F464480

General Info

Members Datasets Scaffolds Average Seq Length
567 457 1134 276

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100006423|Ga0070670_1000064236
Length 276
Sequence MSTITTKDGTEIFYKDWGKGQPVVFSHGWPLSGDAWDVQMLYLSSRGYRTIAHDRRGHGRSAQPWNGNDMDTYADDLAELIEKLDLKNVVLVGHSTGGGEVAHYIGRHGTSRVAKVALVGAVPPQMLKTAANPGGLPIEVFDGIRAGLVADRSQFHKDLAAGPFYGFNRADAKKSQGLIDSFWLQGMAGGLKGQYDCIKQFSEVDYTEDLKKIDVPTLVVHGDDDQVVPIDNSGKLSAKIVKNATLKIYAGAPHGLASTHADQLNADLLAFIEGKL

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
125 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
236 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
237 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
238 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
239 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
240 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
241 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
242 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
243 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
244 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
245 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
246 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
247 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
248 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
249 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
250 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
251 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
252 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
253 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
254 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
255 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
256 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
257 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
258 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
259 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
260 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
261 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
262 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
263 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
264 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
265 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
266 2643221719 Rhizobium sp. Root274 Isolate Unclassified
267 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
268 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
269 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
270 2818991452 Burkholderia cepacia 561 Isolate Unclassified
271 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
272 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
273 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
274 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
275 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
276 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
277 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
278 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
279 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
280 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
281 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
282 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
283 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
284 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
285 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
286 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
287 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
288 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
289 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
290 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
291 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
292 2904564687 Burkholderia sp. 571 Isolate Unclassified
293 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
294 2909042592 Labrys sp. LIt4 Isolate Nodule
295 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
296 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
297 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
298 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
299 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
300 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
301 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
302 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
303 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
304 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
305 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
306 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
307 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
308 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
309 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
310 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
311 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
312 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
313 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
314 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
315 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
316 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
317 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
318 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
319 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
320 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
321 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
322 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
323 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
324 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
325 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
326 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
327 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
328 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
329 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
330 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
331 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
332 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
333 2928536128 Burkholderia sola 565 Isolate Unclassified
334 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
335 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
336 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
337 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
338 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
339 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
340 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
341 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
342 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
343 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
344 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
345 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
346 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
347 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
348 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
349 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
350 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
351 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
352 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
353 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
354 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
355 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
356 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
357 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
358 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
359 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
360 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
361 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
362 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
363 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
364 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
365 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
366 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
367 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
368 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
369 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
370 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
371 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
372 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
373 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
374 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
375 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
376 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
377 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
378 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
379 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
380 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
381 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
382 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
383 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
384 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
385 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
386 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
387 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
388 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
389 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
390 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
391 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
392 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
393 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
394 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
395 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
396 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
397 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
398 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
399 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
400 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
401 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
402 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
403 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
404 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
405 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
406 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
407 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
408 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
409 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
410 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
411 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
412 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
413 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
414 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
415 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
416 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
417 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
418 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
419 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
420 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
421 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
422 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
423 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
424 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
425 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
426 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
427 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
428 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
429 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
430 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
431 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
432 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
433 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
434 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
435 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
436 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
437 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
438 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
439 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
440 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
441 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
442 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
443 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
444 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
445 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
446 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
447 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
448 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
449 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
450 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
451 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
452 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
453 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
454 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
455 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
456 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
457 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 60.67
Metatranscriptomes 0
Isolates 39.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 32.28
Rhizoplane 0.35
Rhizosphere 46.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100006423 3300005331 Bacteria 9950
2 JGI24735J21928_10002261 3300002067 Bacteria 6729
3 JGI25159J45721_1000531 3300002987 Bacteria 17359
4 JGI25151J46595_10001024 3300003187 Bacteria 20946
5 rootL2_10135375 3300003322 Bacteria 3403
6 rootH1_10039362 3300003323 Bacteria 3733
7 Ga0055533_1006520 3300003756 Bacteria 1711
8 Ga0055532_1000284 3300003758 Bacteria 32514
9 Ga0055527_1000313 3300003760 Bacteria 26120
10 Ga0055535_1000539 3300003761 Bacteria 32550
11 Ga0055542_1000566 3300003762 Bacteria 32550
12 Ga0055529_1000536 3300003763 Bacteria 32550
13 Ga0055524_1013236 3300003775 Bacteria 3121
14 Ga0055536_1000026 3300003781 Bacteria 166220
15 Ga0055536_1003109 3300003781 Bacteria 9028
16 Ga0055536_1014330 3300003781 Bacteria 2795
17 Ga0055536_1018373 3300003781 Bacteria 2243
18 Ga0055534_1001667 3300003784 Bacteria 8521
19 Ga0055530_10021016 3300003791 Bacteria 1934
20 Ga0055531_10020842 3300003794 Bacteria 2572
21 Ga0058692_1000009 3300003856 Bacteria 349545
22 Ga0058692_1001774 3300003856 Bacteria 7642
23 Ga0065165_1008893 3300005262 Bacteria 4607
24 Ga0070666_10006014 3300005335 Bacteria 7456
25 Ga0070668_100000159 3300005347 Bacteria 42625
26 Ga0070668_100003860 3300005347 Bacteria 11063
27 Ga0070669_100004604 3300005353 Bacteria 9958
28 Ga0070659_100012725 3300005366 Bacteria 6245
29 Ga0070667_100000120 3300005367 Bacteria 99936
30 Ga0070667_100083824 3300005367 Bacteria 2731
31 Ga0070663_100022801 3300005455 Bacteria 4189
32 Ga0070663_100046341 3300005455 Bacteria 3076
33 Ga0070662_100296649 3300005457 Bacteria 1312
34 Ga0068867_100313422 3300005459 Bacteria 1297
35 Ga0070685_10026416 3300005466 Bacteria 3200
36 Ga0068853_100130485 3300005539 Bacteria 2249
37 Ga0070693_100106174 3300005547 Bacteria 1719
38 Ga0070665_100000182 3300005548 Bacteria 111555
39 Ga0070665_100000266 3300005548 Bacteria 85554
40 Ga0070665_100016027 3300005548 Bacteria 7523
41 Ga0070665_100068652 3300005548 Bacteria 3554
42 Ga0068855_100334669 3300005563 Bacteria 1670
43 Ga0068857_100225704 3300005577 Bacteria 1712
44 Ga0068854_100022639 3300005578 Bacteria 4286
45 Ga0068851_10003540 3300005834 Bacteria 6949
46 Ga0068863_100000053 3300005841 Bacteria 125195
47 Ga0068858_100021689 3300005842 Bacteria 6002
48 Ga0068860_100002365 3300005843 Bacteria 19823
49 Ga0068860_100023577 3300005843 Bacteria 5948
50 Ga0081455_10018295 3300005937 Bacteria 6680
51 Ga0081539_10002649 3300005985 Bacteria 24437
52 Ga0075365_10342918 3300006038 Bacteria 1053
53 Ga0075369_10122097 3300006186 Bacteria 1180
54 Ga0075366_10031621 3300006195 Bacteria 3115
55 Ga0075428_100487059 3300006844 Bacteria 1320
56 Ga0075429_100239900 3300006880 Bacteria 1588
57 Ga0105244_10000146 3300009036 Bacteria 73754
58 Ga0105240_10000377 3300009093 Bacteria 83854
59 Ga0105240_10009278 3300009093 Bacteria 13949
60 Ga0105240_10207040 3300009093 Bacteria 2295
61 Ga0105241_10083164 3300009174 Bacteria 2511
62 Ga0105241_10283024 3300009174 Bacteria 1417
63 Ga0105242_10218422 3300009176 Bacteria 1702
64 Ga0105237_10000075 3300009545 Bacteria 132511
65 Ga0105237_10214243 3300009545 Bacteria 1926
66 Ga0105238_10006002 3300009551 Bacteria 12042
67 Ga0105239_10278697 3300010375 Bacteria 1882
68 Ga0105246_10677908 3300011119 Bacteria 901
69 Ga0157371_10002448 3300013102 Bacteria 17687
70 Ga0157371_10062374 3300013102 Bacteria 2642
71 Ga0157370_10010403 3300013104 Bacteria 9809
72 Ga0157370_10376521 3300013104 Bacteria 1308
73 Ga0157369_10006942 3300013105 Bacteria 13070
74 Ga0157369_10010701 3300013105 Bacteria 10439
75 Ga0157369_10076866 3300013105 Bacteria 3579
76 Ga0157374_10110103 3300013296 Bacteria 2648
77 Ga0163162_10050705 3300013306 Bacteria 4162
78 Ga0182008_10000013 3300014497 Bacteria 286492
79 Ga0182006_1011443 3300015261 Bacteria 3902
80 Ga0182007_10000890 3300015262 Bacteria 16558
81 Ga0182007_10034565 3300015262 Bacteria 1707
82 Ga0163161_10009636 3300017792 Bacteria 6681
83 Ga0163161_10035218 3300017792 Bacteria 3583
84 Ga0213876_10000435 3300021384 Bacteria 34197
85 Ga0209566_100201 3300025225 Bacteria 61860
86 Ga0209674_101509 3300025226 Bacteria 6037
87 Ga0209672_100200 3300025228 Bacteria 47502
88 Ga0209147_100265 3300025229 Bacteria 47502
89 Ga0209258_100439 3300025242 Bacteria 47500
90 Ga0209148_1000422 3300025254 Bacteria 47502
91 Ga0209233_1011368 3300025261 Bacteria 2625
92 Ga0209455_1000322 3300025272 Bacteria 47502
93 Ga0209675_1000026 3300025291 Bacteria 284716
94 Ga0209676_1000059 3300025292 Bacteria 344882
95 Ga0209676_1000075 3300025292 Bacteria 303609
96 Ga0209676_1000217 3300025292 Bacteria 125740
97 Ga0209676_1000430 3300025292 Bacteria 72819
98 Ga0209676_1009431 3300025292 Bacteria 4210
99 Ga0209025_1000066 3300025294 Bacteria 298742
100 Ga0209025_1018468 3300025294 Bacteria 3947
101 Ga0209564_1000562 3300025295 Bacteria 59138
102 Ga0209758_1036805 3300025297 Bacteria 1903
103 Ga0209050_1004528 3300025298 Bacteria 9343
104 Ga0209050_1006552 3300025298 Bacteria 6851
105 Ga0209050_1023539 3300025298 Bacteria 2163
106 Ga0209050_1039381 3300025298 Bacteria 1333
107 Ga0209256_1000182 3300025299 Bacteria 122471
108 Ga0209257_1000184 3300025304 Bacteria 156438
109 Ga0209257_1002469 3300025304 Bacteria 18286
110 Ga0209257_1051138 3300025304 Bacteria 1166
111 Ga0207656_10004236 3300025321 Bacteria 4994
112 Ga0207655_1000834 3300025728 Bacteria 33167
113 Ga0207710_10043536 3300025900 Bacteria 1997
114 Ga0207680_10004781 3300025903 Bacteria 6448
115 Ga0207647_10001123 3300025904 Bacteria 20593
116 Ga0207647_10091823 3300025904 Bacteria 1810
117 Ga0207695_10000007 3300025913 Bacteria 1092551
118 Ga0207695_10001969 3300025913 Bacteria 31806
119 Ga0207695_10017795 3300025913 Bacteria 8246
120 Ga0207695_10030328 3300025913 Bacteria 5954
121 Ga0207671_10000104 3300025914 Bacteria 129250
122 Ga0207671_10013102 3300025914 Bacteria 6624
123 Ga0207671_10031100 3300025914 Bacteria 3980
124 Ga0207671_10106088 3300025914 Bacteria 2133
125 Ga0207649_10324736 3300025920 Bacteria 1132
126 Ga0207681_10003306 3300025923 Bacteria 10093
127 Ga0207694_10000996 3300025924 Bacteria 24749
128 Ga0207694_10002131 3300025924 Bacteria 16262
129 Ga0207650_10004121 3300025925 Bacteria 9934
130 Ga0207706_10013049 3300025933 Bacteria 7561
131 Ga0207704_10121187 3300025938 Bacteria 1790
132 Ga0207712_10000349 3300025961 Bacteria 41192
133 Ga0207668_10000027 3300025972 Bacteria 125575
134 Ga0207658_10000091 3300025986 Bacteria 99970
135 Ga0207658_10020562 3300025986 Bacteria 4570
136 Ga0207677_10299857 3300026023 Bacteria 1327
137 Ga0207703_10005588 3300026035 Bacteria 10095
138 Ga0207639_10000102 3300026041 Bacteria 70172
139 Ga0207678_10023453 3300026067 Bacteria 5397
140 Ga0207678_10126995 3300026067 Bacteria 2175
141 Ga0207702_10260275 3300026078 Bacteria 1633
142 Ga0207641_10000093 3300026088 Bacteria 125747
143 Ga0207648_10312101 3300026089 Bacteria 1412
144 Ga0207698_10008725 3300026142 Bacteria 6428
145 Ga0207698_10009455 3300026142 Bacteria 6218
146 Ga0209371_1000023 3300027312 Bacteria 519553
147 Ga0209371_1002223 3300027312 Bacteria 11226
148 Ga0268266_10000001 3300028379 Bacteria 4040580
149 Ga0268266_10000006 3300028379 Bacteria 1410021
150 Ga0268266_10052861 3300028379 Bacteria 3489
151 Ga0268266_10083967 3300028379 Bacteria 2780
152 Ga0268266_10142445 3300028379 Bacteria 2152
153 Ga0268264_10000049 3300028381 Bacteria 329992
154 Ga0268256_1000023 3300030500 Bacteria 519631
155 Ga0268256_1002503 3300030500 Bacteria 9285
156 Ga0307511_10101435 3300030521 Bacteria 1887
157 Ga0316182_1445581 3300030745 Bacteria 1155
158 Ga0307509_10005665 3300031507 Bacteria 17241
159 Ga0307509_10363896 3300031507 Bacteria 1165
160 Ga0265342_10197333 3300031712 Bacteria 1095
161 Ga0307516_10001045 3300031730 Bacteria 38473
162 Ga0307516_10001603 3300031730 Bacteria 31141
163 Ga0307516_10009088 3300031730 Bacteria 11131
164 Ga0307516_10055146 3300031730 Bacteria 3881
165 Ga0307516_10123654 3300031730 Bacteria 2374
166 Ga0307516_10228621 3300031730 Bacteria 1565
167 Ga0307406_10000326 3300031901 Bacteria 27612
168 Ga0307412_10000201 3300031911 Bacteria 40668
169 Ga0307412_10002382 3300031911 Bacteria 10439
170 Ga0307507_10092042 3300033179 Bacteria 2591
171 Ga0373935_0111774 3300035692 Bacteria 1814
172 Ga0373927_0028417 3300035695 Bacteria 3647
173 Ga0373925_0269171 3300037068 Bacteria 1370
174 Ga0395898_0009870 3300037466 Bacteria 10009
175 Ga0395905_0000095 3300037471 Bacteria 146714
176 Ga0439465_0004973 3300041413 Bacteria 4270
177 Ga0451807_0812982 3300041486 Bacteria 1174
178 Ga0451807_2048314 3300041486 Bacteria 1317
179 Ga0451837_1349669 3300041494 Bacteria 1228
180 Ga0450911_002957 3300042115 Bacteria 3140
181 Ga0450901_001931 3300042533 Bacteria 2309
182 Ga0466969_0002099 3300044656 Bacteria 10632
183 Ga0466972_0001438 3300044658 Bacteria 11560
184 Ga0466972_0002988 3300044658 Bacteria 8374
185 Ga0466972_0035149 3300044658 Bacteria 2452
186 Ga0466972_0040416 3300044658 Bacteria 2272
187 Ga0466982_0000006 3300044672 Bacteria 333931
188 Ga0466965_0006843 3300044683 Bacteria 5209
189 Ga0466965_0041178 3300044683 Bacteria 2275
190 Ga0466966_0005940 3300044684 Bacteria 8053
191 Ga0466966_0026280 3300044684 Bacteria 3802
192 Ga0466961_0035008 3300044693 Bacteria 3224
193 Ga0466961_0085914 3300044693 Bacteria 1989
194 Ga0466971_0000430 3300044719 Bacteria 16408
195 Ga0466968_0001977 3300044735 Bacteria 7446
196 Ga0466968_0003085 3300044735 Bacteria 6142
197 Ga0466970_0000972 3300044765 Bacteria 13784
198 Ga0466970_0024216 3300044765 Bacteria 3174
199 Ga0466970_0029338 3300044765 Bacteria 2895
200 Ga0466970_0082526 3300044765 Bacteria 1738
201 Ga0466960_0025096 3300044901 Bacteria 2694
202 Ga0466959_0014900 3300045049 Bacteria 5663
203 Ga0466959_0054582 3300045049 Bacteria 2919
204 Ga0451576_0199423 3300045051 Bacteria 2090
205 Ga0495603_0052667 3300046455 Bacteria 2416
206 Ga0495590_0009975 3300046457 Bacteria 3589
207 Ga0495629_0030950 3300046459 Bacteria 3791
208 Ga0495651_0052522 3300046462 Bacteria 3139
209 Ga0495653_0008808 3300046463 Bacteria 8264
210 Ga0495653_0050646 3300046463 Bacteria 3193
211 Ga0495650_0001416 3300046471 Bacteria 23327
212 Ga0495650_0006928 3300046471 Bacteria 6937
213 Ga0495650_0007948 3300046471 Bacteria 6283
214 Ga0495580_0002007 3300046472 Bacteria 17917
215 Ga0495582_0026979 3300046473 Bacteria 3147
216 Ga0495639_0002043 3300046475 Bacteria 8932
217 Ga0495664_0116738 3300046477 Bacteria 1613
218 Ga0495594_0225028 3300046499 Bacteria 1070
219 Ga0495583_0006550 3300046506 Bacteria 7583
220 Ga0495606_0106173 3300046507 Bacteria 1701
221 Ga0495628_0004119 3300046516 Bacteria 12931
222 Ga0495648_0040394 3300046524 Bacteria 2958
223 Ga0495663_0000971 3300046525 Bacteria 9530
224 Ga0495666_0018685 3300046526 Bacteria 3444
225 Ga0495642_0033986 3300046528 Bacteria 2052
226 Ga0495652_0034205 3300046529 Bacteria 4430
227 Ga0495654_0093008 3300046530 Bacteria 1397
228 Ga0495640_0053408 3300046533 Bacteria 2770
229 Ga0495586_0014479 3300046535 Bacteria 4188
230 Ga0495587_0010424 3300046536 Bacteria 5916
231 Ga0495621_0036916 3300046539 Bacteria 1698
232 Ga0495645_0004593 3300046543 Bacteria 9427
233 Ga0495622_0000438 3300046557 Bacteria 27066
234 Ga0495622_0007581 3300046557 Bacteria 5040
235 Ga0495622_0090956 3300046557 Bacteria 1402
236 Ga0495622_0095493 3300046557 Bacteria 1364
237 Ga0495633_0001400 3300046558 Bacteria 18792
238 Ga0495633_0010561 3300046558 Bacteria 5031
239 Ga0495656_0017155 3300046615 Bacteria 2759
240 Ga0495656_0042384 3300046615 Bacteria 1905
241 Ga0495634_0025903 3300046642 Bacteria 4096
242 Ga0495611_0024361 3300046648 Bacteria 2632
243 Ga0495611_0057980 3300046648 Bacteria 1756
244 Ga0495611_0076026 3300046648 Bacteria 1539
245 Ga0495588_0030612 3300046674 Bacteria 2706
246 Ga0495588_0049620 3300046674 Bacteria 2159
247 Ga0495657_0227777 3300046675 Bacteria 1128
248 Ga0495599_0003759 3300046678 Bacteria 8906
249 Ga0495599_0042463 3300046678 Bacteria 2853
250 Ga0495623_0007887 3300046679 Bacteria 6925
251 Ga0495623_0021147 3300046679 Bacteria 4204
252 Ga0495646_0063295 3300046680 Bacteria 2196
253 Ga0495613_0071943 3300046689 Bacteria 2520
254 Ga0495624_0024187 3300046690 Bacteria 3998
255 Ga0495624_0181942 3300046690 Bacteria 1280
256 Ga0495671_0073825 3300046692 Bacteria 1674
257 Ga0495581_0196959 3300047315 Bacteria 1178
258 Ga0495604_0009270 3300047317 Bacteria 7791
259 Ga0495604_0019258 3300047317 Bacteria 5464
260 Ga0495636_0011276 3300047318 Bacteria 3537
261 Ga0495674_0260931 3300047319 Bacteria 1423
262 Ga0495672_0044690 3300047320 Bacteria 2655
263 Ga0495672_0055693 3300047320 Bacteria 2306
264 Ga0495672_0084723 3300047320 Bacteria 1758
265 Ga0495680_0059790 3300047322 Bacteria 2940
266 Ga0495680_0177499 3300047322 Bacteria 1539
267 Ga0495687_000317 3300047443 Bacteria 62824
268 Ga0495687_007457 3300047443 Bacteria 6437
269 Ga0495687_087572 3300047443 Bacteria 1201
270 Ga0495679_000026 3300047446 Bacteria 196639
271 Ga0495679_000163 3300047446 Bacteria 60379
272 Ga0495673_0001685 3300047469 Bacteria 16967
273 Ga0495673_0099702 3300047469 Bacteria 1176
274 Ga0495681_0000990 3300047470 Bacteria 21739
275 Ga0495684_0117766 3300047471 Bacteria 2002
276 Ga0495686_0000468 3300047472 Bacteria 60235
277 Ga0495593_0007887 3300047673 Bacteria 6199
278 Ga0495602_0011233 3300048088 Bacteria 9261
279 Ga0495602_0041228 3300048088 Bacteria 4219
280 Ga0495602_0229324 3300048088 Bacteria 1396
281 Ga0495614_0084296 3300048089 Bacteria 1378
282 Ga0496116_0000396 3300048919 Bacteria 63381
283 Ga0496117_0000065 3300048920 Bacteria 254215
284 Ga0496117_0043863 3300048920 Bacteria 3246
285 Ga0496117_0071096 3300048920 Bacteria 2333
286 Ga0496118_0000033 3300048921 Bacteria 326357
287 Ga0496118_0003358 3300048921 Bacteria 20250
288 Ga0496118_0006819 3300048921 Bacteria 12392
289 Ga0496118_0072313 3300048921 Bacteria 2477
290 Ga0496119_0034999 3300048922 Bacteria 3296
291 Ga0496119_0080028 3300048922 Bacteria 1885
292 Ga0496120_0032253 3300048923 Bacteria 3160
293 Ga0496121_0000998 3300048924 Bacteria 50597
294 Ga0496121_0005308 3300048924 Bacteria 16576
295 Ga0496121_0023216 3300048924 Bacteria 5983
296 Ga0496121_0033424 3300048924 Bacteria 4653
297 Ga0496121_0067615 3300048924 Bacteria 2895
298 Ga0496121_0182195 3300048924 Bacteria 1514
299 Ga0496122_0036356 3300048925 Bacteria 3983
300 Ga0496123_0003788 3300048926 Bacteria 16560
301 Ga0496124_0005318 3300048927 Bacteria 14551
302 Ga0496124_0242395 3300048927 Bacteria 1339
303 Ga0496125_0002097 3300048928 Bacteria 26773
304 Ga0496125_0011344 3300048928 Bacteria 8922
305 Ga0496126_0271142 3300048929 Bacteria 1408
306 Ga0495682_0114447 3300049460 Bacteria 966
307 Ga0501031_0238719 3300049568 Bacteria 1182
308 Ga0501032_0070568 3300049569 Bacteria 2330
309 Ga0501033_0104426 3300049570 Bacteria 2065
310 Ga0501034_0021560 3300049571 Bacteria 6564
311 Ga0501034_0114556 3300049571 Bacteria 2684
312 Ga0501036_0186915 3300049572 Bacteria 1744
313 Ga0501037_0138913 3300049573 Bacteria 1739
314 Ga0501038_0057834 3300049574 Bacteria 3328
315 Ga0501039_0104881 3300049575 Bacteria 2207
316 Ga0501046_0263726 3300049580 Bacteria 1265
317 Ga0501047_0004388 3300049581 Bacteria 13276
318 Ga0501067_0003943 3300049583 Bacteria 8193
319 Ga0501068_0005043 3300049584 Bacteria 7194
320 Ga0501068_0103486 3300049584 Bacteria 1766
321 Ga0501069_0004419 3300049585 Bacteria 7260
322 Ga0501070_0011476 3300049586 Bacteria 7486
323 Ga0501071_0003055 3300049587 Bacteria 10371
324 Ga0501072_0067383 3300049588 Bacteria 2824
325 Ga0501073_0007543 3300049589 Bacteria 8078
326 Ga0501074_0008710 3300049590 Bacteria 7352
327 Ga0501080_0012478 3300049742 Bacteria 7790
328 Ga0501080_0111626 3300049742 Bacteria 2534
329 Ga0501083_0008809 3300049744 Bacteria 7121
330 Ga0501035_0001137 3300049822 Bacteria 27823
331 Ga0501044_0003135 3300049823 Bacteria 18706
332 Ga0501044_0042042 3300049823 Bacteria 4757
333 nmdc:mga0k408_25419_c1 3300050493 Bacteria 3354
334 nmdc:mga0qj67_234647_c1 3300050509 Bacteria 1488
335 Ga0500641_0003397 3300053096 Bacteria 5628
336 Ga0500641_0066356 3300053096 Bacteria 1511
337 Ga0500650_0007117 3300053098 Bacteria 4328
338 Ga0500642_0184294 3300053130 Bacteria 975
339 Ga0500568_0001243 3300053139 Bacteria 16900
340 Ga0500568_0001396 3300053139 Bacteria 15671
341 Ga0500590_080922 3300053148 Bacteria 1595
342 Ga0501084_0011057 3300054114 Bacteria 7473
343 Ga0501082_0010498 3300060353 Bacteria 7967
344 Ga0466962_0002385 3300061719 Bacteria 8903
345 2510303947 2510065057 Bacteria 6649661
346 2511497315 2511231052 Bacteria 6974333
347 2512353198 2512047030 Bacteria 9031815
348 2513582079 2513237086 Bacteria 7265287
349 2513615112 2513237091 Bacteria 6900273
350 2513881513 2513237140 Bacteria 7076289
351 2513901204 2513237143 Bacteria 6664116
352 2513908249 2513237144 Bacteria 7530820
353 2513926888 2513237146 Bacteria 7166346
354 2515609579 2515154107 Bacteria 6795637
355 2515683992 2515154122 Bacteria 8609520
356 2516895453 2516653046 Bacteria 6989037
357 2524452680 2524023207 Bacteria 6813453
358 2547501929 2547132130 Bacteria 4660562
359 2551682438 2551306084 Bacteria 8942552
360 2551688631 2551306085 Bacteria 7347181
361 2551695796 2551306086 Bacteria 6843938
362 2551703010 2551306087 Bacteria 7351905
363 2551711015 2551306089 Bacteria 7162724
364 2551720470 2551306090 Bacteria 7953713
365 2551730814 2551306091 Bacteria 7086830
366 2551735563 2551306092 Bacteria 6992595
367 2551743968 2551306093 Bacteria 7064773
368 2578458227 2576861471 Bacteria 4648976
369 2585231696 2582581299 Bacteria 6518058
370 2585255044 2582581304 Bacteria 5831370
371 2599420618 2599185170 Bacteria 7295545
372 2644085246 2643221614 Bacteria 4260023
373 2644193461 2643221634 Bacteria 6705461
374 2644342798 2643221661 Bacteria 4267604
375 2644366098 2643221666 Bacteria 4265935
376 2644657850 2643221719 Bacteria 4568197
377 2747948487 2747842428 Bacteria 4689383
378 2765579372 2765235840 Bacteria 4663337
379 2819565285 2818991440 Bacteria 4774720
380 2819635083 2818991452 Bacteria 8442785
381 2838040708 2838035591 Bacteria 7166484
382 2838664905 2838661181 Bacteria 7385261
383 2840881552 2840878972 Bacteria 5483153
384 2842334988 2842333319 Bacteria 8899485
385 2842391625 2842391507 Bacteria 4486072
386 2842760744 2842757796 Bacteria 3981385
387 2842776706 2842775625 Bacteria 5587290
388 2842781075 2842780639 Bacteria 4337790
389 2855829721 2855825444 Bacteria 6785811
390 2855844825 2855839649 Bacteria 7135830
391 2857443300 2857442823 Bacteria 4562550
392 2858805719 2858800743 Bacteria 6603254
393 2874222066 2874220319 Bacteria 4594709
394 2882462234 2882456835 Bacteria 6863978
395 2884341117 2884338543 Bacteria 4610696
396 2885274874 2885270888 Bacteria 9831543
397 2885306689 2885305155 Bacteria 7348390
398 2885328394 2885326080 Bacteria 7134805
399 2885334799 2885334103 Bacteria 7216818
400 2902687166 2902682994 Bacteria 8951596
401 2904466955 2904463128 Bacteria 4775606
402 2904570962 2904564687 Bacteria 7609577
403 2904578084 2904571731 Bacteria 7608790
404 2909047495 2909042592 Bacteria 6499737
405 2915987569 2915986958 Bacteria 6739310
406 2915999935 2915993759 Bacteria 7016183
407 2916006733 2916000859 Bacteria 6865702
408 2916012054 2916007675 Bacteria 6898660
409 2916017063 2916014648 Bacteria 6946486
410 2916025315 2916021584 Bacteria 6854472
411 2916029527 2916028427 Bacteria 6748433
412 2916040003 2916035215 Bacteria 6755766
413 2916047771 2916041962 Bacteria 6820487
414 2916051472 2916048683 Bacteria 6543552
415 2916059290 2916055098 Bacteria 6758838
416 2916072185 2916068649 Bacteria 6943657
417 2916082265 2916076590 Bacteria 6596108
418 2919090879 2919089067 Bacteria 4560942
419 2919135648 2919134579 Bacteria 4480386
420 2921201783 2921201388 Bacteria 6926299
421 2921211397 2921208531 Bacteria 6745326
422 2921238347 2921237296 Bacteria 6876710
423 2921246953 2921244191 Bacteria 6568419
424 2921262918 2921257292 Bacteria 6808382
425 2921267309 2921263974 Bacteria 6864552
426 2921288039 2921282425 Bacteria 6826397
427 2921293110 2921289301 Bacteria 7316391
428 2921301254 2921296804 Bacteria 7176999
429 2924144128 2924144063 Bacteria 6883928
430 2924151055 2924150972 Bacteria 7169444
431 2924158386 2924158325 Bacteria 7188855
432 2924166365 2924165586 Bacteria 7260590
433 2924172971 2924172951 Bacteria 6749356
434 2924179900 2924179722 Bacteria 6843264
435 2924189570 2924186466 Bacteria 6876637
436 2924197713 2924193448 Bacteria 6955718
437 2924202281 2924200457 Bacteria 6757188
438 2924210478 2924207177 Bacteria 6917007
439 2924217144 2924214083 Bacteria 7080103
440 2924222675 2924221636 Bacteria 7113495
441 2924229399 2924228884 Bacteria 6633132
442 2928499741 2928496128 Bacteria 4631123
443 2928543060 2928536128 Bacteria 7657547
444 2931380345 2931380184 Bacteria 4455911
445 2933017453 2933016740 Bacteria 6355406
446 2936996941 2936996657 Bacteria 6298727
447 2937004952 2937002841 Bacteria 6934057
448 2937015153 2937009748 Bacteria 6746052
449 2937016544 2937016420 Bacteria 6782579
450 2937026401 2937023124 Bacteria 6815156
451 2937049301 2937042894 Bacteria 6741576
452 2937055055 2937049772 Bacteria 6757901
453 2937057803 2937056579 Bacteria 7107896
454 2937070328 2937063883 Bacteria 7199456
455 2937073635 2937071275 Bacteria 6984483
456 2937098833 2937091812 Bacteria 6979387
457 2937100785 2937098957 Bacteria 7249374
458 2937107635 2937106411 Bacteria 6947143
459 2937119074 2937113482 Bacteria 6505872
460 2937121608 2937119839 Bacteria 6597547
461 2937127187 2937126314 Bacteria 6771275
462 2937612902 2937610967 Bacteria 4618818
463 2939626461 2939622612 Bacteria 4698046
464 2939626912 2939626828 Bacteria 4695272
465 2957387952 2957382221 Bacteria 6737050
466 2957392397 2957388812 Bacteria 6778072
467 2957395628 2957395598 Bacteria 6822399
468 2957402420 2957402308 Bacteria 6741770
469 2957413945 2957408893 Bacteria 6558585
470 2957418548 2957415311 Bacteria 6991633
471 2957429435 2957422303 Bacteria 7172205
472 2957433264 2957430029 Bacteria 7022557
473 2957443084 2957437181 Bacteria 6568994
474 2957444332 2957443900 Bacteria 6869977
475 2957455876 2957450854 Bacteria 6765715
476 2957460581 2957457609 Bacteria 6967680
477 2957466739 2957464669 Bacteria 6568877
478 2957471838 2957471148 Bacteria 6797643
479 2957482596 2957478035 Bacteria 6756658
480 2957488235 2957484790 Bacteria 6703082
481 2957497079 2957491536 Bacteria 6695180
482 2957503881 2957498199 Bacteria 7126688
483 2957512696 2957505466 Bacteria 7253085
484 2960584362 2960584000 Bacteria 6864594
485 2960592421 2960591022 Bacteria 6622873
486 2960599411 2960597568 Bacteria 6550735
487 2960610378 2960603979 Bacteria 6898737
488 2960616104 2960610863 Bacteria 6691244
489 2960619496 2960617483 Bacteria 6727748
490 2960629315 2960624210 Bacteria 6875384
491 2960641608 2960637947 Bacteria 7296468
492 2960647186 2960645483 Bacteria 7211087
493 2960657404 2960652885 Bacteria 7083688
494 2960662347 2960660292 Bacteria 7041660
495 2960669075 2960667422 Bacteria 6763020
496 2960674157 2960674078 Bacteria 6609048
497 2960689411 2960687367 Bacteria 6535474
498 2961048833 2961047084 Bacteria 4594415
499 2961067738 2961064222 Bacteria 4749990
500 2964613345 2964607997 Bacteria 7101408
501 2964617466 2964615318 Bacteria 6809089
502 2964623170 2964621998 Bacteria 6834995
503 2964630692 2964628898 Bacteria 7083044
504 2964638836 2964636051 Bacteria 7091832
505 2964645079 2964643177 Bacteria 6820887
506 2964651823 2964649959 Bacteria 6675118
507 2964661756 2964656573 Bacteria 7100150
508 2964667141 2964663802 Bacteria 7019362
509 2964677630 2964670856 Bacteria 6851364
510 2964679943 2964678106 Bacteria 6792020
511 2964688751 2964685014 Bacteria 6839111
512 2964696976 2964691889 Bacteria 6802758
513 2964701166 2964698721 Bacteria 6765331
514 2964712495 2964705432 Bacteria 7114648
515 2964715074 2964712639 Bacteria 6695970
516 2964724178 2964719344 Bacteria 7286602
517 2967670464 2967664464 Bacteria 6948836
518 2967675869 2967671571 Bacteria 7021409
519 2967683113 2967678726 Bacteria 7264382
520 2967697122 2967693043 Bacteria 6804451
521 2967700086 2967699805 Bacteria 6854538
522 2967706979 2967706974 Bacteria 7186053
523 2967717787 2967714385 Bacteria 7000047
524 2967724100 2967721400 Bacteria 7073753
525 2967740442 2967735183 Bacteria 6827012
526 2967742027 2967742019 Bacteria 6794534
527 2967755052 2967748971 Bacteria 6733771
528 2967758403 2967755722 Bacteria 6814706
529 2967767836 2967762386 Bacteria 6923502
530 2967771082 2967769361 Bacteria 6587838
531 2967776112 2967775926 Bacteria 6738189
532 2970021383 2970019648 Bacteria 7072033
533 2970034057 2970033650 Bacteria 7118744
534 2970045932 2970040964 Bacteria 6731123
535 2970051254 2970047711 Bacteria 7088379
536 2970055005 2970054988 Bacteria 6611507
537 2970063410 2970061556 Bacteria 7099761
538 2970069202 2970068827 Bacteria 7123112
539 2970076310 2970076120 Bacteria 6697332
540 2970082845 2970082768 Bacteria 6183754
541 2970090816 2970088815 Bacteria 6933825
542 2970095996 2970095765 Bacteria 6936963
543 2970104753 2970102677 Bacteria 6812532
544 2970109388 2970109326 Bacteria 6863976
545 2970116393 2970116247 Bacteria 6501857
546 2970132777 2970129317 Bacteria 6806560
547 2970142459 2970136068 Bacteria 7207982
548 2970147613 2970143518 Bacteria 6446480
549 2970150223 2970149975 Bacteria 6779706
550 2970159686 2970156795 Bacteria 7168044
551 2970166008 2970164137 Bacteria 6861252
552 2970175082 2970170962 Bacteria 6876229
553 2970177994 2970177841 Bacteria 6768001
554 2970191217 2970184632 Bacteria 7054431
555 2970198692 2970191845 Bacteria 7032787
556 2977517009 2977516862 Bacteria 6940108
557 2977526174 2977523885 Bacteria 6960446
558 2977544266 2977537788 Bacteria 6929320
559 2977553873 2977551784 Bacteria 7125765
560 2977564358 2977558990 Bacteria 6863948
561 2977571483 2977565890 Bacteria 6901543
562 2977577195 2977572785 Bacteria 6763888
563 2977582810 2977579622 Bacteria 6772100
564 648736854 648276728 Bacteria 6968865
565 8003997361 8003992118 Bacteria 7266902
566 8020941280 8020938398 Bacteria 7472757
567 8020956616 8020953355 Bacteria 7439080
568 Ga0070670_100006423
569 JGI24735J21928_10002261
570 JGI25159J45721_1000531
571 JGI25151J46595_10001024
572 rootL2_10135375
573 rootH1_10039362
574 Ga0055533_1006520
575 Ga0055532_1000284
576 Ga0055527_1000313
577 Ga0055535_1000539
578 Ga0055542_1000566
579 Ga0055529_1000536
580 Ga0055524_1013236
581 Ga0055536_1000026
582 Ga0055536_1003109
583 Ga0055536_1014330
584 Ga0055536_1018373
585 Ga0055534_1001667
586 Ga0055530_10021016
587 Ga0055531_10020842
588 Ga0058692_1000009
589 Ga0058692_1001774
590 Ga0065165_1008893
591 Ga0070666_10006014
592 Ga0070668_100000159
593 Ga0070668_100003860
594 Ga0070669_100004604
595 Ga0070659_100012725
596 Ga0070667_100000120
597 Ga0070667_100083824
598 Ga0070663_100022801
599 Ga0070663_100046341
600 Ga0070662_100296649
601 Ga0068867_100313422
602 Ga0070685_10026416
603 Ga0068853_100130485
604 Ga0070693_100106174
605 Ga0070665_100000182
606 Ga0070665_100000266
607 Ga0070665_100016027
608 Ga0070665_100068652
609 Ga0068855_100334669
610 Ga0068857_100225704
611 Ga0068854_100022639
612 Ga0068851_10003540
613 Ga0068863_100000053
614 Ga0068858_100021689
615 Ga0068860_100002365
616 Ga0068860_100023577
617 Ga0081455_10018295
618 Ga0081539_10002649
619 Ga0075365_10342918
620 Ga0075369_10122097
621 Ga0075366_10031621
622 Ga0075428_100487059
623 Ga0075429_100239900
624 Ga0105244_10000146
625 Ga0105240_10000377
626 Ga0105240_10009278
627 Ga0105240_10207040
628 Ga0105241_10083164
629 Ga0105241_10283024
630 Ga0105242_10218422
631 Ga0105237_10000075
632 Ga0105237_10214243
633 Ga0105238_10006002
634 Ga0105239_10278697
635 Ga0105246_10677908
636 Ga0157371_10002448
637 Ga0157371_10062374
638 Ga0157370_10010403
639 Ga0157370_10376521
640 Ga0157369_10006942
641 Ga0157369_10010701
642 Ga0157369_10076866
643 Ga0157374_10110103
644 Ga0163162_10050705
645 Ga0182008_10000013
646 Ga0182006_1011443
647 Ga0182007_10000890
648 Ga0182007_10034565
649 Ga0163161_10009636
650 Ga0163161_10035218
651 Ga0213876_10000435
652 Ga0209566_100201
653 Ga0209674_101509
654 Ga0209672_100200
655 Ga0209147_100265
656 Ga0209258_100439
657 Ga0209148_1000422
658 Ga0209233_1011368
659 Ga0209455_1000322
660 Ga0209675_1000026
661 Ga0209676_1000059
662 Ga0209676_1000075
663 Ga0209676_1000217
664 Ga0209676_1000430
665 Ga0209676_1009431
666 Ga0209025_1000066
667 Ga0209025_1018468
668 Ga0209564_1000562
669 Ga0209758_1036805
670 Ga0209050_1004528
671 Ga0209050_1006552
672 Ga0209050_1023539
673 Ga0209050_1039381
674 Ga0209256_1000182
675 Ga0209257_1000184
676 Ga0209257_1002469
677 Ga0209257_1051138
678 Ga0207656_10004236
679 Ga0207655_1000834
680 Ga0207710_10043536
681 Ga0207680_10004781
682 Ga0207647_10001123
683 Ga0207647_10091823
684 Ga0207695_10000007
685 Ga0207695_10001969
686 Ga0207695_10017795
687 Ga0207695_10030328
688 Ga0207671_10000104
689 Ga0207671_10013102
690 Ga0207671_10031100
691 Ga0207671_10106088
692 Ga0207649_10324736
693 Ga0207681_10003306
694 Ga0207694_10000996
695 Ga0207694_10002131
696 Ga0207650_10004121
697 Ga0207706_10013049
698 Ga0207704_10121187
699 Ga0207712_10000349
700 Ga0207668_10000027
701 Ga0207658_10000091
702 Ga0207658_10020562
703 Ga0207677_10299857
704 Ga0207703_10005588
705 Ga0207639_10000102
706 Ga0207678_10023453
707 Ga0207678_10126995
708 Ga0207702_10260275
709 Ga0207641_10000093
710 Ga0207648_10312101
711 Ga0207698_10008725
712 Ga0207698_10009455
713 Ga0209371_1000023
714 Ga0209371_1002223
715 Ga0268266_10000001
716 Ga0268266_10000006
717 Ga0268266_10052861
718 Ga0268266_10083967
719 Ga0268266_10142445
720 Ga0268264_10000049
721 Ga0268256_1000023
722 Ga0268256_1002503
723 Ga0307511_10101435
724 Ga0316182_1445581
725 Ga0307509_10005665
726 Ga0307509_10363896
727 Ga0265342_10197333
728 Ga0307516_10001045
729 Ga0307516_10001603
730 Ga0307516_10009088
731 Ga0307516_10055146
732 Ga0307516_10123654
733 Ga0307516_10228621
734 Ga0307406_10000326
735 Ga0307412_10000201
736 Ga0307412_10002382
737 Ga0307507_10092042
738 Ga0373935_0111774
739 Ga0373927_0028417
740 Ga0373925_0269171
741 Ga0395898_0009870
742 Ga0395905_0000095
743 Ga0439465_0004973
744 Ga0451807_0812982
745 Ga0451807_2048314
746 Ga0451837_1349669
747 Ga0450911_002957
748 Ga0450901_001931
749 Ga0466969_0002099
750 Ga0466972_0001438
751 Ga0466972_0002988
752 Ga0466972_0035149
753 Ga0466972_0040416
754 Ga0466982_0000006
755 Ga0466965_0006843
756 Ga0466965_0041178
757 Ga0466966_0005940
758 Ga0466966_0026280
759 Ga0466961_0035008
760 Ga0466961_0085914
761 Ga0466971_0000430
762 Ga0466968_0001977
763 Ga0466968_0003085
764 Ga0466970_0000972
765 Ga0466970_0024216
766 Ga0466970_0029338
767 Ga0466970_0082526
768 Ga0466960_0025096
769 Ga0466959_0014900
770 Ga0466959_0054582
771 Ga0451576_0199423
772 Ga0495603_0052667
773 Ga0495590_0009975
774 Ga0495629_0030950
775 Ga0495651_0052522
776 Ga0495653_0008808
777 Ga0495653_0050646
778 Ga0495650_0001416
779 Ga0495650_0006928
780 Ga0495650_0007948
781 Ga0495580_0002007
782 Ga0495582_0026979
783 Ga0495639_0002043
784 Ga0495664_0116738
785 Ga0495594_0225028
786 Ga0495583_0006550
787 Ga0495606_0106173
788 Ga0495628_0004119
789 Ga0495648_0040394
790 Ga0495663_0000971
791 Ga0495666_0018685
792 Ga0495642_0033986
793 Ga0495652_0034205
794 Ga0495654_0093008
795 Ga0495640_0053408
796 Ga0495586_0014479
797 Ga0495587_0010424
798 Ga0495621_0036916
799 Ga0495645_0004593
800 Ga0495622_0000438
801 Ga0495622_0007581
802 Ga0495622_0090956
803 Ga0495622_0095493
804 Ga0495633_0001400
805 Ga0495633_0010561
806 Ga0495656_0017155
807 Ga0495656_0042384
808 Ga0495634_0025903
809 Ga0495611_0024361
810 Ga0495611_0057980
811 Ga0495611_0076026
812 Ga0495588_0030612
813 Ga0495588_0049620
814 Ga0495657_0227777
815 Ga0495599_0003759
816 Ga0495599_0042463
817 Ga0495623_0007887
818 Ga0495623_0021147
819 Ga0495646_0063295
820 Ga0495613_0071943
821 Ga0495624_0024187
822 Ga0495624_0181942
823 Ga0495671_0073825
824 Ga0495581_0196959
825 Ga0495604_0009270
826 Ga0495604_0019258
827 Ga0495636_0011276
828 Ga0495674_0260931
829 Ga0495672_0044690
830 Ga0495672_0055693
831 Ga0495672_0084723
832 Ga0495680_0059790
833 Ga0495680_0177499
834 Ga0495687_000317
835 Ga0495687_007457
836 Ga0495687_087572
837 Ga0495679_000026
838 Ga0495679_000163
839 Ga0495673_0001685
840 Ga0495673_0099702
841 Ga0495681_0000990
842 Ga0495684_0117766
843 Ga0495686_0000468
844 Ga0495593_0007887
845 Ga0495602_0011233
846 Ga0495602_0041228
847 Ga0495602_0229324
848 Ga0495614_0084296
849 Ga0496116_0000396
850 Ga0496117_0000065
851 Ga0496117_0043863
852 Ga0496117_0071096
853 Ga0496118_0000033
854 Ga0496118_0003358
855 Ga0496118_0006819
856 Ga0496118_0072313
857 Ga0496119_0034999
858 Ga0496119_0080028
859 Ga0496120_0032253
860 Ga0496121_0000998
861 Ga0496121_0005308
862 Ga0496121_0023216
863 Ga0496121_0033424
864 Ga0496121_0067615
865 Ga0496121_0182195
866 Ga0496122_0036356
867 Ga0496123_0003788
868 Ga0496124_0005318
869 Ga0496124_0242395
870 Ga0496125_0002097
871 Ga0496125_0011344
872 Ga0496126_0271142
873 Ga0495682_0114447
874 Ga0501031_0238719
875 Ga0501032_0070568
876 Ga0501033_0104426
877 Ga0501034_0021560
878 Ga0501034_0114556
879 Ga0501036_0186915
880 Ga0501037_0138913
881 Ga0501038_0057834
882 Ga0501039_0104881
883 Ga0501046_0263726
884 Ga0501047_0004388
885 Ga0501067_0003943
886 Ga0501068_0005043
887 Ga0501068_0103486
888 Ga0501069_0004419
889 Ga0501070_0011476
890 Ga0501071_0003055
891 Ga0501072_0067383
892 Ga0501073_0007543
893 Ga0501074_0008710
894 Ga0501080_0012478
895 Ga0501080_0111626
896 Ga0501083_0008809
897 Ga0501035_0001137
898 Ga0501044_0003135
899 Ga0501044_0042042
900 nmdc:mga0k408_25419_c1
901 nmdc:mga0qj67_234647_c1
902 Ga0500641_0003397
903 Ga0500641_0066356
904 Ga0500650_0007117
905 Ga0500642_0184294
906 Ga0500568_0001243
907 Ga0500568_0001396
908 Ga0500590_080922
909 Ga0501084_0011057
910 Ga0501082_0010498
911 Ga0466962_0002385
912 2510303947
913 2511497315
914 2512353198
915 2513582079
916 2513615112
917 2513881513
918 2513901204
919 2513908249
920 2513926888
921 2515609579
922 2515683992
923 2516895453
924 2524452680
925 2547501929
926 2551682438
927 2551688631
928 2551695796
929 2551703010
930 2551711015
931 2551720470
932 2551730814
933 2551735563
934 2551743968
935 2578458227
936 2585231696
937 2585255044
938 2599420618
939 2644085246
940 2644193461
941 2644342798
942 2644366098
943 2644657850
944 2747948487
945 2765579372
946 2819565285
947 2819635083
948 2838040708
949 2838664905
950 2840881552
951 2842334988
952 2842391625
953 2842760744
954 2842776706
955 2842781075
956 2855829721
957 2855844825
958 2857443300
959 2858805719
960 2874222066
961 2882462234
962 2884341117
963 2885274874
964 2885306689
965 2885328394
966 2885334799
967 2902687166
968 2904466955
969 2904570962
970 2904578084
971 2909047495
972 2915987569
973 2915999935
974 2916006733
975 2916012054
976 2916017063
977 2916025315
978 2916029527
979 2916040003
980 2916047771
981 2916051472
982 2916059290
983 2916072185
984 2916082265
985 2919090879
986 2919135648
987 2921201783
988 2921211397
989 2921238347
990 2921246953
991 2921262918
992 2921267309
993 2921288039
994 2921293110
995 2921301254
996 2924144128
997 2924151055
998 2924158386
999 2924166365
1000 2924172971
1001 2924179900
1002 2924189570
1003 2924197713
1004 2924202281
1005 2924210478
1006 2924217144
1007 2924222675
1008 2924229399
1009 2928499741
1010 2928543060
1011 2931380345
1012 2933017453
1013 2936996941
1014 2937004952
1015 2937015153
1016 2937016544
1017 2937026401
1018 2937049301
1019 2937055055
1020 2937057803
1021 2937070328
1022 2937073635
1023 2937098833
1024 2937100785
1025 2937107635
1026 2937119074
1027 2937121608
1028 2937127187
1029 2937612902
1030 2939626461
1031 2939626912
1032 2957387952
1033 2957392397
1034 2957395628
1035 2957402420
1036 2957413945
1037 2957418548
1038 2957429435
1039 2957433264
1040 2957443084
1041 2957444332
1042 2957455876
1043 2957460581
1044 2957466739
1045 2957471838
1046 2957482596
1047 2957488235
1048 2957497079
1049 2957503881
1050 2957512696
1051 2960584362
1052 2960592421
1053 2960599411
1054 2960610378
1055 2960616104
1056 2960619496
1057 2960629315
1058 2960641608
1059 2960647186
1060 2960657404
1061 2960662347
1062 2960669075
1063 2960674157
1064 2960689411
1065 2961048833
1066 2961067738
1067 2964613345
1068 2964617466
1069 2964623170
1070 2964630692
1071 2964638836
1072 2964645079
1073 2964651823
1074 2964661756
1075 2964667141
1076 2964677630
1077 2964679943
1078 2964688751
1079 2964696976
1080 2964701166
1081 2964712495
1082 2964715074
1083 2964724178
1084 2967670464
1085 2967675869
1086 2967683113
1087 2967697122
1088 2967700086
1089 2967706979
1090 2967717787
1091 2967724100
1092 2967740442
1093 2967742027
1094 2967755052
1095 2967758403
1096 2967767836
1097 2967771082
1098 2967776112
1099 2970021383
1100 2970034057
1101 2970045932
1102 2970051254
1103 2970055005
1104 2970063410
1105 2970069202
1106 2970076310
1107 2970082845
1108 2970090816
1109 2970095996
1110 2970104753
1111 2970109388
1112 2970116393
1113 2970132777
1114 2970142459
1115 2970147613
1116 2970150223
1117 2970159686
1118 2970166008
1119 2970175082
1120 2970177994
1121 2970191217
1122 2970198692
1123 2977517009
1124 2977526174
1125 2977544266
1126 2977553873
1127 2977564358
1128 2977571483
1129 2977577195
1130 2977582810
1131 648736854
1132 8003997361
1133 8020941280
1134 8020956616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

195

259

0.93

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

21

261

0.9

PF12146

Hydrolase_4

Serine aminopeptidase, S33

20

136

0.9

PF00326

Peptidase_S9

Prolyl oligopeptidase family

145

276

0.75

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

23

267

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a8s-assembly1.cif.gz_A chloroperoxidase f/propionate complex 0.9943 27 298
4dgq-assembly1.cif.gz_C crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia 0.9938 28 298
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.9905 27 298
3ia2-assembly2.cif.gz_D pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog 0.9903 27 298
3hi4-assembly2.cif.gz_D switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase 0.9903 27 298
ID Description Score Start End Superfamily
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9935 28 298 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9893 27 298 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9857 27 298 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9851 27 298 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9745 27 298 3.40.50.1820
ID Description Score Start End GO Terms
AF-E6PXJ0-F1-model_v4 Putative peroxidase/hydrolase 0.9983 27 298 GO:0004601
GO:0016787
AF-A0A3G7BLC3-F1-model_v4 deleted 0.997 27 298
AF-A0A3D0GG95-F1-model_v4 deleted 0.9964 51 298
AF-A0A7I6QCA6-F1-model_v4 deleted 0.9946 117 298
AF-A0A087NKY4-F1-model_v4 deleted 0.9942 27 298

Map