3300048911 Bacteria 5058
457 Ga0496108_0062639 3300048911 Bacteria 3132
458 Ga0496109_0009580 3300048912 Bacteria 8261
459 Ga0496109_0038868 3300048912 Bacteria 4305
460 Ga0496110_0015571 3300048913 Bacteria 6333
461 Ga0496110_0020528 3300048913 Bacteria 5578
462 Ga0496111_0000725 3300048914 Bacteria 17585
463 Ga0496111_0000804 3300048914 Bacteria 16837
464 Ga0496111_0027288 3300048914 Bacteria 4038
465 Ga0496112_0009675 3300048915 Bacteria 8699
466 Ga0496112_0039804 3300048915 Bacteria 4594
467 Ga0496113_0055887 3300048916 Bacteria 2961
468 Ga0496114_0006175 3300048917 Bacteria 9430
469 Ga0496114_0009177 3300048917 Bacteria 7841
470 Ga0496114_0013169 3300048917 Bacteria 6629
471 Ga0496114_0070696 3300048917 Bacteria 2932
472 Ga0496115_0062316 3300048918 Bacteria 3008
473 Ga0496116_0000381 3300048919 Bacteria 65986
474 Ga0496118_0000236 3300048921 Bacteria 97321
475 Ga0496118_0006770 3300048921 Bacteria 12462
476 Ga0496119_0002723 3300048922 Bacteria 19055
477 Ga0496119_0011055 3300048922 Bacteria 7524
478 Ga0496119_0024375 3300048922 Bacteria 4258
479 Ga0496120_0000365 3300048923 Bacteria 73526
480 Ga0496121_0018809 3300048924 Bacteria 6941
481 Ga0496126_0000006 3300048929 Bacteria 798804
482 Ga0496126_0000529 3300048929 Bacteria 73936
483 Ga0496126_0016940 3300048929 Bacteria 7272
484 Ga0501032_0003034 3300049569 Bacteria 13016
485 Ga0501032_0056445 3300049569 Bacteria 2640
486 Ga0501033_0014619 3300049570 Bacteria 5961
487 Ga0501034_0003557 3300049571 Bacteria 17711
488 Ga0501034_0005252 3300049571 Bacteria 14213
489 Ga0501034_0005796 3300049571 Bacteria 13435
490 Ga0501036_0009172 3300049572 Bacteria 8135
491 Ga0501036_0036136 3300049572 Bacteria 4180
492 Ga0501037_0001079 3300049573 Bacteria 20226
493 Ga0501037_0012781 3300049573 Bacteria 6185
494 Ga0501038_0045817 3300049574 Bacteria 3795
495 Ga0501038_0050464 3300049574 Bacteria 3594
496 Ga0501040_0033779 3300049576 Bacteria 3467
497 Ga0501041_0020735 3300049577 Bacteria 3932
498 Ga0501043_0001189 3300049579 Bacteria 22891
499 Ga0501043_0007809 3300049579 Bacteria 8457
500 Ga0501046_0001119 3300049580 Bacteria 26186
501 Ga0501047_0000031 3300049581 Bacteria 215903
502 Ga0501047_0003260 3300049581 Bacteria 15389
503 Ga0501047_0003811 3300049581 Bacteria 14173
504 Ga0501047_0062617 3300049581 Bacteria 3588
505 Ga0501048_0003279 3300049582 Bacteria 12334
506 Ga0501048_0004538 3300049582 Bacteria 10568
507 Ga0501048_0039159 3300049582 Bacteria 3401
508 Ga0501070_0001404 3300049586 Bacteria 21565
509 Ga0501071_0011367 3300049587 Bacteria 5997
510 Ga0501072_0015173 3300049588 Bacteria 5907
511 Ga0501074_0030814 3300049590 Bacteria 3886
512 Ga0501074_0042935 3300049590 Bacteria 3272
513 Ga0501075_0013240 3300049591 Bacteria 5884
514 Ga0501077_0017199 3300049593 Bacteria 4561
515 Ga0501079_0057352 3300049741 Bacteria 3005
516 Ga0501080_0110244 3300049742 Bacteria 2551
517 Ga0501081_0022993 3300049743 Bacteria 4174
518 Ga0501035_0002105 3300049822 Bacteria 19784
519 Ga0501044_0001501 3300049823 Bacteria 27346
520 nmdc:mga0yw44_25700_c1 3300050492 Bacteria 3353
521 nmdc:mga05p37_16596_c1 3300050507 Bacteria 8870
522 nmdc:mga09592_45905_c1 3300050508 Bacteria 3679
523 nmdc:mga08y16_18653_c1 3300050511 Bacteria 7307
524 nmdc:mga0n895_6584_c1 3300050512 Bacteria 9885
525 nmdc:mga0n895_90077_c1 3300050512 Bacteria 3069
526 nmdc:mga0rr50_26275_c1 3300050513 Bacteria 4060
527 nmdc:mga08x19_24473_c1 3300050514 Bacteria 3753
528 nmdc:mga0a205_30290_c1 3300050515 Bacteria 5180
529 nmdc:mga0a205_8924_c1 3300050515 Bacteria 9138
530 Ga0495612_0004251 3300053078 Bacteria 5945
531 Ga0495619_0001215 3300053085 Bacteria 16882
532 Ga0500616_0000562 3300053153 Bacteria 45732
533 Ga0500645_000013 3300053730 Bacteria 154598
534 Ga0466962_0018562 3300061719 Bacteria 3346
535 Ga0530510_0007037 3300061734 Bacteria 7834

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0080541 Ga0316582_0080541_30_1748 569
2 3300037588 Ga0316581_0006698 Ga0316581_0006698_1314_3032 569
3 3300045836 Ga0466958_0004261 Ga0466958_0004261_27_1838 585
4 3300049741 Ga0501079_0057352 Ga0501079_0057352_23_1924 618
5 3300031247 Ga0265340_10014868 Ga0265340_100148683 635
6 3300047320 Ga0495672_0031132 Ga0495672_0031132_40_1995 642
7 3300042016 Ga0439463_009295 Ga0439463_009295_356_2407 665
8 3300005985 Ga0081539_10037163 Ga0081539_100371633 667
9 3300048917 Ga0496114_0070696 Ga0496114_0070696_49_2079 670
10 3300005471 Ga0070698_100006885 Ga0070698_1000068856 683
11 3300025922 Ga0207646_10024626 Ga0207646_100246266 683
12 3300005471 Ga0070698_100000292 Ga0070698_1000002925 685
13 3300009148 Ga0105243_10073198 Ga0105243_100731983 687
14 3300009174 Ga0105241_10039580 Ga0105241_100395803 687
15 3300025940 Ga0207691_10023642 Ga0207691_100236423 687
16 3300044842 Ga0466957_0005956 Ga0466957_0005956_4611_6782 687
17 3300045836 Ga0466958_0001919 Ga0466958_0001919_4982_7153 687
18 3300045976 Ga0466967_0039055 Ga0466967_0039055_452_2623 687
19 3300005434 Ga0070709_10008912 Ga0070709_100089123 688
20 3300025898 Ga0207692_10022331 Ga0207692_100223312 688
21 3300035117 Ga0373953_0001691 Ga0373953_0001691_2877_5099 688
22 3300035119 Ga0373956_0011544 Ga0373956_0011544_146_2368 688
23 3300037068 Ga0373925_0049842 Ga0373925_0049842_126_2360 688
24 3300046463 Ga0495653_0069720 Ga0495653_0069720_267_2489 688
25 3300046675 Ga0495657_0059771 Ga0495657_0059771_143_2365 688
26 3300039437 Ga0436365_1876513 Ga0436365_1876513_296_2503 689
27 3300006844 Ga0075428_100049902 Ga0075428_1000499022 690
28 3300021388 Ga0213875_10000125 Ga0213875_1000012561 692
29 3300037068 Ga0373925_0000259 Ga0373925_0000259_41918_44110 692
30 3300037853 Ga0436364_0732570 Ga0436364_0732570_32447_34975 692
31 3300028556 Ga0265337_1000031 Ga0265337_100003153 693
32 3300028563 Ga0265319_1003749 Ga0265319_10037492 693
33 3300028573 Ga0265334_10000333 Ga0265334_1000033311 693
34 3300028666 Ga0265336_10000933 Ga0265336_1000093310 693
35 3300028800 Ga0265338_10000233 Ga0265338_1000023380 693
36 3300029957 Ga0265324_10002086 Ga0265324_100020862 693
37 3300031240 Ga0265320_10002847 Ga0265320_100028473 693
38 3300031241 Ga0265325_10001214 Ga0265325_100012145 693
39 3300031247 Ga0265340_10039304 Ga0265340_100393042 693
40 3300031711 Ga0265314_10002928 Ga0265314_1000292812 693
41 3300031712 Ga0265342_10004391 Ga0265342_100043915 693
42 3300039437 Ga0436365_1343494 Ga0436365_1343494_247_2481 693
43 3300037312 Ga0395899_0002340 Ga0395899_0002340_226_2442 694
44 3300013105 Ga0157369_10041708 Ga0157369_100417082 695
45 3300020069 Ga0197907_10937645 Ga0197907_109376453 695
46 3300020075 Ga0206349_1910650 Ga0206349_19106503 695
47 3300020080 Ga0206350_10028680 Ga0206350_100286802 695
48 3300022467 Ga0224712_10001523 Ga0224712_100015233 695
49 3300049571 Ga0501034_0005796 Ga0501034_0005796_5035_7242 695
50 3300005366 Ga0070659_100000761 Ga0070659_10000076115 696
51 3300025932 Ga0207690_10000222 Ga0207690_1000022230 696
52 3300005329 Ga0070683_100051744 Ga0070683_1000517442 697
53 3300048929 Ga0496126_0000529 Ga0496126_0000529_37883_40177 697
54 3300005367 Ga0070667_100011129 Ga0070667_1000111294 698
55 3300025922 Ga0207646_10038921 Ga0207646_100389214 698
56 3300025986 Ga0207658_10011306 Ga0207658_100113062 698
57 3300013105 Ga0157369_10000755 Ga0157369_1000075535 699
58 3300044693 Ga0466961_0005153 Ga0466961_0005153_734_2998 699
59 3300031995 Ga0307409_100047312 Ga0307409_1000473121 700
60 3300046462 Ga0495651_0022964 Ga0495651_0022964_21_2285 700
61 3300048919 Ga0496116_0000381 Ga0496116_0000381_13022_15298 700
62 3300048921 Ga0496118_0006770 Ga0496118_0006770_8424_10700 700
63 3300048922 Ga0496119_0002723 Ga0496119_0002723_6537_8813 700
64 3300006846 Ga0075430_100057171 Ga0075430_1000571712 701
65 3300044694 Ga0466963_0038399 Ga0466963_0038399_40_2235 701
66 3300044901 Ga0466960_0001422 Ga0466960_0001422_5344_7539 701
67 3300049742 Ga0501080_0110244 Ga0501080_0110244_292_2511 701
68 3300005327 Ga0070658_10001237 Ga0070658_100012372 702
69 3300025909 Ga0207705_10001467 Ga0207705_100014678 702
70 3300036401 Ga0373937_0045593 Ga0373937_0045593_763_3108 702
71 3300044693 Ga0466961_0039043 Ga0466961_0039043_496_2775 702
72 3300046472 Ga0495580_0003931 Ga0495580_0003931_5646_7991 702
73 3300046535 Ga0495586_0004142 Ga0495586_0004142_2753_5122 702
74 3300047471 Ga0495684_0010896 Ga0495684_0010896_2749_5094 702
75 3300005327 Ga0070658_10035027 Ga0070658_100350272 703
76 3300005437 Ga0070710_10000359 Ga0070710_1000035914 703
77 3300006173 Ga0070716_100006426 Ga0070716_1000064263 703
78 3300025929 Ga0207664_10009935 Ga0207664_100099352 703
79 3300025939 Ga0207665_10010256 Ga0207665_100102563 703
80 3300046476 Ga0495662_0004106 Ga0495662_0004106_1027_3396 703
81 3300048088 Ga0495602_0082832 Ga0495602_0082832_82_2610 703
82 3300005842 Ga0068858_100000032 Ga0068858_10000003255 704
83 3300026035 Ga0207703_10000015 Ga0207703_1000001554 704
84 3300048916 Ga0496113_0055887 Ga0496113_0055887_440_2587 704
85 3300005617 Ga0068859_100112361 Ga0068859_1001123612 705
86 3300006931 Ga0097620_100112361 Ga0097620_1001123612 705
87 3300009101 Ga0105247_10001144 Ga0105247_100011442 705
88 3300013307 Ga0157372_10000057 Ga0157372_1000005757 705
89 3300022467 Ga0224712_10018270 Ga0224712_100182701 705
90 3300025900 Ga0207710_10000082 Ga0207710_1000008254 705
91 3300025906 Ga0207699_10006407 Ga0207699_100064073 705
92 3300026078 Ga0207702_10006521 Ga0207702_100065215 705
93 3300046559 Ga0495667_0025243 Ga0495667_0025243_700_3243 705
94 3300048922 Ga0496119_0024375 Ga0496119_0024375_1693_4071 705
95 3300048924 Ga0496121_0018809 Ga0496121_0018809_3460_5838 705
96 3300005434 Ga0070709_10000636 Ga0070709_1000063614 706
97 3300005937 Ga0081455_10013968 Ga0081455_100139688 706
98 3300005983 Ga0081540_1000250 Ga0081540_100025017 706
99 3300025918 Ga0207662_10012551 Ga0207662_100125512 706
100 3300025928 Ga0207700_10020123 Ga0207700_100201232 706
101 3300035116 Ga0373945_0006935 Ga0373945_0006935_581_2959 706
102 3300035171 Ga0373946_0000372 Ga0373946_0000372_12135_14513 706
103 3300035692 Ga0373935_0002764 Ga0373935_0002764_6339_8717 706
104 3300035695 Ga0373927_0014896 Ga0373927_0014896_2338_4716 706
105 3300037853 Ga0436364_1191161 Ga0436364_1191161_472_2949 706
106 3300046455 Ga0495603_0027490 Ga0495603_0027490_707_3064 706
107 3300046473 Ga0495582_0000493 Ga0495582_0000493_19101_21458 706
108 3300046477 Ga0495664_0006890 Ga0495664_0006890_3738_6116 706
109 3300046531 Ga0495665_0020589 Ga0495665_0020589_450_2828 706
110 3300046559 Ga0495667_0033281 Ga0495667_0033281_859_3237 706
111 3300046642 Ga0495634_0029120 Ga0495634_0029120_899_3256 706
112 3300046663 Ga0495635_0011485 Ga0495635_0011485_2716_5094 706
113 3300046678 Ga0495599_0023036 Ga0495599_0023036_1249_3627 706
114 3300046690 Ga0495624_0004583 Ga0495624_0004583_5531_7909 706
115 3300047315 Ga0495581_0005557 Ga0495581_0005557_2646_5003 706
116 3300047319 Ga0495674_0003948 Ga0495674_0003948_176_2554 706
117 3300047321 Ga0495676_0002514 Ga0495676_0002514_825_3203 706
118 3300047471 Ga0495684_0075653 Ga0495684_0075653_37_2415 706
119 3300053078 Ga0495612_0004251 Ga0495612_0004251_1586_3943 706
120 3300005616 Ga0068852_100005201 Ga0068852_1000052012 707
121 3300005841 Ga0068863_100000471 Ga0068863_10000047134 707
122 3300022467 Ga0224712_10001825 Ga0224712_100018253 707
123 3300026067 Ga0207678_10041230 Ga0207678_100412303 707
124 3300026088 Ga0207641_10001668 Ga0207641_100016682 707
125 3300026142 Ga0207698_10001879 Ga0207698_100018793 707
126 3300046459 Ga0495629_0017495 Ga0495629_0017495_2150_4471 707
127 3300046461 Ga0495641_0012884 Ga0495641_0012884_1210_3531 707
128 3300047673 Ga0495593_0011142 Ga0495593_0011142_434_2755 707
129 3300048929 Ga0496126_0016940 Ga0496126_0016940_4870_7101 707
130 3300049590 Ga0501074_0030814 Ga0501074_0030814_1664_3832 707
131 3300005614 Ga0068856_100023338 Ga0068856_1000233382 708
132 3300009098 Ga0105245_10027732 Ga0105245_100277322 708
133 3300010375 Ga0105239_10102606 Ga0105239_101026062 708
134 3300046454 Ga0495592_0057656 Ga0495592_0057656_358_2595 708
135 3300046462 Ga0495651_0056838 Ga0495651_0056838_598_2835 708
136 3300046514 Ga0495618_0019029 Ga0495618_0019029_1657_3894 708
137 3300046536 Ga0495587_0005669 Ga0495587_0005669_1247_3484 708
138 3300046543 Ga0495645_0009882 Ga0495645_0009882_3554_5791 708
139 3300046559 Ga0495667_0028127 Ga0495667_0028127_1378_3615 708
140 3300046663 Ga0495635_0021089 Ga0495635_0021089_1455_3692 708
141 3300046678 Ga0495599_0043372 Ga0495599_0043372_474_2711 708
142 3300046690 Ga0495624_0052301 Ga0495624_0052301_112_2349 708
143 3300047322 Ga0495680_0016612 Ga0495680_0016612_3909_6146 708
144 3300048907 Ga0496104_0043005 Ga0496104_0043005_172_2616 708
145 3300048917 Ga0496114_0006175 Ga0496114_0006175_4894_7422 708
146 3300048917 Ga0496114_0009177 Ga0496114_0009177_2139_4583 708
147 3300049576 Ga0501040_0033779 Ga0501040_0033779_363_2561 708
148 3300049577 Ga0501041_0020735 Ga0501041_0020735_495_2693 708
149 3300049581 Ga0501047_0000031 Ga0501047_0000031_81280_83436 708
150 3300049582 Ga0501048_0039159 Ga0501048_0039159_1048_3246 708
151 3300049587 Ga0501071_0011367 Ga0501071_0011367_1735_3933 708
152 3300049588 Ga0501072_0015173 Ga0501072_0015173_2130_4328 708
153 3300049590 Ga0501074_0042935 Ga0501074_0042935_335_2533 708
154 3300049591 Ga0501075_0013240 Ga0501075_0013240_892_3090 708
155 3300049593 Ga0501077_0017199 Ga0501077_0017199_1316_3514 708
156 3300049743 Ga0501081_0022993 Ga0501081_0022993_916_3114 708
157 3300061734 Ga0530510_0007037 Ga0530510_0007037_4484_6682 708
158 3300005435 Ga0070714_100000106 Ga0070714_10000010624 709
159 3300005564 Ga0070664_100011125 Ga0070664_1000111253 709
160 3300020082 Ga0206353_10006789 Ga0206353_100067893 709
161 3300025929 Ga0207664_10000047 Ga0207664_1000004768 709
162 3300025944 Ga0207661_10001366 Ga0207661_1000136615 709
163 3300025945 Ga0207679_10008905 Ga0207679_100089054 709
164 3300031727 Ga0316576_10000140 Ga0316576_1000014020 709
165 3300035398 Ga0316574_0039750 Ga0316574_0039750_113_2272 709
166 3300046524 Ga0495648_0011396 Ga0495648_0011396_925_3324 709
167 3300049569 Ga0501032_0003034 Ga0501032_0003034_2422_4584 709
168 3300049570 Ga0501033_0014619 Ga0501033_0014619_1745_3907 709
169 3300049571 Ga0501034_0003557 Ga0501034_0003557_8758_10920 709
170 3300049572 Ga0501036_0036136 Ga0501036_0036136_1513_3690 709
171 3300049573 Ga0501037_0012781 Ga0501037_0012781_614_2776 709
172 3300049579 Ga0501043_0007809 Ga0501043_0007809_4098_6260 709
173 3300049580 Ga0501046_0001119 Ga0501046_0001119_8249_10411 709
174 3300049581 Ga0501047_0003260 Ga0501047_0003260_8434_10596 709
175 3300049582 Ga0501048_0004538 Ga0501048_0004538_8169_10331 709
176 3300049586 Ga0501070_0001404 Ga0501070_0001404_8433_10595 709
177 3300049822 Ga0501035_0002105 Ga0501035_0002105_8405_10567 709
178 3300049823 Ga0501044_0001501 Ga0501044_0001501_8433_10595 709
179 3300005617 Ga0068859_100028711 Ga0068859_1000287114 710
180 3300006931 Ga0097620_100028711 Ga0097620_1000287114 710
181 3300013105 Ga0157369_10038585 Ga0157369_100385855 710
182 3300020082 Ga0206353_11070430 Ga0206353_110704302 710
183 3300049569 Ga0501032_0056445 Ga0501032_0056445_206_2383 710
184 3300049574 Ga0501038_0050464 Ga0501038_0050464_1187_3364 710
185 3300049581 Ga0501047_0062617 Ga0501047_0062617_174_2351 710
186 iso_pu_bacteria 2839986021 2839986417 710
187 3300005445 Ga0070708_100004383 Ga0070708_1000043839 711
188 3300005467 Ga0070706_100005676 Ga0070706_1000056763 711
189 3300005467 Ga0070706_100051660 Ga0070706_1000516603 711
190 3300005468 Ga0070707_100005079 Ga0070707_1000050794 711
191 3300005471 Ga0070698_100002789 Ga0070698_10000278913 711
192 3300006028 Ga0070717_10019169 Ga0070717_100191693 711
193 3300025910 Ga0207684_10003975 Ga0207684_100039754 711
194 3300025922 Ga0207646_10000950 Ga0207646_1000095021 711
195 3300035725 Ga0373947_0024902 Ga0373947_0024902_1015_3225 711
196 3300037068 Ga0373925_0005725 Ga0373925_0005725_1293_3503 711
197 3300046454 Ga0495592_0014671 Ga0495592_0014671_970_3195 711
198 3300046462 Ga0495651_0002082 Ga0495651_0002082_10282_12507 711
199 3300046463 Ga0495653_0001312 Ga0495653_0001312_16205_18430 711
200 3300046514 Ga0495618_0019004 Ga0495618_0019004_1801_4026 711
201 3300046529 Ga0495652_0005857 Ga0495652_0005857_6859_9084 711
202 3300046543 Ga0495645_0051697 Ga0495645_0051697_383_2608 711
203 3300046559 Ga0495667_0010935 Ga0495667_0010935_2439_4664 711
204 3300046663 Ga0495635_0001276 Ga0495635_0001276_11399_13624 711
205 3300046809 Ga0495600_0007906 Ga0495600_0007906_3732_5957 711
206 3300047319 Ga0495674_0021595 Ga0495674_0021595_1302_3527 711
207 3300047322 Ga0495680_0002758 Ga0495680_0002758_15153_17378 711
208 3300047471 Ga0495684_0007239 Ga0495684_0007239_4638_6863 711
209 3300047471 Ga0495684_0091503 Ga0495684_0091503_73_2283 711
210 3300048088 Ga0495602_0003227 Ga0495602_0003227_2417_4642 711
211 iso_pu_bacteria 2558860280 2559429432 711
212 iso_pu_bacteria 2738541274 2738707743 711
213 iso_pu_bacteria 2738543028 2739334083 711
214 iso_pu_bacteria 2852677369 2852680186 711
215 3300005518 Ga0070699_100011216 Ga0070699_1000112163 712
216 3300006358 Ga0068871_100019675 Ga0068871_1000196753 712
217 3300009177 Ga0105248_10099456 Ga0105248_100994562 712
218 3300013297 Ga0157378_10010038 Ga0157378_100100385 712
219 3300025924 Ga0207694_10098631 Ga0207694_100986312 712
220 3300026121 Ga0207683_10000518 Ga0207683_1000051830 712
221 3300036401 Ga0373937_0033566 Ga0373937_0033566_789_3089 712
222 3300046536 Ga0495587_0016671 Ga0495587_0016671_2016_4316 712
223 3300046663 Ga0495635_0016587 Ga0495635_0016587_264_2564 712
224 3300046675 Ga0495657_0013222 Ga0495657_0013222_1681_3981 712
225 3300047322 Ga0495680_0029307 Ga0495680_0029307_1166_3466 712
226 3300047471 Ga0495684_0020382 Ga0495684_0020382_654_2954 712
227 3300048903 Ga0496100_0007750 Ga0496100_0007750_2653_4833 712
228 3300048907 Ga0496104_0024373 Ga0496104_0024373_1406_3586 712
229 3300048908 Ga0496105_0017160 Ga0496105_0017160_1180_3360 712
230 3300048917 Ga0496114_0013169 Ga0496114_0013169_246_2426 712
231 3300005335 Ga0070666_10002219 Ga0070666_100022192 713
232 3300005367 Ga0070667_100049214 Ga0070667_1000492142 713
233 3300005434 Ga0070709_10015554 Ga0070709_100155542 713
234 3300005539 Ga0068853_100066537 Ga0068853_1000665372 713
235 3300005841 Ga0068863_100000697 Ga0068863_1000006975 713
236 3300006163 Ga0070715_10002273 Ga0070715_100022735 713
237 3300006173 Ga0070716_100019306 Ga0070716_1000193062 713
238 3300009177 Ga0105248_10000044 Ga0105248_1000004494 713
239 3300025905 Ga0207685_10002014 Ga0207685_100020142 713
240 3300025906 Ga0207699_10012710 Ga0207699_100127102 713
241 3300025915 Ga0207693_10005784 Ga0207693_100057845 713
242 3300025916 Ga0207663_10008102 Ga0207663_100081023 713
243 3300025928 Ga0207700_10008492 Ga0207700_100084923 713
244 3300025929 Ga0207664_10002163 Ga0207664_100021635 713
245 3300025939 Ga0207665_10000685 Ga0207665_100006858 713
246 3300025941 Ga0207711_10000034 Ga0207711_10000034117 713
247 3300025986 Ga0207658_10032879 Ga0207658_100328792 713
248 3300026088 Ga0207641_10002042 Ga0207641_1000204213 713
249 3300030521 Ga0307511_10000032 Ga0307511_100000329 713
250 3300037853 Ga0436364_1286697 Ga0436364_1286697_3020_5416 713
251 3300044656 Ga0466969_0001218 Ga0466969_0001218_2118_4286 713
252 3300044656 Ga0466969_0015827 Ga0466969_0015827_278_2446 713
253 3300044684 Ga0466966_0000550 Ga0466966_0000550_4866_7034 713
254 3300045049 Ga0466959_0001869 Ga0466959_0001869_6532_8700 713
255 3300046531 Ga0495665_0001587 Ga0495665_0001587_8730_11051 713
256 3300046690 Ga0495624_0006516 Ga0495624_0006516_5069_7390 713
257 3300047319 Ga0495674_0079150 Ga0495674_0079150_173_2692 713
258 3300047444 Ga0495675_0020785 Ga0495675_0020785_1296_3617 713
259 3300048907 Ga0496104_0009485 Ga0496104_0009485_1608_3827 713
260 3300048908 Ga0496105_0001355 Ga0496105_0001355_2525_4744 713
261 3300048912 Ga0496109_0038868 Ga0496109_0038868_616_2973 713
262 3300048915 Ga0496112_0039804 Ga0496112_0039804_2250_4469 713
263 3300048918 Ga0496115_0062316 Ga0496115_0062316_568_2787 713
264 3300053085 Ga0495619_0001215 Ga0495619_0001215_5679_8000 713
265 3300061719 Ga0466962_0018562 Ga0466962_0018562_492_2660 713
266 iso_pu_bacteria 2517572101 2517760497 713
267 3300005467 Ga0070706_100003956 Ga0070706_1000039565 714
268 3300006048 Ga0075363_100016552 Ga0075363_1000165522 714
269 3300021384 Ga0213876_10001728 Ga0213876_100017281 714
270 3300035398 Ga0316574_0057652 Ga0316574_0057652_165_2360 714
271 3300038735 Ga0400485_16978 Ga0400485_16978_6787_8961 714
272 3300038742 Ga0400486_03657 Ga0400486_03657_44012_46186 714
273 3300039437 Ga0436365_1397287 Ga0436365_1397287_4118_6313 714
274 3300044694 Ga0466963_0013145 Ga0466963_0013145_1543_3732 714
275 3300044694 Ga0466963_0042000 Ga0466963_0042000_20_2293 714
276 3300044842 Ga0466957_0025051 Ga0466957_0025051_1117_3306 714
277 3300045836 Ga0466958_0044907 Ga0466958_0044907_401_2590 714
278 3300045976 Ga0466967_0027849 Ga0466967_0027849_205_2400 714
279 3300045976 Ga0466967_0068658 Ga0466967_0068658_458_2647 714
280 3300048908 Ga0496105_0015933 Ga0496105_0015933_806_3340 714
281 3300048912 Ga0496109_0009580 Ga0496109_0009580_3704_6238 714
282 3300048914 Ga0496111_0000725 Ga0496111_0000725_80_2614 714
283 3300048921 Ga0496118_0000236 Ga0496118_0000236_11901_14096 714
284 3300048929 Ga0496126_0000006 Ga0496126_0000006_704740_707013 714
285 3300049571 Ga0501034_0005252 Ga0501034_0005252_393_2594 714
286 3300049572 Ga0501036_0009172 Ga0501036_0009172_1196_3397 714
287 3300049573 Ga0501037_0001079 Ga0501037_0001079_9990_12191 714
288 3300049574 Ga0501038_0045817 Ga0501038_0045817_236_2437 714
289 3300049579 Ga0501043_0001189 Ga0501043_0001189_10590_12791 714
290 3300049581 Ga0501047_0003811 Ga0501047_0003811_10568_12769 714
291 3300049582 Ga0501048_0003279 Ga0501048_0003279_6636_8837 714
292 3300053730 Ga0500645_000013 Ga0500645_000013_140448_142643 714
293 iso_pu_bacteria 2643221613 2644083514 714
294 iso_pu_bacteria 2643221721 2644664290 714
295 iso_pu_bacteria 2687453737 2689959782 714
296 iso_pu_bacteria 2929212328 2929216884 714
297 iso_pu_bacteria 2935890801 2935892891 714
298 iso_pu_bacteria 8002784119 8002789596 714
299 3300005436 Ga0070713_100041209 Ga0070713_1000412092 715
300 3300005439 Ga0070711_100003675 Ga0070711_1000036756 715
301 3300005455 Ga0070663_100009689 Ga0070663_1000096892 715
302 3300005614 Ga0068856_100016752 Ga0068856_1000167523 715
303 3300005617 Ga0068859_100000861 Ga0068859_10000086111 715
304 3300005844 Ga0068862_100000025 Ga0068862_10000002511 715
305 3300006931 Ga0097620_100000861 Ga0097620_10000086115 715
306 3300025929 Ga0207664_10014714 Ga0207664_100147143 715
307 3300025929 Ga0207664_10016582 Ga0207664_100165823 715
308 3300025939 Ga0207665_10031285 Ga0207665_100312851 715
309 3300026078 Ga0207702_10015965 Ga0207702_100159652 715
310 3300026118 Ga0207675_100038085 Ga0207675_1000380852 715
311 3300028380 Ga0268265_10000112 Ga0268265_1000011287 715
312 3300028666 Ga0265336_10001667 Ga0265336_100016674 715
313 3300031456 Ga0307513_10000711 Ga0307513_1000071132 715
314 3300036712 Ga0316584_0034838 Ga0316584_0034838_940_3132 715
315 3300039437 Ga0436365_1876162 Ga0436365_1876162_3034_5232 715
316 3300044684 Ga0466966_0001592 Ga0466966_0001592_3100_5307 715
317 3300044693 Ga0466961_0007726 Ga0466961_0007726_80_2287 715
318 3300044842 Ga0466957_0005992 Ga0466957_0005992_45_2252 715
319 3300044901 Ga0466960_0019673 Ga0466960_0019673_255_2711 715
320 3300045049 Ga0466959_0003841 Ga0466959_0003841_2184_4391 715
321 3300045836 Ga0466958_0018312 Ga0466958_0018312_192_2399 715
322 3300047673 Ga0495593_0009493 Ga0495593_0009493_2877_5225 715
323 3300048913 Ga0496110_0020528 Ga0496110_0020528_893_3427 715
324 3300048922 Ga0496119_0011055 Ga0496119_0011055_49_2259 715
325 3300050492 nmdc:mga0yw44_25700_c1 nmdc:mga0yw44_25700_c1_1130_3328 715
326 iso_pu_bacteria 2687453743 2689995653 715
327 iso_pu_bacteria 2751185734 2753070576 715
328 iso_pu_bacteria 2795385470 2795786359 715
329 iso_pu_bacteria 8002775197 8002775291 715
330 3300005468 Ga0070707_100000256 Ga0070707_10000025644 716
331 3300005471 Ga0070698_100000333 Ga0070698_10000033339 716
332 3300006914 Ga0075436_100006150 Ga0075436_1000061502 716
333 3300006914 Ga0075436_100009887 Ga0075436_1000098872 716
334 3300009147 Ga0114129_10008499 Ga0114129_100084997 716
335 3300013105 Ga0157369_10064360 Ga0157369_100643602 716
336 3300025910 Ga0207684_10032201 Ga0207684_100322012 716
337 3300025917 Ga0207660_10003721 Ga0207660_100037213 716
338 3300025921 Ga0207652_10001553 Ga0207652_100015535 716
339 3300025922 Ga0207646_10001124 Ga0207646_1000112429 716
340 3300046455 Ga0495603_0034409 Ga0495603_0034409_687_2969 716
341 3300048911 Ga0496108_0023644 Ga0496108_0023644_132_2342 716
342 3300048914 Ga0496111_0027288 Ga0496111_0027288_20_2230 716
343 3300050507 nmdc:mga05p37_16596_c1 nmdc:mga05p37_16596_c1_6100_8598 716
344 3300050511 nmdc:mga08y16_18653_c1 nmdc:mga08y16_18653_c1_2109_4607 716
345 3300050512 nmdc:mga0n895_90077_c1 nmdc:mga0n895_90077_c1_147_2564 716
346 3300050513 nmdc:mga0rr50_26275_c1 nmdc:mga0rr50_26275_c1_653_3151 716
347 3300050514 nmdc:mga08x19_24473_c1 nmdc:mga08x19_24473_c1_971_3388 716
348 3300050515 nmdc:mga0a205_8924_c1 nmdc:mga0a205_8924_c1_1244_3742 716
349 iso_pu_bacteria 2508501039 2508672549 716
350 iso_pu_bacteria 2675902999 2676202210 716
351 iso_pu_bacteria 2773857921 2774846786 716
352 iso_pu_bacteria 2835188231 2835189656 716
353 iso_pu_bacteria 2902799365 2902801968 716
354 3300005334 Ga0068869_100001048 Ga0068869_1000010483 717
355 3300005337 Ga0070682_100001669 Ga0070682_1000016695 717
356 3300005344 Ga0070661_100032950 Ga0070661_1000329502 717
357 3300005345 Ga0070692_10005633 Ga0070692_100056333 717
358 3300005355 Ga0070671_100010643 Ga0070671_1000106433 717
359 3300005455 Ga0070663_100006716 Ga0070663_1000067163 717
360 3300005456 Ga0070678_100004156 Ga0070678_1000041562 717
361 3300005471 Ga0070698_100027060 Ga0070698_1000270603 717
362 3300005530 Ga0070679_100044375 Ga0070679_1000443752 717
363 3300005547 Ga0070693_100001131 Ga0070693_10000113110 717
364 3300005548 Ga0070665_100006766 Ga0070665_1000067667 717
365 3300005615 Ga0070702_100001528 Ga0070702_1000015284 717
366 3300005616 Ga0068852_100015733 Ga0068852_1000157332 717
367 3300005840 Ga0068870_10005205 Ga0068870_100052053 717
368 3300005842 Ga0068858_100008158 Ga0068858_1000081585 717
369 3300006173 Ga0070716_100021851 Ga0070716_1000218511 717
370 3300006852 Ga0075433_10009007 Ga0075433_100090074 717
371 3300006871 Ga0075434_100047739 Ga0075434_1000477392 717
372 3300007076 Ga0075435_100016314 Ga0075435_1000163143 717
373 3300009011 Ga0105251_10010655 Ga0105251_100106552 717
374 3300009174 Ga0105241_10004557 Ga0105241_100045575 717
375 3300009177 Ga0105248_10031957 Ga0105248_100319572 717
376 3300011119 Ga0105246_10004714 Ga0105246_100047143 717
377 3300014497 Ga0182008_10008911 Ga0182008_100089113 717
378 3300021388 Ga0213875_10003958 Ga0213875_100039588 717
379 3300022467 Ga0224712_10016615 Ga0224712_100166151 717
380 3300025900 Ga0207710_10007989 Ga0207710_100079893 717
381 3300025901 Ga0207688_10002421 Ga0207688_100024213 717
382 3300025907 Ga0207645_10016955 Ga0207645_100169552 717
383 3300025908 Ga0207643_10000047 Ga0207643_1000004764 717
384 3300025909 Ga0207705_10033227 Ga0207705_100332272 717
385 3300025911 Ga0207654_10002775 Ga0207654_100027754 717
386 3300025912 Ga0207707_10018376 Ga0207707_100183762 717
387 3300025917 Ga0207660_10003517 Ga0207660_100035177 717
388 3300025921 Ga0207652_10016234 Ga0207652_100162343 717
389 3300025925 Ga0207650_10002188 Ga0207650_100021882 717
390 3300025927 Ga0207687_10006723 Ga0207687_100067234 717
391 3300025931 Ga0207644_10006599 Ga0207644_100065993 717
392 3300025942 Ga0207689_10002053 Ga0207689_100020533 717
393 3300025944 Ga0207661_10007732 Ga0207661_100077323 717
394 3300025945 Ga0207679_10008686 Ga0207679_100086863 717
395 3300026035 Ga0207703_10007913 Ga0207703_100079133 717
396 3300026078 Ga0207702_10002814 Ga0207702_100028148 717
397 3300026095 Ga0207676_10002096 Ga0207676_100020966 717
398 3300026116 Ga0207674_10007503 Ga0207674_100075032 717
399 3300026142 Ga0207698_10017775 Ga0207698_100177753 717
400 3300027907 Ga0207428_10003971 Ga0207428_1000397110 717
401 3300031691 Ga0316579_10019126 Ga0316579_100191262 717
402 3300031727 Ga0316576_10000368 Ga0316576_1000036814 717
403 3300031733 Ga0316577_10033530 Ga0316577_100335302 717
404 3300032133 Ga0316583_10000069 Ga0316583_100000696 717
405 3300032137 Ga0316585_10009741 Ga0316585_100097412 717
406 3300035398 Ga0316574_0000932 Ga0316574_0000932_31_2232 717
407 3300036712 Ga0316584_0038360 Ga0316584_0038360_938_3139 717
408 3300042005 Ga0439448_0004301 Ga0439448_0004301_595_2961 717
409 3300045976 Ga0466967_0021513 Ga0466967_0021513_2270_4471 717
410 3300048905 Ga0496102_0015452 Ga0496102_0015452_1155_3521 717
411 3300048907 Ga0496104_0036069 Ga0496104_0036069_1876_4242 717
412 3300048908 Ga0496105_0005746 Ga0496105_0005746_5314_7680 717
413 3300048909 Ga0496106_0002569 Ga0496106_0002569_3701_6067 717
414 3300048913 Ga0496110_0015571 Ga0496110_0015571_1759_4125 717
415 3300048914 Ga0496111_0000804 Ga0496111_0000804_8233_10599 717
416 3300050512 nmdc:mga0n895_6584_c1 nmdc:mga0n895_6584_c1_6293_8659 717
417 3300050515 nmdc:mga0a205_30290_c1 nmdc:mga0a205_30290_c1_1361_3727 717
418 3300053153 Ga0500616_0000562 Ga0500616_0000562_36819_39023 717
419 iso_pu_bacteria 2671180195 2671840179 717
420 iso_pu_bacteria 2773857922 2774858335 717
421 iso_pu_bacteria 2917736166 2917739285 717
422 3300005436 Ga0070713_100031239 Ga0070713_1000312393 718
423 3300005545 Ga0070695_100007897 Ga0070695_1000078972 718
424 iso_pu_bacteria 2895880812 2895889509 718
425 iso_pu_bacteria 2897561785 2897564404 718
426 3300031903 Ga0307407_10008241 Ga0307407_100082412 719
427 3300005458 Ga0070681_10000009 Ga0070681_1000000978 720
428 3300005530 Ga0070679_100000107 Ga0070679_1000001076 720
429 3300006880 Ga0075429_100058487 Ga0075429_1000584872 720
430 3300025912 Ga0207707_10000458 Ga0207707_1000045824 720
431 3300025917 Ga0207660_10000649 Ga0207660_100006499 720
432 3300025921 Ga0207652_10000118 Ga0207652_1000011824 720
433 3300028573 Ga0265334_10001544 Ga0265334_100015442 720
434 3300028800 Ga0265338_10034428 Ga0265338_100344282 720
435 3300048905 Ga0496102_0114179 Ga0496102_0114179_128_2308 720
436 3300050508 nmdc:mga09592_45905_c1 nmdc:mga09592_45905_c1_1372_3570 720
437 iso_pu_bacteria 2506783011 2506868381 720
438 iso_pu_bacteria 2773857933 2774902763 720
439 iso_pu_bacteria 2870782633 2870783874 720
440 3300005441 Ga0070700_100000032 Ga0070700_10000003246 721
441 3300009101 Ga0105247_10000199 Ga0105247_100001996 721
442 3300009177 Ga0105248_10000603 Ga0105248_1000060336 721
443 3300025900 Ga0207710_10000120 Ga0207710_1000012051 721
444 3300025941 Ga0207711_10007649 Ga0207711_100076492 721
445 3300028556 Ga0265337_1009950 Ga0265337_10099502 721
446 3300028577 Ga0265318_10006271 Ga0265318_100062712 721
447 3300048907 Ga0496104_0002450 Ga0496104_0002450_13245_15785 721
448 3300048923 Ga0496120_0000365 Ga0496120_0000365_21642_24185 721
449 iso_pu_bacteria 2842134933 2842140151 721
450 iso_pu_bacteria 2932398195 2932399387 721
451 3300005983 Ga0081540_1000162 Ga0081540_100016232 734
452 3300005983 Ga0081540_1000470 Ga0081540_100047012 735
453 3300005329 Ga0070683_100046666 Ga0070683_1000466661 736
454 3300025945 Ga0207679_10001188 Ga0207679_100011887 736
455 3300042876 Ga0451577_0019727 Ga0451577_0019727_285_2495 736
456 3300045051 Ga0451576_0010150 Ga0451576_0010150_7747_9957 736
457 3300005327 Ga0070658_10000801 Ga0070658_100008012 739
458 3300005329 Ga0070683_100002373 Ga0070683_1000023734 739
459 3300005330 Ga0070690_100000330 Ga0070690_1000003305 739
460 3300005331 Ga0070670_100028489 Ga0070670_1000284893 739
461 3300005333 Ga0070677_10000074 Ga0070677_1000007412 739
462 3300005334 Ga0068869_100000496 Ga0068869_1000004964 739
463 3300005335 Ga0070666_10002930 Ga0070666_100029307 739
464 3300005338 Ga0068868_100000319 Ga0068868_1000003192 739
465 3300005339 Ga0070660_100000981 Ga0070660_10000098111 739
466 3300005340 Ga0070689_100001499 Ga0070689_1000014993 739
467 3300005343 Ga0070687_100000001 Ga0070687_10000000163 739
468 3300005344 Ga0070661_100000069 Ga0070661_1000000696 739
469 3300005347 Ga0070668_100001308 Ga0070668_10000130811 739
470 3300005353 Ga0070669_100001342 Ga0070669_1000013424 739
471 3300005354 Ga0070675_100000424 Ga0070675_10000042415 739
472 3300005355 Ga0070671_100010605 Ga0070671_1000106053 739
473 3300005356 Ga0070674_100002261 Ga0070674_1000022616 739
474 3300005364 Ga0070673_100003308 Ga0070673_1000033083 739
475 3300005366 Ga0070659_100001237 Ga0070659_1000012374 739
476 3300005367 Ga0070667_100003402 Ga0070667_1000034024 739
477 3300005440 Ga0070705_100000880 Ga0070705_1000008807 739
478 3300005455 Ga0070663_100006471 Ga0070663_1000064713 739
479 3300005456 Ga0070678_100001632 Ga0070678_1000016327 739
480 3300005457 Ga0070662_100000847 Ga0070662_10000084711 739
481 3300005459 Ga0068867_100015425 Ga0068867_1000154253 739
482 3300005466 Ga0070685_10004058 Ga0070685_100040584 739
483 3300005539 Ga0068853_100000106 Ga0068853_10000010647 739
484 3300005543 Ga0070672_100003652 Ga0070672_1000036524 739
485 3300005544 Ga0070686_100000313 Ga0070686_10000031315 739
486 3300005563 Ga0068855_100006655 Ga0068855_1000066558 739
487 3300005564 Ga0070664_100001951 Ga0070664_1000019514 739
488 3300005577 Ga0068857_100010932 Ga0068857_1000109322 739
489 3300005578 Ga0068854_100001733 Ga0068854_1000017334 739
490 3300005614 Ga0068856_100000478 Ga0068856_1000004785 739
491 3300005616 Ga0068852_100001697 Ga0068852_1000016973 739
492 3300005618 Ga0068864_100003341 Ga0068864_1000033416 739
493 3300005718 Ga0068866_10000470 Ga0068866_100004703 739
494 3300005719 Ga0068861_100006435 Ga0068861_1000064353 739
495 3300005834 Ga0068851_10000340 Ga0068851_1000034012 739
496 3300005840 Ga0068870_10000085 Ga0068870_100000852 739
497 3300005841 Ga0068863_100003940 Ga0068863_1000039406 739
498 3300005842 Ga0068858_100033012 Ga0068858_1000330122 739
499 3300005843 Ga0068860_100001788 Ga0068860_1000017884 739
500 3300005844 Ga0068862_100007334 Ga0068862_1000073342 739
501 3300005983 Ga0081540_1000939 Ga0081540_100093912 739
502 3300009093 Ga0105240_10017695 Ga0105240_100176955 739
503 3300009098 Ga0105245_10001442 Ga0105245_100014426 739
504 3300009101 Ga0105247_10002920 Ga0105247_100029206 739
505 3300009148 Ga0105243_10002605 Ga0105243_100026056 739
506 3300009174 Ga0105241_10014214 Ga0105241_100142144 739
507 3300009176 Ga0105242_10000388 Ga0105242_1000038823 739
508 3300009545 Ga0105237_10000276 Ga0105237_1000027631 739
509 3300009551 Ga0105238_10000302 Ga0105238_1000030232 739
510 3300009553 Ga0105249_10001178 Ga0105249_100011784 739
511 3300010375 Ga0105239_10000686 Ga0105239_1000068633 739
512 3300011119 Ga0105246_10001043 Ga0105246_100010435 739
513 3300013102 Ga0157371_10000234 Ga0157371_1000023447 739
514 3300013105 Ga0157369_10000365 Ga0157369_1000036532 739
515 3300013296 Ga0157374_10012474 Ga0157374_100124744 739
516 3300013297 Ga0157378_10000488 Ga0157378_1000048831 739
517 3300013306 Ga0163162_10001380 Ga0163162_1000138017 739
518 3300013307 Ga0157372_10057691 Ga0157372_100576912 739
519 3300013308 Ga0157375_10018083 Ga0157375_100180832 739
520 3300014325 Ga0163163_10007989 Ga0163163_100079895 739
521 3300014745 Ga0157377_10000288 Ga0157377_100002882 739
522 3300014968 Ga0157379_10000247 Ga0157379_1000024731 739
523 3300014969 Ga0157376_10000866 Ga0157376_1000086613 739
524 3300025315 Ga0207697_10001817 Ga0207697_100018176 739
525 3300025321 Ga0207656_10002698 Ga0207656_100026984 739
526 3300025900 Ga0207710_10001028 Ga0207710_100010284 739
527 3300025901 Ga0207688_10000003 Ga0207688_1000000327 739
528 3300025907 Ga0207645_10000022 Ga0207645_1000002275 739
529 3300025908 Ga0207643_10000011 Ga0207643_1000001197 739
530 3300025914 Ga0207671_10012428 Ga0207671_100124284 739
531 3300025918 Ga0207662_10000004 Ga0207662_1000000489 739
532 3300025919 Ga0207657_10000055 Ga0207657_1000005523 739
533 3300025925 Ga0207650_10000213 Ga0207650_1000021346 739
534 3300025926 Ga0207659_10000392 Ga0207659_1000039212 739
535 3300025927 Ga0207687_10045044 Ga0207687_100450442 739
536 3300025931 Ga0207644_10006863 Ga0207644_100068634 739
537 3300025932 Ga0207690_10007808 Ga0207690_100078084 739
538 3300025933 Ga0207706_10000152 Ga0207706_1000015231 739
539 3300025935 Ga0207709_10008172 Ga0207709_100081722 739
540 3300025936 Ga0207670_10000208 Ga0207670_100002085 739
541 3300025937 Ga0207669_10000264 Ga0207669_100002647 739
542 3300025938 Ga0207704_10000425 Ga0207704_100004254 739
543 3300025940 Ga0207691_10000457 Ga0207691_1000045734 739
544 3300025941 Ga0207711_10001044 Ga0207711_1000104412 739
545 3300025942 Ga0207689_10000245 Ga0207689_100002454 739
546 3300025945 Ga0207679_10001077 Ga0207679_1000107710 739
547 3300025960 Ga0207651_10000377 Ga0207651_100003774 739
548 3300025961 Ga0207712_10001866 Ga0207712_100018664 739
549 3300025981 Ga0207640_10026838 Ga0207640_100268382 739
550 3300026023 Ga0207677_10000407 Ga0207677_100004071 739
551 3300026035 Ga0207703_10001767 Ga0207703_1000176711 739
552 3300026041 Ga0207639_10002454 Ga0207639_100024544 739
553 3300026067 Ga0207678_10013620 Ga0207678_100136204 739
554 3300026075 Ga0207708_10003774 Ga0207708_100037744 739
555 3300026078 Ga0207702_10003518 Ga0207702_100035184 739
556 3300026088 Ga0207641_10002896 Ga0207641_1000289611 739
557 3300026089 Ga0207648_10000094 Ga0207648_1000009444 739
558 3300026116 Ga0207674_10000942 Ga0207674_1000094219 739
559 3300026118 Ga0207675_100000004 Ga0207675_10000000498 739
560 3300026121 Ga0207683_10000007 Ga0207683_1000000771 739
561 3300028379 Ga0268266_10001966 Ga0268266_100019664 739
562 3300028380 Ga0268265_10002022 Ga0268265_1000202211 739
563 3300028381 Ga0268264_10000729 Ga0268264_1000072931 739
564 3300048905 Ga0496102_0002119 Ga0496102_0002119_14390_16609 739
565 3300048911 Ga0496108_0062639 Ga0496108_0062639_878_3097 739
566 3300048915 Ga0496112_0009675 Ga0496112_0009675_4078_6297 739

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22019

GlgB_N

alpha-1,4-glucan branching enzyme GlgB, N-terminal domain

130

219

0.97

PF02806

Alpha-amylase_C

Alpha amylase, C-terminal all-beta domain

749

867

0.93

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

392

471

0.91

PF02922

CBM_48

Carbohydrate-binding module 48 (Isoamylase N-terminal domain)

244

333

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e6z-assembly3.cif.gz_C crystal structure of ecoli branching enzyme with beta cyclodextrin 0.97 120 732
5e70-assembly3.cif.gz_C crystal structure of ecoli branching enzyme with gamma cyclodextrin 0.9696 120 732
1m7x-assembly2.cif.gz_B the x-ray crystallographic structure of branching enzyme 0.9688 122 732
5e6y-assembly2.cif.gz_B crystal structure of e.coli branching enzyme in complex with alpha cyclodextrin 0.9673 120 732
1m7x-assembly3.cif.gz_C the x-ray crystallographic structure of branching enzyme 0.9672 120 732
ID Description Score Start End Superfamily
af_P07762_230_612_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9799 238 616 3.20.20.80
af_P07762_103_221_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9795 105 224 2.60.40.10
af_P07762_103_221_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9715 105 224 2.60.40.10
af_P07762_230_612_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9672 238 616 3.20.20.80
3k1dA03 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.9672 629 732 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A2A8BXL6-F1-model_v4 1,4-alpha-glucan branching enzyme 0.9964 485 593 GO:0003844
GO:0005829
GO:0005978
AF-A0A529PXB5-F1-model_v4 1,4-alpha-glucan branching enzyme 0.9926 477 579 GO:0003844
GO:0005829
GO:0005978
AF-A0A367M0P4-F1-model_v4 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) 0.9917 480 685 GO:0003844
GO:0005829
GO:0005978
GO:0043169
AF-A0A7X5N0R0-F1-model_v4 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) 0.9904 323 613 GO:0003844
GO:0005829
GO:0005978
AF-T1DHB5-F1-model_v4 Glycogen branching enzyme 0.9904 489 732 GO:0003844
GO:0005829
GO:0005978
GO:0043169

Feature Viewer

pLDDT pTM Quality
92.4 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map