F464490

General Info

Members Datasets Scaffolds Average Seq Length
567 280 1134 257

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100305037|Ga0068855_1003050373
Length 280
Sequence VTLGGQERSDPGSGLSHPAYGQLRRVTDTASVLLCDNPGLMTLDGTNTWVLQGPGSDEMVIVDPXPDDDEHIGRIASLGKIPLVLISHKHEDHTGAIDKIVDRTGAVVRAVGSGFLRGLGGPLSDGEVIDAAGLRITVMATPGHTADSLSFLVDVWGERSDGRGGAVLTADTVLGRGTTVIDTEDGSLRDYLESLRRLHGLGQRVVLPGHGPELGDLEAVAAMYLAHREERLGQVRDALRVLGEDATARQVVEHVYTDVDEKLWDAAEKSTEAQLTYLRS

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
262 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
267 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
273 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
274 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
275 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
276 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
277 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
278 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
279 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
280 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 0.18
Rhizoplane 13.05
Rhizosphere 63.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100305037 3300005563 Bacteria 1763
2 JGI24746J21847_1001331 3300001977 Bacteria 3934
3 JGI24739J22299_10026914 3300001989 Bacteria 2014
4 JGI24743J22301_10021971 3300001991 Bacteria 1221
5 JGI24750J21931_1002875 3300002070 Bacteria 2068
6 JGI24744J21845_10000036 3300002077 Bacteria 15776
7 JGI24744J21845_10008210 3300002077 Bacteria 2156
8 JGI24034J26672_10029769 3300002239 Bacteria 885
9 JGI24751J29686_10017327 3300002459 Bacteria 1488
10 Ga0055540_1000128 3300003792 Bacteria 77207
11 Ga0055540_1003523 3300003792 Bacteria 7514
12 Ga0055540_1007880 3300003792 Bacteria 3935
13 Ga0055540_1029390 3300003792 Bacteria 1287
14 Ga0070676_10026368 3300005328 Bacteria 3291
15 Ga0070683_100260923 3300005329 Bacteria 1648
16 Ga0070690_100087509 3300005330 Bacteria 2046
17 Ga0068869_100043910 3300005334 Bacteria 3213
18 Ga0070680_100597889 3300005336 Bacteria 947
19 Ga0070682_100010609 3300005337 Bacteria 5233
20 Ga0068868_100004397 3300005338 Bacteria 9879
21 Ga0068868_100137557 3300005338 Bacteria 2003
22 Ga0070660_100027175 3300005339 Bacteria 4268
23 Ga0070660_100578559 3300005339 Bacteria 938
24 Ga0070689_100503171 3300005340 Bacteria 1038
25 Ga0070689_100596503 3300005340 Bacteria 956
26 Ga0070691_10003792 3300005341 Bacteria 6824
27 Ga0070668_100000612 3300005347 Bacteria 23913
28 Ga0070668_100023325 3300005347 Bacteria 4680
29 Ga0070668_100276404 3300005347 Bacteria 1401
30 Ga0070669_100000503 3300005353 Bacteria 29454
31 Ga0070669_100008403 3300005353 Bacteria 7368
32 Ga0070671_100024864 3300005355 Bacteria 4907
33 Ga0070671_100147393 3300005355 Bacteria 1987
34 Ga0070674_100000542 3300005356 Bacteria 18928
35 Ga0070674_100074625 3300005356 Bacteria 2407
36 Ga0070688_100016773 3300005365 Bacteria 4193
37 Ga0070659_100006875 3300005366 Bacteria 8239
38 Ga0070659_100237365 3300005366 Bacteria 1508
39 Ga0070667_100000054 3300005367 Bacteria 151864
40 Ga0070667_100068274 3300005367 Bacteria 3024
41 Ga0070703_10022064 3300005406 Bacteria 1865
42 Ga0070709_10007859 3300005434 Bacteria 5857
43 Ga0070714_100079160 3300005435 Bacteria 2857
44 Ga0070713_100132018 3300005436 Bacteria 2203
45 Ga0070710_10004514 3300005437 Bacteria 6585
46 Ga0070710_10018699 3300005437 Bacteria 3569
47 Ga0070701_10000355 3300005438 Bacteria 15231
48 Ga0070711_100006966 3300005439 Bacteria 6855
49 Ga0070711_100061391 3300005439 Bacteria 2617
50 Ga0070705_100243040 3300005440 Bacteria 1259
51 Ga0070700_100086304 3300005441 Bacteria 2037
52 Ga0070700_100136563 3300005441 Bacteria 1661
53 Ga0070694_100027260 3300005444 Bacteria 3709
54 Ga0070663_100329166 3300005455 Bacteria 1231
55 Ga0070678_100000240 3300005456 Bacteria 25075
56 Ga0070662_100011661 3300005457 Bacteria 5802
57 Ga0070662_100041482 3300005457 Bacteria 3283
58 Ga0070681_10461212 3300005458 Bacteria 1183
59 Ga0068867_100001913 3300005459 Bacteria 14498
60 Ga0068867_100337025 3300005459 Bacteria 1254
61 Ga0070685_10132366 3300005466 Bacteria 1561
62 Ga0070684_100614208 3300005535 Bacteria 1011
63 Ga0068853_100009813 3300005539 Bacteria 7725
64 Ga0070695_100058033 3300005545 Bacteria 2502
65 Ga0070696_100003869 3300005546 Bacteria 9998
66 Ga0070693_100008151 3300005547 Bacteria 5148
67 Ga0070665_100005662 3300005548 Bacteria 12842
68 Ga0070665_100036847 3300005548 Bacteria 4918
69 Ga0070665_100069247 3300005548 Bacteria 3536
70 Ga0070665_100083917 3300005548 Bacteria 3190
71 Ga0070704_100023640 3300005549 Bacteria 4019
72 Ga0068855_100202536 3300005563 Bacteria 2234
73 Ga0070664_100488010 3300005564 Bacteria 1134
74 Ga0068854_100006177 3300005578 Bacteria 7603
75 Ga0068856_100264692 3300005614 Bacteria 1735
76 Ga0070702_100000643 3300005615 Bacteria 12971
77 Ga0068852_100178699 3300005616 Bacteria 1994
78 Ga0068859_100038030 3300005617 Bacteria 4829
79 Ga0068859_100168536 3300005617 Bacteria 2270
80 Ga0068859_100246688 3300005617 Bacteria 1875
81 Ga0068864_100220721 3300005618 Bacteria 1749
82 Ga0068866_10001606 3300005718 Bacteria 9578
83 Ga0068861_100002075 3300005719 Bacteria 12996
84 Ga0068861_100171741 3300005719 Bacteria 1797
85 Ga0068870_10348967 3300005840 Bacteria 949
86 Ga0068863_100026655 3300005841 Bacteria 5511
87 Ga0068863_100101108 3300005841 Bacteria 2740
88 Ga0068863_100503700 3300005841 Bacteria 1192
89 Ga0068858_100006020 3300005842 Bacteria 11829
90 Ga0068858_100020079 3300005842 Bacteria 6249
91 Ga0068858_100686070 3300005842 Bacteria 996
92 Ga0068860_100000246 3300005843 Bacteria 81869
93 Ga0068860_100000986 3300005843 Bacteria 31453
94 Ga0068860_100193334 3300005843 Bacteria 1969
95 Ga0068862_100000024 3300005844 Bacteria 197686
96 Ga0068862_100026059 3300005844 Bacteria 4914
97 Ga0068862_100040538 3300005844 Bacteria 3958
98 Ga0068862_100221035 3300005844 Bacteria 1715
99 Ga0081455_10044246 3300005937 Bacteria 3887
100 Ga0081455_10069414 3300005937 Bacteria 2930
101 Ga0081538_10089489 3300005981 Bacteria 1598
102 Ga0075365_10001760 3300006038 Bacteria 10087
103 Ga0075365_10003855 3300006038 Bacteria 7832
104 Ga0075365_10004009 3300006038 Bacteria 7719
105 Ga0075365_10125455 3300006038 Bacteria 1774
106 Ga0075363_100000617 3300006048 Bacteria 11761
107 Ga0075363_100000889 3300006048 Bacteria 10521
108 Ga0075363_100001162 3300006048 Bacteria 9654
109 Ga0075363_100087858 3300006048 Bacteria 1708
110 Ga0075364_10000442 3300006051 Bacteria 20783
111 Ga0075364_10002781 3300006051 Bacteria 9834
112 Ga0075364_10006806 3300006051 Bacteria 6743
113 Ga0075364_10061147 3300006051 Bacteria 2470
114 Ga0075364_10088435 3300006051 Bacteria 2054
115 Ga0075364_10109947 3300006051 Bacteria 1838
116 Ga0075364_10116214 3300006051 Bacteria 1788
117 Ga0075364_10165052 3300006051 Bacteria 1496
118 Ga0075364_10215278 3300006051 Bacteria 1303
119 Ga0075364_10330098 3300006051 Bacteria 1039
120 Ga0070715_10001419 3300006163 Bacteria 6932
121 Ga0070716_100067343 3300006173 Bacteria 2092
122 Ga0070716_100182416 3300006173 Bacteria 1379
123 Ga0070712_100001832 3300006175 Bacteria 12940
124 Ga0070712_100193410 3300006175 Bacteria 1593
125 Ga0070712_100385927 3300006175 Bacteria 1154
126 Ga0075367_10004774 3300006178 Bacteria 6664
127 Ga0075369_10008637 3300006186 Bacteria 3929
128 Ga0075369_10022055 3300006186 Bacteria 2624
129 Ga0075369_10025646 3300006186 Bacteria 2453
130 Ga0075369_10031921 3300006186 Bacteria 2226
131 Ga0075369_10088139 3300006186 Bacteria 1382
132 Ga0075370_10028907 3300006353 Bacteria 3084
133 Ga0075428_100142898 3300006844 Bacteria 2602
134 Ga0075430_100211572 3300006846 Bacteria 1609
135 Ga0068865_100006081 3300006881 Bacteria 7362
136 Ga0097620_100038030 3300006931 Bacteria 4829
137 Ga0097620_100168536 3300006931 Bacteria 2270
138 Ga0097620_100246708 3300006931 Bacteria 1875
139 Ga0105250_10041987 3300009092 Bacteria 1833
140 Ga0105245_10000550 3300009098 Bacteria 34123
141 Ga0105245_10844809 3300009098 Bacteria 955
142 Ga0105245_10890445 3300009098 Bacteria 931
143 Ga0105247_10000073 3300009101 Bacteria 113714
144 Ga0105247_10000477 3300009101 Bacteria 33443
145 Ga0105247_10109146 3300009101 Bacteria 1778
146 Ga0105247_10278592 3300009101 Bacteria 1153
147 Ga0114129_10028302 3300009147 Bacteria 7940
148 Ga0105243_10001265 3300009148 Bacteria 22712
149 Ga0105243_10194533 3300009148 Bacteria 1774
150 Ga0105241_10011776 3300009174 Bacteria 6424
151 Ga0105242_10000552 3300009176 Bacteria 29645
152 Ga0105248_10000088 3300009177 Bacteria 103505
153 Ga0105248_10002522 3300009177 Bacteria 20377
154 Ga0105248_10122691 3300009177 Bacteria 2931
155 Ga0105248_10445147 3300009177 Bacteria 1460
156 Ga0105237_10004938 3300009545 Bacteria 15240
157 Ga0105237_10011693 3300009545 Bacteria 9284
158 Ga0105238_10024176 3300009551 Bacteria 6195
159 Ga0105249_10000126 3300009553 Bacteria 103461
160 Ga0105249_10001282 3300009553 Bacteria 22065
161 Ga0105249_10002446 3300009553 Bacteria 16120
162 Ga0105249_10114651 3300009553 Bacteria 2552
163 Ga0105147_105718 3300009982 Bacteria 1047
164 Ga0099796_10020122 3300010159 Bacteria 2035
165 Ga0105239_10003697 3300010375 Bacteria 18631
166 Ga0105239_10209312 3300010375 Bacteria 2186
167 Ga0105239_10249003 3300010375 Bacteria 1995
168 Ga0105239_10263228 3300010375 Bacteria 1938
169 Ga0105246_10081470 3300011119 Bacteria 2307
170 Ga0157369_10355282 3300013105 Bacteria 1522
171 Ga0157378_10002494 3300013297 Bacteria 16374
172 Ga0163162_10003098 3300013306 Bacteria 15877
173 Ga0163162_10176374 3300013306 Bacteria 2263
174 Ga0163162_10654078 3300013306 Bacteria 1174
175 Ga0157372_10041447 3300013307 Bacteria 5091
176 Ga0157375_10000957 3300013308 Bacteria 24989
177 Ga0157375_10350244 3300013308 Bacteria 1643
178 Ga0157375_10486874 3300013308 Bacteria 1398
179 Ga0157375_10490284 3300013308 Bacteria 1393
180 Ga0163163_10011130 3300014325 Bacteria 8146
181 Ga0163163_10016288 3300014325 Bacteria 6903
182 Ga0163163_10336008 3300014325 Bacteria 1566
183 Ga0157380_10000206 3300014326 Bacteria 34907
184 Ga0157377_10107030 3300014745 Bacteria 1676
185 Ga0157376_10131720 3300014969 Bacteria 2232
186 Ga0163161_10003884 3300017792 Bacteria 10476
187 Ga0163161_10520670 3300017792 Bacteria 971
188 Ga0213876_10001338 3300021384 Bacteria 15444
189 Ga0213876_10084618 3300021384 Bacteria 1678
190 Ga0213875_10018646 3300021388 Bacteria 3344
191 Ga0213875_10037672 3300021388 Bacteria 2279
192 Ga0209673_1053251 3300025273 Bacteria 1057
193 Ga0209051_1000305 3300025303 Bacteria 77260
194 Ga0209051_1000915 3300025303 Bacteria 29327
195 Ga0209051_1001195 3300025303 Bacteria 23470
196 Ga0209051_1002539 3300025303 Bacteria 12897
197 Ga0209051_1021035 3300025303 Bacteria 2791
198 Ga0207696_1045693 3300025711 Bacteria 1265
199 Ga0207692_10075972 3300025898 Bacteria 1783
200 Ga0207642_10000198 3300025899 Bacteria 17601
201 Ga0207642_10016053 3300025899 Bacteria 2810
202 Ga0207642_10194343 3300025899 Bacteria 1116
203 Ga0207710_10000099 3300025900 Bacteria 113735
204 Ga0207710_10003628 3300025900 Bacteria 6841
205 Ga0207688_10001328 3300025901 Bacteria 12857
206 Ga0207688_10008625 3300025901 Bacteria 5549
207 Ga0207680_10173387 3300025903 Bacteria 1454
208 Ga0207647_10013376 3300025904 Bacteria 5692
209 Ga0207647_10112689 3300025904 Bacteria 1607
210 Ga0207685_10021368 3300025905 Bacteria 2168
211 Ga0207699_10008199 3300025906 Bacteria 5144
212 Ga0207645_10015927 3300025907 Bacteria 4983
213 Ga0207643_10334635 3300025908 Bacteria 948
214 Ga0207707_10676088 3300025912 Bacteria 868
215 Ga0207671_10012097 3300025914 Bacteria 6968
216 Ga0207693_10002328 3300025915 Bacteria 16509
217 Ga0207693_10118056 3300025915 Bacteria 2083
218 Ga0207663_10046886 3300025916 Bacteria 2665
219 Ga0207663_10053188 3300025916 Bacteria 2529
220 Ga0207649_10200066 3300025920 Bacteria 1411
221 Ga0207681_10006366 3300025923 Bacteria 7250
222 Ga0207681_10017597 3300025923 Bacteria 4490
223 Ga0207694_10025538 3300025924 Bacteria 4490
224 Ga0207694_10266277 3300025924 Bacteria 1405
225 Ga0207659_10154693 3300025926 Bacteria 1794
226 Ga0207687_10002843 3300025927 Bacteria 11753
227 Ga0207664_10019094 3300025929 Bacteria 5060
228 Ga0207644_10132476 3300025931 Bacteria 1910
229 Ga0207706_10028700 3300025933 Bacteria 4967
230 Ga0207706_10029573 3300025933 Bacteria 4890
231 Ga0207709_10001153 3300025935 Bacteria 19244
232 Ga0207670_10531221 3300025936 Bacteria 959
233 Ga0207669_10000469 3300025937 Bacteria 17615
234 Ga0207669_10043292 3300025937 Bacteria 2636
235 Ga0207704_10000572 3300025938 Bacteria 16393
236 Ga0207704_10310343 3300025938 Bacteria 1212
237 Ga0207665_10003687 3300025939 Bacteria 10229
238 Ga0207665_10024579 3300025939 Bacteria 3973
239 Ga0207711_10000386 3300025941 Bacteria 46700
240 Ga0207711_10094512 3300025941 Bacteria 2635
241 Ga0207711_10155639 3300025941 Bacteria 2065
242 Ga0207689_10014963 3300025942 Bacteria 6583
243 Ga0207689_10260054 3300025942 Bacteria 1436
244 Ga0207667_10258811 3300025949 Bacteria 1780
245 Ga0207712_10000093 3300025961 Bacteria 103470
246 Ga0207712_10003821 3300025961 Bacteria 9508
247 Ga0207712_10111231 3300025961 Bacteria 2055
248 Ga0207668_10001310 3300025972 Bacteria 14773
249 Ga0207668_10002201 3300025972 Bacteria 11374
250 Ga0207668_10223633 3300025972 Bacteria 1513
251 Ga0207640_10002689 3300025981 Bacteria 9514
252 Ga0207640_10039294 3300025981 Bacteria 2994
253 Ga0207640_10084629 3300025981 Bacteria 2178
254 Ga0207658_10000096 3300025986 Bacteria 98147
255 Ga0207658_10003389 3300025986 Bacteria 11281
256 Ga0207677_10000944 3300026023 Bacteria 16222
257 Ga0207677_10160554 3300026023 Bacteria 1746
258 Ga0207703_10005058 3300026035 Bacteria 10675
259 Ga0207703_10186821 3300026035 Bacteria 1832
260 Ga0207703_10319480 3300026035 Bacteria 1421
261 Ga0207639_10058665 3300026041 Bacteria 2961
262 Ga0207678_10008585 3300026067 Bacteria 9000
263 Ga0207708_10133015 3300026075 Bacteria 1946
264 Ga0207708_10191734 3300026075 Bacteria 1627
265 Ga0207702_10244705 3300026078 Bacteria 1682
266 Ga0207702_10619712 3300026078 Bacteria 1062
267 Ga0207641_10000164 3300026088 Bacteria 93616
268 Ga0207641_10001427 3300026088 Bacteria 23500
269 Ga0207641_10023522 3300026088 Bacteria 5075
270 Ga0207641_10204943 3300026088 Bacteria 1821
271 Ga0207648_10372609 3300026089 Bacteria 1290
272 Ga0207676_10117826 3300026095 Bacteria 2234
273 Ga0207675_100006606 3300026118 Bacteria 10971
274 Ga0207675_100228274 3300026118 Bacteria 1795
275 Ga0207683_10003649 3300026121 Bacteria 13390
276 Ga0207683_10028797 3300026121 Bacteria 4805
277 Ga0268266_10007067 3300028379 Bacteria 10193
278 Ga0268266_10011869 3300028379 Bacteria 7547
279 Ga0268266_10061133 3300028379 Bacteria 3248
280 Ga0268266_10499313 3300028379 Bacteria 1161
281 Ga0268266_10671526 3300028379 Bacteria 998
282 Ga0268265_10000012 3300028380 Bacteria 343132
283 Ga0268265_10145740 3300028380 Bacteria 1989
284 Ga0268264_10000104 3300028381 Bacteria 217837
285 Ga0268264_10000885 3300028381 Bacteria 31559
286 Ga0268264_10089172 3300028381 Bacteria 2655
287 Ga0268264_10177815 3300028381 Bacteria 1930
288 Ga0265327_10002144 3300031251 Bacteria 21784
289 Ga0307405_10043201 3300031731 Bacteria 2748
290 Ga0307413_10007279 3300031824 Bacteria 5126
291 Ga0307413_10644072 3300031824 Bacteria 873
292 Ga0307410_10001244 3300031852 Bacteria 11319
293 Ga0307409_100007355 3300031995 Bacteria 6580
294 Ga0307415_100106207 3300032126 Bacteria 2072
295 Ga0373951_0084038 3300035091 Bacteria 827
296 Ga0373955_0380796 3300035172 Bacteria 856
297 Ga0373931_0105860 3300035691 Bacteria 1589
298 Ga0373935_0289485 3300035692 Bacteria 1155
299 Ga0373947_0317874 3300035725 Bacteria 1041
300 Ga0436364_0636171 3300037853 Bacteria 12590
301 Ga0436364_0718930 3300037853 Bacteria 3527
302 Ga0436364_0839437 3300037853 Bacteria 1159
303 Ga0436364_1341984 3300037853 Bacteria 4577
304 Ga0436365_0065786 3300039437 Bacteria 16053
305 Ga0436365_0095204 3300039437 Bacteria 1890
306 Ga0436365_1041061 3300039437 Bacteria 87934
307 Ga0436365_1482123 3300039437 Bacteria 3645
308 Ga0436365_1488292 3300039437 Bacteria 1403
309 Ga0436365_1878623 3300039437 Bacteria 4636
310 Ga0436361_0026174 3300039447 Bacteria 994
311 Ga0436363_0364332 3300039450 Bacteria 2077
312 Ga0439466_0014229 3300041411 Bacteria 2900
313 Ga0439466_0018038 3300041411 Bacteria 2536
314 Ga0439465_0004754 3300041413 Bacteria 4377
315 Ga0451793_1219293 3300041452 Bacteria 4418
316 Ga0451795_0217691 3300041456 Bacteria 1545
317 Ga0451853_0703928 3300041512 Bacteria 1733
318 Ga0439431_0006954 3300041997 Bacteria 2517
319 Ga0439435_0015936 3300042436 Bacteria 1877
320 Ga0466972_0025208 3300044658 Bacteria 2949
321 Ga0466972_0028299 3300044658 Bacteria 2765
322 Ga0466972_0042512 3300044658 Bacteria 2209
323 Ga0466972_0053152 3300044658 Bacteria 1951
324 Ga0466965_0031369 3300044683 Bacteria 2591
325 Ga0466966_0008762 3300044684 Bacteria 6698
326 Ga0466966_0021213 3300044684 Bacteria 4266
327 Ga0466961_0005380 3300044693 Bacteria 8057
328 Ga0466964_0017279 3300044706 Bacteria 2760
329 Ga0466964_0049714 3300044706 Bacteria 1717
330 Ga0466971_0021210 3300044719 Bacteria 2890
331 Ga0466968_0003727 3300044735 Bacteria 5651
332 Ga0466968_0012387 3300044735 Bacteria 3338
333 Ga0466970_0170370 3300044765 Bacteria 1206
334 Ga0466957_0002195 3300044842 Bacteria 10462
335 Ga0466957_0012311 3300044842 Bacteria 4952
336 Ga0466957_0019571 3300044842 Bacteria 3982
337 Ga0466957_0276237 3300044842 Bacteria 1123
338 Ga0466960_0000049 3300044901 Bacteria 39790
339 Ga0466960_0010081 3300044901 Bacteria 3915
340 Ga0466960_0025588 3300044901 Bacteria 2671
341 Ga0466960_0196977 3300044901 Bacteria 1099
342 Ga0466959_0001637 3300045049 Bacteria 13837
343 Ga0466959_0019063 3300045049 Bacteria 5043
344 Ga0466959_0029222 3300045049 Bacteria 4084
345 Ga0466958_0001405 3300045836 Bacteria 11385
346 Ga0466958_0069018 3300045836 Bacteria 2161
347 Ga0466958_0234601 3300045836 Bacteria 1172
348 Ga0466967_0007714 3300045976 Bacteria 7801
349 Ga0466967_0009033 3300045976 Bacteria 7366
350 Ga0466967_0029240 3300045976 Bacteria 4610
351 Ga0466967_0186261 3300045976 Bacteria 1960
352 Ga0466967_0191221 3300045976 Bacteria 1934
353 Ga0466967_0228656 3300045976 Bacteria 1770
354 Ga0466967_0258348 3300045976 Bacteria 1666
355 Ga0466967_0433903 3300045976 Bacteria 1282
356 Ga0466967_0501947 3300045976 Bacteria 1191
357 Ga0466967_0541518 3300045976 Bacteria 1145
358 Ga0495629_0015395 3300046459 Bacteria 5493
359 Ga0495638_0044489 3300046460 Bacteria 2796
360 Ga0495638_0074298 3300046460 Bacteria 2073
361 Ga0495639_0125189 3300046475 Bacteria 1228
362 Ga0495606_0028973 3300046507 Bacteria 3895
363 Ga0495644_0109509 3300046523 Bacteria 1048
364 Ga0495648_0031033 3300046524 Bacteria 3524
365 Ga0495654_0039254 3300046530 Bacteria 2364
366 Ga0495635_0050893 3300046663 Bacteria 2855
367 Ga0495658_0010953 3300046683 Bacteria 4547
368 Ga0495581_0100170 3300047315 Bacteria 1683
369 Ga0495672_0004621 3300047320 Bacteria 11172
370 Ga0495672_0062044 3300047320 Bacteria 2152
371 Ga0495676_0068959 3300047321 Bacteria 2730
372 Ga0495673_0000739 3300047469 Bacteria 31175
373 Ga0495686_0005119 3300047472 Bacteria 10476
374 Ga0495686_0010294 3300047472 Bacteria 6661
375 Ga0496100_0000021 3300048903 Bacteria 140074
376 Ga0496100_0000176 3300048903 Bacteria 35625
377 Ga0496100_0007574 3300048903 Bacteria 6000
378 Ga0496100_0254206 3300048903 Bacteria 1301
379 Ga0496100_0322637 3300048903 Bacteria 1160
380 Ga0496101_0000043 3300048904 Bacteria 161643
381 Ga0496101_0000071 3300048904 Bacteria 119709
382 Ga0496101_0000910 3300048904 Bacteria 17422
383 Ga0496101_0061464 3300048904 Bacteria 2728
384 Ga0496101_0067751 3300048904 Bacteria 2607
385 Ga0496101_0098819 3300048904 Bacteria 2181
386 Ga0496101_0099009 3300048904 Bacteria 2179
387 Ga0496102_0000026 3300048905 Bacteria 227176
388 Ga0496102_0000133 3300048905 Bacteria 101632
389 Ga0496102_0002253 3300048905 Bacteria 16518
390 Ga0496102_0008456 3300048905 Bacteria 8824
391 Ga0496102_0012410 3300048905 Bacteria 7372
392 Ga0496102_0051223 3300048905 Bacteria 3761
393 Ga0496102_0229705 3300048905 Bacteria 1749
394 Ga0496102_0276234 3300048905 Bacteria 1583
395 Ga0496103_0000023 3300048906 Bacteria 227174
396 Ga0496103_0000410 3300048906 Bacteria 38075
397 Ga0496103_0000421 3300048906 Bacteria 37035
398 Ga0496103_0001048 3300048906 Bacteria 19317
399 Ga0496103_0044040 3300048906 Bacteria 2749
400 Ga0496104_0024378 3300048907 Bacteria 5565
401 Ga0496104_0030688 3300048907 Bacteria 4996
402 Ga0496104_0186816 3300048907 Bacteria 1983
403 Ga0496104_0316378 3300048907 Bacteria 1474
404 Ga0496104_0542124 3300048907 Bacteria 1074
405 Ga0496105_0010447 3300048908 Bacteria 7298
406 Ga0496105_0417456 3300048908 Bacteria 1063
407 Ga0496106_0002575 3300048909 Bacteria 13503
408 Ga0496106_0004008 3300048909 Bacteria 11008
409 Ga0496106_0004169 3300048909 Bacteria 10777
410 Ga0496106_0014348 3300048909 Bacteria 5854
411 Ga0496106_0025293 3300048909 Bacteria 4417
412 Ga0496106_0058966 3300048909 Bacteria 2907
413 Ga0496107_0006173 3300048910 Bacteria 8231
414 Ga0496107_0009575 3300048910 Bacteria 6720
415 Ga0496107_0011924 3300048910 Bacteria 6069
416 Ga0496107_0046645 3300048910 Bacteria 3118
417 Ga0496107_0057810 3300048910 Bacteria 2804
418 Ga0496108_0000541 3300048911 Bacteria 29566
419 Ga0496108_0001274 3300048911 Bacteria 19729
420 Ga0496108_0024033 3300048911 Bacteria 5017
421 Ga0496108_0032477 3300048911 Bacteria 4336
422 Ga0496108_0051545 3300048911 Bacteria 3448
423 Ga0496108_0142876 3300048911 Bacteria 2062
424 Ga0496109_0000308 3300048912 Bacteria 46150
425 Ga0496109_0000822 3300048912 Bacteria 25887
426 Ga0496109_0178906 3300048912 Bacteria 1991
427 Ga0496109_0220373 3300048912 Bacteria 1784
428 Ga0496109_0538781 3300048912 Bacteria 1101
429 Ga0496110_0037112 3300048913 Bacteria 4234
430 Ga0496110_0070593 3300048913 Bacteria 3095
431 Ga0496111_0008116 3300048914 Bacteria 6935
432 Ga0496111_0177909 3300048914 Bacteria 1581
433 Ga0496112_0003772 3300048915 Bacteria 12648
434 Ga0496112_0040966 3300048915 Bacteria 4530
435 Ga0496112_0056214 3300048915 Bacteria 3872
436 Ga0496112_0073525 3300048915 Bacteria 3379
437 Ga0496113_0003363 3300048916 Bacteria 9557
438 Ga0496113_0004604 3300048916 Bacteria 8503
439 Ga0496113_0108527 3300048916 Bacteria 2158
440 Ga0496114_0000052 3300048917 Bacteria 101539
441 Ga0496114_0001069 3300048917 Bacteria 20603
442 Ga0496114_0004138 3300048917 Bacteria 11223
443 Ga0496114_0280192 3300048917 Bacteria 1470
444 Ga0496115_0000351 3300048918 Bacteria 38720
445 Ga0496115_0002431 3300048918 Bacteria 13370
446 Ga0496115_0004793 3300048918 Bacteria 9815
447 Ga0496116_0000018 3300048919 Bacteria 545877
448 Ga0496116_0000799 3300048919 Bacteria 39896
449 Ga0496116_0049588 3300048919 Bacteria 2805
450 Ga0496117_0000015 3300048920 Bacteria 583316
451 Ga0496117_0002015 3300048920 Bacteria 26922
452 Ga0496117_0023942 3300048920 Bacteria 4847
453 Ga0496118_0000012 3300048921 Bacteria 583316
454 Ga0496118_0000295 3300048921 Bacteria 86668
455 Ga0496118_0000825 3300048921 Bacteria 49332
456 Ga0496118_0050623 3300048921 Bacteria 3185
457 Ga0496119_0000238 3300048922 Bacteria 77684
458 Ga0496119_0007632 3300048922 Bacteria 9700
459 Ga0496119_0008330 3300048922 Bacteria 9137
460 Ga0496119_0072866 3300048922 Bacteria 2005
461 Ga0496120_0000352 3300048923 Bacteria 75803
462 Ga0496120_0035234 3300048923 Bacteria 2992
463 Ga0496121_0000002 3300048924 Bacteria 1494588
464 Ga0496121_0000062 3300048924 Bacteria 274819
465 Ga0496121_0001660 3300048924 Bacteria 36727
466 Ga0496121_0085278 3300048924 Bacteria 2487
467 Ga0496122_0000048 3300048925 Bacteria 269532
468 Ga0496122_0015720 3300048925 Bacteria 7216
469 Ga0496124_0000002 3300048927 Bacteria 1494588
470 Ga0496125_0000002 3300048928 Bacteria 1480920
471 Ga0496125_0049706 3300048928 Bacteria 3480
472 Ga0496126_0000009 3300048929 Bacteria 750350
473 Ga0496126_0000227 3300048929 Bacteria 122133
474 Ga0496126_0002056 3300048929 Bacteria 28267
475 Ga0496126_0003125 3300048929 Bacteria 21349
476 Ga0501032_0001315 3300049569 Bacteria 19909
477 Ga0501032_0003186 3300049569 Bacteria 12624
478 Ga0501033_0005654 3300049570 Bacteria 9876
479 Ga0501033_0062952 3300049570 Bacteria 2731
480 Ga0501034_0024479 3300049571 Bacteria 6142
481 Ga0501036_0005200 3300049572 Bacteria 10523
482 Ga0501036_0016844 3300049572 Bacteria 6105
483 Ga0501037_0000898 3300049573 Bacteria 22178
484 Ga0501037_0003607 3300049573 Bacteria 11219
485 Ga0501038_0256612 3300049574 Bacteria 1383
486 Ga0501039_0000130 3300049575 Bacteria 52419
487 Ga0501043_0005985 3300049579 Bacteria 9776
488 Ga0501043_0112604 3300049579 Bacteria 2136
489 Ga0501046_0009717 3300049580 Bacteria 8297
490 Ga0501046_0207575 3300049580 Bacteria 1455
491 Ga0501047_0001766 3300049581 Bacteria 20901
492 Ga0501047_0009655 3300049581 Bacteria 9120
493 Ga0501047_0272729 3300049581 Bacteria 1538
494 Ga0501048_0001594 3300049582 Bacteria 17223
495 Ga0501069_0047676 3300049585 Bacteria 2378
496 Ga0501070_0001879 3300049586 Bacteria 18565
497 Ga0501070_0009592 3300049586 Bacteria 8177
498 Ga0501070_0064189 3300049586 Bacteria 3041
499 Ga0501071_0082108 3300049587 Bacteria 2360
500 Ga0501073_0082965 3300049589 Bacteria 2230
501 Ga0501080_0023016 3300049742 Bacteria 5778
502 Ga0501080_0042303 3300049742 Bacteria 4243
503 Ga0501080_0639857 3300049742 Bacteria 942
504 Ga0501035_0000834 3300049822 Bacteria 32953
505 Ga0501035_0528897 3300049822 Bacteria 968
506 Ga0501044_0000388 3300049823 Bacteria 54487
507 Ga0501044_0006239 3300049823 Bacteria 13181
508 Ga0501044_0008193 3300049823 Bacteria 11468
509 Ga0501044_0033302 3300049823 Bacteria 5416
510 Ga0501045_0370604 3300049824 Bacteria 1066
511 nmdc:mga03n38_105291_c1 3300050490 Bacteria 1366
512 nmdc:mga03n38_1795_c1 3300050490 Bacteria 6365
513 nmdc:mga03n38_2219_c1 3300050490 Bacteria 5931
514 nmdc:mga03n38_6069_c1 3300050490 Bacteria 4170
515 nmdc:mga00v17_1070_c1 3300050491 Bacteria 14406
516 nmdc:mga00v17_11326_c1 3300050491 Bacteria 4903
517 nmdc:mga00v17_116379_c1 3300050491 Bacteria 1167
518 nmdc:mga00v17_168871_c1 3300050491 Bacteria 1410
519 nmdc:mga00v17_182031_c1 3300050491 Bacteria 1356
520 nmdc:mga00v17_2717_c1 3300050491 Bacteria 9083
521 nmdc:mga00v17_515187_c1 3300050491 Bacteria 775
522 nmdc:mga00v17_5316_c1 3300050491 Bacteria 6782
523 nmdc:mga0yw44_17379_c1 3300050492 Bacteria 3913
524 nmdc:mga0yw44_294289_c1 3300050492 Bacteria 1087
525 nmdc:mga0yw44_311305_c1 3300050492 Bacteria 1056
526 nmdc:mga0yw44_70697_c1 3300050492 Bacteria 2165
527 nmdc:mga0yw44_758_c1 3300050492 Bacteria 11976
528 nmdc:mga0k408_237468_c1 3300050493 Bacteria 1088
529 nmdc:mga06z11_10067_c1 3300050494 Bacteria 4012
530 nmdc:mga06z11_83641_c1 3300050494 Bacteria 1718
531 nmdc:mga04h51_91256_c1 3300050495 Bacteria 1096
532 nmdc:mga07m45_126811_c1 3300050496 Bacteria 1476
533 nmdc:mga07m45_157859_c1 3300050496 Bacteria 1316
534 nmdc:mga07m45_2105_c1 3300050496 Bacteria 9255
535 nmdc:mga07m45_260533_c1 3300050496 Bacteria 1009
536 nmdc:mga05p37_102075_c1 3300050507 Bacteria 3532
537 nmdc:mga0qj67_21879_c1 3300050509 Bacteria 4906
538 nmdc:mga08y16_857835_c1 3300050511 Bacteria 897
539 nmdc:mga0sz30_1254_c1 3300050516 Bacteria 9065
540 nmdc:mga0sz30_27484_c1 3300050516 Bacteria 2337
541 nmdc:mga0sz30_3078_c1 3300050516 Bacteria 5973
542 nmdc:mga0sz30_49022_c1 3300050516 Bacteria 1219
543 nmdc:mga0sz30_8324_c2 3300050516 Bacteria 3555
544 nmdc:mga0sz30_966_c3 3300050516 Bacteria 5425
545 Ga0500635_0000793 3300053080 Bacteria 7843
546 Ga0500643_001006 3300053087 Bacteria 17262
547 Ga0500643_028398 3300053087 Bacteria 1731
548 Ga0500643_028739 3300053087 Bacteria 1717
549 Ga0500641_0063686 3300053096 Bacteria 1539
550 Ga0500556_0005321 3300053104 Bacteria 3639
551 Ga0500642_0059270 3300053130 Bacteria 1714
552 Ga0500652_000692 3300053131 Bacteria 11466
553 Ga0500616_0002446 3300053153 Bacteria 15432
554 Ga0500616_0030461 3300053153 Bacteria 2963
555 Ga0500616_0112772 3300053153 Bacteria 1311
556 Ga0500627_0168920 3300053158 Bacteria 986
557 Ga0501084_0079105 3300054114 Bacteria 2756
558 Ga0466962_0016386 3300061719 Bacteria 3574
559 2644488572 2643221687 Bacteria 6500351
560 2738664067 2738541264 Bacteria 5935393
561 2738703419 2738541274 Bacteria 6909446
562 2739143202 2738541356 Bacteria 5935017
563 2739329120 2738543028 Bacteria 6917070
564 2842136374 2842134933 Bacteria 5847019
565 2902795539 2902792274 Bacteria 7270173
566 2902842717 2902837492 Bacteria 6697721
567 2939583945 2939582691 Bacteria 7088898
568 Ga0068855_100305037
569 JGI24746J21847_1001331
570 JGI24739J22299_10026914
571 JGI24743J22301_10021971
572 JGI24750J21931_1002875
573 JGI24744J21845_10000036
574 JGI24744J21845_10008210
575 JGI24034J26672_10029769
576 JGI24751J29686_10017327
577 Ga0055540_1000128
578 Ga0055540_1003523
579 Ga0055540_1007880
580 Ga0055540_1029390
581 Ga0070676_10026368
582 Ga0070683_100260923
583 Ga0070690_100087509
584 Ga0068869_100043910
585 Ga0070680_100597889
586 Ga0070682_100010609
587 Ga0068868_100004397
588 Ga0068868_100137557
589 Ga0070660_100027175
590 Ga0070660_100578559
591 Ga0070689_100503171
592 Ga0070689_100596503
593 Ga0070691_10003792
594 Ga0070668_100000612
595 Ga0070668_100023325
596 Ga0070668_100276404
597 Ga0070669_100000503
598 Ga0070669_100008403
599 Ga0070671_100024864
600 Ga0070671_100147393
601 Ga0070674_100000542
602 Ga0070674_100074625
603 Ga0070688_100016773
604 Ga0070659_100006875
605 Ga0070659_100237365
606 Ga0070667_100000054
607 Ga0070667_100068274
608 Ga0070703_10022064
609 Ga0070709_10007859
610 Ga0070714_100079160
611 Ga0070713_100132018
612 Ga0070710_10004514
613 Ga0070710_10018699
614 Ga0070701_10000355
615 Ga0070711_100006966
616 Ga0070711_100061391
617 Ga0070705_100243040
618 Ga0070700_100086304
619 Ga0070700_100136563
620 Ga0070694_100027260
621 Ga0070663_100329166
622 Ga0070678_100000240
623 Ga0070662_100011661
624 Ga0070662_100041482
625 Ga0070681_10461212
626 Ga0068867_100001913
627 Ga0068867_100337025
628 Ga0070685_10132366
629 Ga0070684_100614208
630 Ga0068853_100009813
631 Ga0070695_100058033
632 Ga0070696_100003869
633 Ga0070693_100008151
634 Ga0070665_100005662
635 Ga0070665_100036847
636 Ga0070665_100069247
637 Ga0070665_100083917
638 Ga0070704_100023640
639 Ga0068855_100202536
640 Ga0070664_100488010
641 Ga0068854_100006177
642 Ga0068856_100264692
643 Ga0070702_100000643
644 Ga0068852_100178699
645 Ga0068859_100038030
646 Ga0068859_100168536
647 Ga0068859_100246688
648 Ga0068864_100220721
649 Ga0068866_10001606
650 Ga0068861_100002075
651 Ga0068861_100171741
652 Ga0068870_10348967
653 Ga0068863_100026655
654 Ga0068863_100101108
655 Ga0068863_100503700
656 Ga0068858_100006020
657 Ga0068858_100020079
658 Ga0068858_100686070
659 Ga0068860_100000246
660 Ga0068860_100000986
661 Ga0068860_100193334
662 Ga0068862_100000024
663 Ga0068862_100026059
664 Ga0068862_100040538
665 Ga0068862_100221035
666 Ga0081455_10044246
667 Ga0081455_10069414
668 Ga0081538_10089489
669 Ga0075365_10001760
670 Ga0075365_10003855
671 Ga0075365_10004009
672 Ga0075365_10125455
673 Ga0075363_100000617
674 Ga0075363_100000889
675 Ga0075363_100001162
676 Ga0075363_100087858
677 Ga0075364_10000442
678 Ga0075364_10002781
679 Ga0075364_10006806
680 Ga0075364_10061147
681 Ga0075364_10088435
682 Ga0075364_10109947
683 Ga0075364_10116214
684 Ga0075364_10165052
685 Ga0075364_10215278
686 Ga0075364_10330098
687 Ga0070715_10001419
688 Ga0070716_100067343
689 Ga0070716_100182416
690 Ga0070712_100001832
691 Ga0070712_100193410
692 Ga0070712_100385927
693 Ga0075367_10004774
694 Ga0075369_10008637
695 Ga0075369_10022055
696 Ga0075369_10025646
697 Ga0075369_10031921
698 Ga0075369_10088139
699 Ga0075370_10028907
700 Ga0075428_100142898
701 Ga0075430_100211572
702 Ga0068865_100006081
703 Ga0097620_100038030
704 Ga0097620_100168536
705 Ga0097620_100246708
706 Ga0105250_10041987
707 Ga0105245_10000550
708 Ga0105245_10844809
709 Ga0105245_10890445
710 Ga0105247_10000073
711 Ga0105247_10000477
712 Ga0105247_10109146
713 Ga0105247_10278592
714 Ga0114129_10028302
715 Ga0105243_10001265
716 Ga0105243_10194533
717 Ga0105241_10011776
718 Ga0105242_10000552
719 Ga0105248_10000088
720 Ga0105248_10002522
721 Ga0105248_10122691
722 Ga0105248_10445147
723 Ga0105237_10004938
724 Ga0105237_10011693
725 Ga0105238_10024176
726 Ga0105249_10000126
727 Ga0105249_10001282
728 Ga0105249_10002446
729 Ga0105249_10114651
730 Ga0105147_105718
731 Ga0099796_10020122
732 Ga0105239_10003697
733 Ga0105239_10209312
734 Ga0105239_10249003
735 Ga0105239_10263228
736 Ga0105246_10081470
737 Ga0157369_10355282
738 Ga0157378_10002494
739 Ga0163162_10003098
740 Ga0163162_10176374
741 Ga0163162_10654078
742 Ga0157372_10041447
743 Ga0157375_10000957
744 Ga0157375_10350244
745 Ga0157375_10486874
746 Ga0157375_10490284
747 Ga0163163_10011130
748 Ga0163163_10016288
749 Ga0163163_10336008
750 Ga0157380_10000206
751 Ga0157377_10107030
752 Ga0157376_10131720
753 Ga0163161_10003884
754 Ga0163161_10520670
755 Ga0213876_10001338
756 Ga0213876_10084618
757 Ga0213875_10018646
758 Ga0213875_10037672
759 Ga0209673_1053251
760 Ga0209051_1000305
761 Ga0209051_1000915
762 Ga0209051_1001195
763 Ga0209051_1002539
764 Ga0209051_1021035
765 Ga0207696_1045693
766 Ga0207692_10075972
767 Ga0207642_10000198
768 Ga0207642_10016053
769 Ga0207642_10194343
770 Ga0207710_10000099
771 Ga0207710_10003628
772 Ga0207688_10001328
773 Ga0207688_10008625
774 Ga0207680_10173387
775 Ga0207647_10013376
776 Ga0207647_10112689
777 Ga0207685_10021368
778 Ga0207699_10008199
779 Ga0207645_10015927
780 Ga0207643_10334635
781 Ga0207707_10676088
782 Ga0207671_10012097
783 Ga0207693_10002328
784 Ga0207693_10118056
785 Ga0207663_10046886
786 Ga0207663_10053188
787 Ga0207649_10200066
788 Ga0207681_10006366
789 Ga0207681_10017597
790 Ga0207694_10025538
791 Ga0207694_10266277
792 Ga0207659_10154693
793 Ga0207687_10002843
794 Ga0207664_10019094
795 Ga0207644_10132476
796 Ga0207706_10028700
797 Ga0207706_10029573
798 Ga0207709_10001153
799 Ga0207670_10531221
800 Ga0207669_10000469
801 Ga0207669_10043292
802 Ga0207704_10000572
803 Ga0207704_10310343
804 Ga0207665_10003687
805 Ga0207665_10024579
806 Ga0207711_10000386
807 Ga0207711_10094512
808 Ga0207711_10155639
809 Ga0207689_10014963
810 Ga0207689_10260054
811 Ga0207667_10258811
812 Ga0207712_10000093
813 Ga0207712_10003821
814 Ga0207712_10111231
815 Ga0207668_10001310
816 Ga0207668_10002201
817 Ga0207668_10223633
818 Ga0207640_10002689
819 Ga0207640_10039294
820 Ga0207640_10084629
821 Ga0207658_10000096
822 Ga0207658_10003389
823 Ga0207677_10000944
824 Ga0207677_10160554
825 Ga0207703_10005058
826 Ga0207703_10186821
827 Ga0207703_10319480
828 Ga0207639_10058665
829 Ga0207678_10008585
830 Ga0207708_10133015
831 Ga0207708_10191734
832 Ga0207702_10244705
833 Ga0207702_10619712
834 Ga0207641_10000164
835 Ga0207641_10001427
836 Ga0207641_10023522
837 Ga0207641_10204943
838 Ga0207648_10372609
839 Ga0207676_10117826
840 Ga0207675_100006606
841 Ga0207675_100228274
842 Ga0207683_10003649
843 Ga0207683_10028797
844 Ga0268266_10007067
845 Ga0268266_10011869
846 Ga0268266_10061133
847 Ga0268266_10499313
848 Ga0268266_10671526
849 Ga0268265_10000012
850 Ga0268265_10145740
851 Ga0268264_10000104
852 Ga0268264_10000885
853 Ga0268264_10089172
854 Ga0268264_10177815
855 Ga0265327_10002144
856 Ga0307405_10043201
857 Ga0307413_10007279
858 Ga0307413_10644072
859 Ga0307410_10001244
860 Ga0307409_100007355
861 Ga0307415_100106207
862 Ga0373951_0084038
863 Ga0373955_0380796
864 Ga0373931_0105860
865 Ga0373935_0289485
866 Ga0373947_0317874
867 Ga0436364_0636171
868 Ga0436364_0718930
869 Ga0436364_0839437
870 Ga0436364_1341984
871 Ga0436365_0065786
872 Ga0436365_0095204
873 Ga0436365_1041061
874 Ga0436365_1482123
875 Ga0436365_1488292
876 Ga0436365_1878623
877 Ga0436361_0026174
878 Ga0436363_0364332
879 Ga0439466_0014229
880 Ga0439466_0018038
881 Ga0439465_0004754
882 Ga0451793_1219293
883 Ga0451795_0217691
884 Ga0451853_0703928
885 Ga0439431_0006954
886 Ga0439435_0015936
887 Ga0466972_0025208
888 Ga0466972_0028299
889 Ga0466972_0042512
890 Ga0466972_0053152
891 Ga0466965_0031369
892 Ga0466966_0008762
893 Ga0466966_0021213
894 Ga0466961_0005380
895 Ga0466964_0017279
896 Ga0466964_0049714
897 Ga0466971_0021210
898 Ga0466968_0003727
899 Ga0466968_0012387
900 Ga0466970_0170370
901 Ga0466957_0002195
902 Ga0466957_0012311
903 Ga0466957_0019571
904 Ga0466957_0276237
905 Ga0466960_0000049
906 Ga0466960_0010081
907 Ga0466960_0025588
908 Ga0466960_0196977
909 Ga0466959_0001637
910 Ga0466959_0019063
911 Ga0466959_0029222
912 Ga0466958_0001405
913 Ga0466958_0069018
914 Ga0466958_0234601
915 Ga0466967_0007714
916 Ga0466967_0009033
917 Ga0466967_0029240
918 Ga0466967_0186261
919 Ga0466967_0191221
920 Ga0466967_0228656
921 Ga0466967_0258348
922 Ga0466967_0433903
923 Ga0466967_0501947
924 Ga0466967_0541518
925 Ga0495629_0015395
926 Ga0495638_0044489
927 Ga0495638_0074298
928 Ga0495639_0125189
929 Ga0495606_0028973
930 Ga0495644_0109509
931 Ga0495648_0031033
932 Ga0495654_0039254
933 Ga0495635_0050893
934 Ga0495658_0010953
935 Ga0495581_0100170
936 Ga0495672_0004621
937 Ga0495672_0062044
938 Ga0495676_0068959
939 Ga0495673_0000739
940 Ga0495686_0005119
941 Ga0495686_0010294
942 Ga0496100_0000021
943 Ga0496100_0000176
944 Ga0496100_0007574
945 Ga0496100_0254206
946 Ga0496100_0322637
947 Ga0496101_0000043
948 Ga0496101_0000071
949 Ga0496101_0000910
950 Ga0496101_0061464
951 Ga0496101_0067751
952 Ga0496101_0098819
953 Ga0496101_0099009
954 Ga0496102_0000026
955 Ga0496102_0000133
956 Ga0496102_0002253
957 Ga0496102_0008456
958 Ga0496102_0012410
959 Ga0496102_0051223
960 Ga0496102_0229705
961 Ga0496102_0276234
962 Ga0496103_0000023
963 Ga0496103_0000410
964 Ga0496103_0000421
965 Ga0496103_0001048
966 Ga0496103_0044040
967 Ga0496104_0024378
968 Ga0496104_0030688
969 Ga0496104_0186816
970 Ga0496104_0316378
971 Ga0496104_0542124
972 Ga0496105_0010447
973 Ga0496105_0417456
974 Ga0496106_0002575
975 Ga0496106_0004008
976 Ga0496106_0004169
977 Ga0496106_0014348
978 Ga0496106_0025293
979 Ga0496106_0058966
980 Ga0496107_0006173
981 Ga0496107_0009575
982 Ga0496107_0011924
983 Ga0496107_0046645
984 Ga0496107_0057810
985 Ga0496108_0000541
986 Ga0496108_0001274
987 Ga0496108_0024033
988 Ga0496108_0032477
989 Ga0496108_0051545
990 Ga0496108_0142876
991 Ga0496109_0000308
992 Ga0496109_0000822
993 Ga0496109_0178906
994 Ga0496109_0220373
995 Ga0496109_0538781
996 Ga0496110_0037112
997 Ga0496110_0070593
998 Ga0496111_0008116
999 Ga0496111_0177909
1000 Ga0496112_0003772
1001 Ga0496112_0040966
1002 Ga0496112_0056214
1003 Ga0496112_0073525
1004 Ga0496113_0003363
1005 Ga0496113_0004604
1006 Ga0496113_0108527
1007 Ga0496114_0000052
1008 Ga0496114_0001069
1009 Ga0496114_0004138
1010 Ga0496114_0280192
1011 Ga0496115_0000351
1012 Ga0496115_0002431
1013 Ga0496115_0004793
1014 Ga0496116_0000018
1015 Ga0496116_0000799
1016 Ga0496116_0049588
1017 Ga0496117_0000015
1018 Ga0496117_0002015
1019 Ga0496117_0023942
1020 Ga0496118_0000012
1021 Ga0496118_0000295
1022 Ga0496118_0000825
1023 Ga0496118_0050623
1024 Ga0496119_0000238
1025 Ga0496119_0007632
1026 Ga0496119_0008330
1027 Ga0496119_0072866
1028 Ga0496120_0000352
1029 Ga0496120_0035234
1030 Ga0496121_0000002
1031 Ga0496121_0000062
1032 Ga0496121_0001660
1033 Ga0496121_0085278
1034 Ga0496122_0000048
1035 Ga0496122_0015720
1036 Ga0496124_0000002
1037 Ga0496125_0000002
1038 Ga0496125_0049706
1039 Ga0496126_0000009
1040 Ga0496126_0000227
1041 Ga0496126_0002056
1042 Ga0496126_0003125
1043 Ga0501032_0001315
1044 Ga0501032_0003186
1045 Ga0501033_0005654
1046 Ga0501033_0062952
1047 Ga0501034_0024479
1048 Ga0501036_0005200
1049 Ga0501036_0016844
1050 Ga0501037_0000898
1051 Ga0501037_0003607
1052 Ga0501038_0256612
1053 Ga0501039_0000130
1054 Ga0501043_0005985
1055 Ga0501043_0112604
1056 Ga0501046_0009717
1057 Ga0501046_0207575
1058 Ga0501047_0001766
1059 Ga0501047_0009655
1060 Ga0501047_0272729
1061 Ga0501048_0001594
1062 Ga0501069_0047676
1063 Ga0501070_0001879
1064 Ga0501070_0009592
1065 Ga0501070_0064189
1066 Ga0501071_0082108
1067 Ga0501073_0082965
1068 Ga0501080_0023016
1069 Ga0501080_0042303
1070 Ga0501080_0639857
1071 Ga0501035_0000834
1072 Ga0501035_0528897
1073 Ga0501044_0000388
1074 Ga0501044_0006239
1075 Ga0501044_0008193
1076 Ga0501044_0033302
1077 Ga0501045_0370604
1078 nmdc:mga03n38_105291_c1
1079 nmdc:mga03n38_1795_c1
1080 nmdc:mga03n38_2219_c1
1081 nmdc:mga03n38_6069_c1
1082 nmdc:mga00v17_1070_c1
1083 nmdc:mga00v17_11326_c1
1084 nmdc:mga00v17_116379_c1
1085 nmdc:mga00v17_168871_c1
1086 nmdc:mga00v17_182031_c1
1087 nmdc:mga00v17_2717_c1
1088 nmdc:mga00v17_515187_c1
1089 nmdc:mga00v17_5316_c1
1090 nmdc:mga0yw44_17379_c1
1091 nmdc:mga0yw44_294289_c1
1092 nmdc:mga0yw44_311305_c1
1093 nmdc:mga0yw44_70697_c1
1094 nmdc:mga0yw44_758_c1
1095 nmdc:mga0k408_237468_c1
1096 nmdc:mga06z11_10067_c1
1097 nmdc:mga06z11_83641_c1
1098 nmdc:mga04h51_91256_c1
1099 nmdc:mga07m45_126811_c1
1100 nmdc:mga07m45_157859_c1
1101 nmdc:mga07m45_2105_c1
1102 nmdc:mga07m45_260533_c1
1103 nmdc:mga05p37_102075_c1
1104 nmdc:mga0qj67_21879_c1
1105 nmdc:mga08y16_857835_c1
1106 nmdc:mga0sz30_1254_c1
1107 nmdc:mga0sz30_27484_c1
1108 nmdc:mga0sz30_3078_c1
1109 nmdc:mga0sz30_49022_c1
1110 nmdc:mga0sz30_8324_c2
1111 nmdc:mga0sz30_966_c3
1112 Ga0500635_0000793
1113 Ga0500643_001006
1114 Ga0500643_028398
1115 Ga0500643_028739
1116 Ga0500641_0063686
1117 Ga0500556_0005321
1118 Ga0500642_0059270
1119 Ga0500652_000692
1120 Ga0500616_0002446
1121 Ga0500616_0030461
1122 Ga0500616_0112772
1123 Ga0500627_0168920
1124 Ga0501084_0079105
1125 Ga0466962_0016386
1126 2644488572
1127 2738664067
1128 2738703419
1129 2739143202
1130 2739329120
1131 2842136374
1132 2902795539
1133 2902842717
1134 2939583945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

41

210

0.95

PF17778

BLACT_WH

Beta-lactamase associated winged helix domain

247

280

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ad9-assembly2.cif.gz_E crystal structure of human lactb2. 0.8387 11 257
4ad9-assembly2.cif.gz_F crystal structure of human lactb2. 0.834 11 257
6ao1-assembly3.cif.gz_C crystal structure of a beta-lactamase from burkholderia phymatum 0.829 5 257
4ad9-assembly1.cif.gz_B crystal structure of human lactb2. 0.8267 11 257
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.8267 5 257
ID Description Score Start End Superfamily
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9759 7 192 3.60.15.10
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9708 7 192 3.60.15.10
af_Q6NYF0_205_289_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9236 194 257 1.10.10.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8978 110 193 3.60.15.10
af_Q9VLS9_206_284_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8954 200 257 1.10.10.10
ID Description Score Start End GO Terms
AF-X8EDK6-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9858 7 96 GO:0016787
GO:0046872
AF-A0A7I9WYM2-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9821 14 112 GO:0016787
GO:0046872
AF-A0A2S9GMA5-F1-model_v4 MBL fold metallo-hydrolase 0.9749 47 125 GO:0016787
AF-A0A2Z5YN19-F1-model_v4 deleted 0.9741 5 94
AF-A0A841NQ02-F1-model_v4 deleted 0.9642 5 258

Map