F464494

General Info

Members Datasets Scaffolds Average Seq Length
567 312 1134 264

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10004075|Ga0081455_1000407513
Length 259
Sequence MSRGYRPPAPHPSGARPPVVPASGLPGHVALIMDGNGRWAKQRGLPRTKGHEAGEAALFDVIEGALEVGVRYLSAYAFSTENWRRSPDEVRFLMGFNRAVIRRRRDELHAMGVRVRWSGRPGRLWKSVIDELRSAEEMTRRNDALTLQFCVNYGGRAELADAVRINPDRIDERTIRRYLYAPEIPDVDLFIRSSGEQRTSNFLLWQSSYAEMAFIPTLWPDFDRRHLWAAIEWYADRDRRFGSAIPNPVPGTGVTPSAR

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
147 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
250 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 2508501039 Frankia saprophytica CN3 Isolate Nodule
259 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
260 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
261 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
262 2643221566 Microbacterium sp. Root166 Isolate Unclassified
263 2643221575 Microbacterium sp. Root61 Isolate Unclassified
264 2643221616 Leifsonia sp. Root227 Isolate Unclassified
265 2643221711 Terrabacter sp. Root85 Isolate Unclassified
266 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
267 2687453737 Frankia sp. BMG5.36 Isolate Nodule
268 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
269 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
270 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
271 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
272 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
273 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
274 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
275 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
276 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
277 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
278 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
279 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
280 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
281 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
282 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
283 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
284 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
285 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
286 2857727296 Kocuria sp. R-72562 Isolate Unclassified
287 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
288 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
289 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
290 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
291 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
292 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
293 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
294 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
295 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
296 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
297 2919069694 Microbacterium sp. 1154 Isolate Unclassified
298 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
299 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
300 2920879853 Kocuria salina CV6 Isolate Unclassified
301 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
302 2928153084 Leifsonia sp. 563 Isolate Unclassified
303 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
304 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
305 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
306 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
307 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
308 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
309 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
310 8002775197 Frankia nepalensis CN7 Isolate Nodule
311 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
312 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.71
Metatranscriptomes 1.59
Isolates 9.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 0.71
Rhizoplane 7.05
Rhizosphere 71.08
Stem 0
Stem Tuber 0.18
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10004075 3300005937 Bacteria 16549
2 JGI24735J21928_10016514 3300002067 Bacteria 2289
3 JGI25164J39214_1002166 3300002772 Bacteria 3264
4 JGI25165J46597_1000002 3300003214 Bacteria 765387
5 Ga0006562J51391_1028901 3300003578 Bacteria 3870
6 Ga0006562J51391_1028902 3300003578 Bacteria 2357
7 Ga0006562J51391_1039029 3300003578 Bacteria 3280
8 Ga0006562J51391_1169475 3300003578 Bacteria 2100
9 Ga0006562J51391_1169476 3300003578 Bacteria 2030
10 Ga0055539_1000008 3300003752 Bacteria 537665
11 Ga0055533_1000001 3300003756 Bacteria 1863437
12 Ga0055525_1000221 3300003759 Bacteria 62301
13 Ga0055525_1000365 3300003759 Bacteria 30386
14 Ga0055527_1000001 3300003760 Bacteria 850044
15 Ga0055529_1000018 3300003763 Bacteria 344344
16 Ga0055541_1009324 3300003841 Bacteria 1523
17 Ga0070658_10000833 3300005327 Bacteria 26391
18 Ga0070658_10075378 3300005327 Bacteria 2767
19 Ga0070658_10121672 3300005327 Bacteria 2169
20 Ga0070658_10168885 3300005327 Bacteria 1837
21 Ga0070683_100013636 3300005329 Bacteria 7094
22 Ga0070682_100164986 3300005337 Bacteria 1534
23 Ga0068868_100029730 3300005338 Bacteria 4186
24 Ga0070660_100133225 3300005339 Bacteria 1990
25 Ga0070661_100068570 3300005344 Bacteria 2607
26 Ga0070668_100313524 3300005347 Bacteria 1319
27 Ga0070659_100014108 3300005366 Bacteria 5963
28 Ga0070659_100409250 3300005366 Bacteria 1146
29 Ga0070659_100432560 3300005366 Bacteria 1114
30 Ga0070667_100027561 3300005367 Bacteria 4727
31 Ga0070705_100125586 3300005440 Bacteria 1665
32 Ga0070663_100003571 3300005455 Bacteria 8983
33 Ga0070663_100281656 3300005455 Bacteria 1325
34 Ga0070681_10395661 3300005458 Bacteria 1293
35 Ga0070679_100428066 3300005530 Bacteria 1269
36 Ga0068853_100028944 3300005539 Bacteria 4663
37 Ga0070672_100049351 3300005543 Bacteria 3274
38 Ga0070693_100034918 3300005547 Bacteria 2785
39 Ga0068855_100023298 3300005563 Bacteria 7415
40 Ga0068855_100226576 3300005563 Bacteria 2095
41 Ga0068857_100124317 3300005577 Bacteria 2324
42 Ga0068856_100017184 3300005614 Bacteria 7009
43 Ga0068856_100026572 3300005614 Bacteria 5644
44 Ga0068856_100121478 3300005614 Bacteria 2614
45 Ga0068856_100376118 3300005614 Bacteria 1439
46 Ga0070702_100002838 3300005615 Bacteria 7602
47 Ga0068852_100006614 3300005616 Bacteria 8395
48 Ga0068852_100024812 3300005616 Bacteria 4850
49 Ga0068852_100057001 3300005616 Bacteria 3379
50 Ga0068852_100110180 3300005616 Bacteria 2501
51 Ga0068864_100023638 3300005618 Bacteria 5163
52 Ga0068864_100367238 3300005618 Bacteria 1361
53 Ga0068861_100907337 3300005719 Bacteria 835
54 Ga0068851_10000003 3300005834 Bacteria 293018
55 Ga0068863_100018229 3300005841 Bacteria 6721
56 Ga0068863_100380195 3300005841 Bacteria 1379
57 Ga0068858_100014735 3300005842 Bacteria 7358
58 Ga0068862_100001933 3300005844 Bacteria 18801
59 Ga0081455_10000363 3300005937 Bacteria 59814
60 Ga0081455_10076616 3300005937 Bacteria 2754
61 Ga0081538_10116964 3300005981 Bacteria 1292
62 Ga0075365_10000821 3300006038 Bacteria 12815
63 Ga0075365_10017154 3300006038 Bacteria 4422
64 Ga0075363_100068619 3300006048 Bacteria 1923
65 Ga0075364_10005149 3300006051 Bacteria 7580
66 Ga0070715_10009957 3300006163 Bacteria 3371
67 Ga0070716_100001544 3300006173 Bacteria 10324
68 Ga0075367_10018787 3300006178 Bacteria 3820
69 Ga0075431_100486470 3300006847 Bacteria 1226
70 Ga0075429_100006527 3300006880 Bacteria 10092
71 Ga0068865_100038939 3300006881 Bacteria 3221
72 Ga0097620_100000357 3300006931 Bacteria 45626
73 Ga0105240_10006064 3300009093 Bacteria 17858
74 Ga0105240_10060054 3300009093 Bacteria 4741
75 Ga0105240_10296905 3300009093 Bacteria 1850
76 Ga0111539_10010636 3300009094 Bacteria 11585
77 Ga0105245_10149847 3300009098 Bacteria 2205
78 Ga0105245_10467955 3300009098 Bacteria 1272
79 Ga0105247_10090946 3300009101 Bacteria 1937
80 Ga0105247_10531272 3300009101 Bacteria 862
81 Ga0114129_10010043 3300009147 Bacteria 13495
82 Ga0105241_10001064 3300009174 Bacteria 20907
83 Ga0105242_10023921 3300009176 Bacteria 4821
84 Ga0105242_10379007 3300009176 Bacteria 1314
85 Ga0105242_10566617 3300009176 Bacteria 1092
86 Ga0105248_10001478 3300009177 Bacteria 26153
87 Ga0105248_10003592 3300009177 Bacteria 17186
88 Ga0105248_10315030 3300009177 Bacteria 1762
89 Ga0105237_10000131 3300009545 Bacteria 105010
90 Ga0105237_10052484 3300009545 Bacteria 4093
91 Ga0105237_10081585 3300009545 Bacteria 3225
92 Ga0105238_10420233 3300009551 Bacteria 1332
93 Ga0105249_10046438 3300009553 Bacteria 3952
94 Ga0105249_10776647 3300009553 Bacteria 1021
95 Ga0105239_10039388 3300010375 Bacteria 5178
96 Ga0105239_10394648 3300010375 Bacteria 1565
97 Ga0105239_10396574 3300010375 Bacteria 1561
98 Ga0157370_10040504 3300013104 Bacteria 4498
99 Ga0157369_10015044 3300013105 Bacteria 8731
100 Ga0157369_10046604 3300013105 Bacteria 4711
101 Ga0157369_10548092 3300013105 Bacteria 1195
102 Ga0157374_10384569 3300013296 Bacteria 1398
103 Ga0163162_10027684 3300013306 Bacteria 5607
104 Ga0163162_10659700 3300013306 Bacteria 1169
105 Ga0157372_10059728 3300013307 Bacteria 4266
106 Ga0157372_10398338 3300013307 Bacteria 1604
107 Ga0157372_10488787 3300013307 Bacteria 1435
108 Ga0163163_10012121 3300014325 Bacteria 7845
109 Ga0157380_10123667 3300014326 Bacteria 2196
110 Ga0157380_10168720 3300014326 Bacteria 1910
111 Ga0157379_10000058 3300014968 Bacteria 69871
112 Ga0157379_10017991 3300014968 Bacteria 6229
113 Ga0157376_10163493 3300014969 Bacteria 2020
114 Ga0163161_10172108 3300017792 Bacteria 1656
115 Ga0163161_10495716 3300017792 Bacteria 994
116 Ga0206353_10742524 3300020082 Bacteria 1170
117 Ga0206353_11120836 3300020082 Bacteria 19200
118 Ga0206353_11696786 3300020082 Bacteria 1734
119 Ga0206353_11704794 3300020082 Bacteria 1155
120 Ga0209566_100026 3300025225 Bacteria 367457
121 Ga0209674_100001 3300025226 Bacteria 4013750
122 Ga0209672_100006 3300025228 Bacteria 1004497
123 Ga0209147_100868 3300025229 Bacteria 14017
124 Ga0209563_100001 3300025230 Bacteria 4013775
125 Ga0209563_100461 3300025230 Bacteria 14011
126 Ga0207427_100329 3300025231 Bacteria 31805
127 Ga0209437_100739 3300025233 Bacteria 16245
128 Ga0209677_100001 3300025253 Bacteria 4013787
129 Ga0209677_100523 3300025253 Bacteria 21334
130 Ga0209148_1000015 3300025254 Bacteria 850103
131 Ga0209148_1000828 3300025254 Bacteria 22166
132 Ga0209233_1000001 3300025261 Bacteria 2992747
133 Ga0209233_1013893 3300025261 Bacteria 2288
134 Ga0209455_1000013 3300025272 Bacteria 850103
135 Ga0209455_1000979 3300025272 Bacteria 14449
136 Ga0209455_1019341 3300025272 Bacteria 1379
137 Ga0207656_10000002 3300025321 Bacteria 792178
138 Ga0207692_10344603 3300025898 Bacteria 917
139 Ga0207647_10015825 3300025904 Bacteria 5162
140 Ga0207647_10044805 3300025904 Bacteria 2762
141 Ga0207685_10024569 3300025905 Bacteria 2068
142 Ga0207705_10000006 3300025909 Bacteria 657147
143 Ga0207705_10025267 3300025909 Bacteria 4241
144 Ga0207705_10082199 3300025909 Bacteria 2349
145 Ga0207705_10293633 3300025909 Bacteria 1245
146 Ga0207654_10000001 3300025911 Bacteria 1816198
147 Ga0207707_10000220 3300025912 Bacteria 61279
148 Ga0207695_10006059 3300025913 Bacteria 15782
149 Ga0207695_10025529 3300025913 Bacteria 6612
150 Ga0207671_10000002 3300025914 Bacteria 1144816
151 Ga0207671_10024829 3300025914 Bacteria 4504
152 Ga0207671_10026815 3300025914 Bacteria 4311
153 Ga0207693_10001931 3300025915 Bacteria 18156
154 Ga0207660_10000997 3300025917 Bacteria 18782
155 Ga0207662_10057162 3300025918 Bacteria 2331
156 Ga0207657_10025274 3300025919 Bacteria 5480
157 Ga0207657_10088806 3300025919 Bacteria 2583
158 Ga0207649_10017423 3300025920 Bacteria 4071
159 Ga0207652_10000471 3300025921 Bacteria 41340
160 Ga0207652_10160407 3300025921 Bacteria 2016
161 Ga0207694_10000092 3300025924 Bacteria 100605
162 Ga0207694_10163248 3300025924 Bacteria 1800
163 Ga0207650_10227902 3300025925 Bacteria 1502
164 Ga0207659_10436179 3300025926 Bacteria 1101
165 Ga0207687_10084305 3300025927 Bacteria 2303
166 Ga0207687_10111005 3300025927 Bacteria 2035
167 Ga0207687_10231320 3300025927 Bacteria 1460
168 Ga0207664_10014767 3300025929 Bacteria 5653
169 Ga0207664_10147835 3300025929 Bacteria 1994
170 Ga0207690_10001146 3300025932 Bacteria 16853
171 Ga0207690_10175044 3300025932 Bacteria 1611
172 Ga0207706_10324820 3300025933 Bacteria 1339
173 Ga0207665_10000952 3300025939 Bacteria 19599
174 Ga0207691_10060547 3300025940 Bacteria 3439
175 Ga0207711_10000060 3300025941 Bacteria 127720
176 Ga0207711_10004780 3300025941 Bacteria 11496
177 Ga0207711_10004873 3300025941 Bacteria 11391
178 Ga0207711_10080057 3300025941 Bacteria 2853
179 Ga0207661_10058908 3300025944 Bacteria 3093
180 Ga0207661_10102850 3300025944 Bacteria 2403
181 Ga0207667_10006393 3300025949 Bacteria 14282
182 Ga0207667_10014728 3300025949 Bacteria 8899
183 Ga0207712_10017638 3300025961 Bacteria 4641
184 Ga0207712_10149101 3300025961 Bacteria 1805
185 Ga0207668_10696407 3300025972 Bacteria 893
186 Ga0207658_10009467 3300025986 Bacteria 6609
187 Ga0207658_10164439 3300025986 Bacteria 1821
188 Ga0207677_10020532 3300026023 Bacteria 4013
189 Ga0207677_10508549 3300026023 Bacteria 1043
190 Ga0207703_10000009 3300026035 Bacteria 343983
191 Ga0207703_10000031 3300026035 Bacteria 196940
192 Ga0207703_10208222 3300026035 Bacteria 1742
193 Ga0207639_10033026 3300026041 Bacteria 3814
194 Ga0207639_10260722 3300026041 Bacteria 1516
195 Ga0207678_10085543 3300026067 Bacteria 2696
196 Ga0207678_10102979 3300026067 Bacteria 2437
197 Ga0207678_10534638 3300026067 Bacteria 1024
198 Ga0207678_10924990 3300026067 Bacteria 771
199 Ga0207708_10242050 3300026075 Bacteria 1451
200 Ga0207702_10070091 3300026078 Bacteria 3015
201 Ga0207702_10110798 3300026078 Bacteria 2440
202 Ga0207702_10189466 3300026078 Bacteria 1899
203 Ga0207641_10003481 3300026088 Bacteria 13948
204 Ga0207648_10080635 3300026089 Bacteria 2839
205 Ga0207674_10004399 3300026116 Bacteria 16981
206 Ga0207674_10033183 3300026116 Bacteria 5405
207 Ga0207674_10105779 3300026116 Bacteria 2792
208 Ga0207674_10107019 3300026116 Bacteria 2773
209 Ga0207674_10152334 3300026116 Bacteria 2269
210 Ga0207674_10480524 3300026116 Bacteria 1201
211 Ga0207675_100009028 3300026118 Bacteria 9353
212 Ga0207683_10033049 3300026121 Bacteria 4493
213 Ga0207683_10084642 3300026121 Bacteria 2819
214 Ga0207698_10000277 3300026142 Bacteria 31170
215 Ga0207698_10056228 3300026142 Bacteria 3037
216 Ga0207698_10057880 3300026142 Bacteria 3001
217 Ga0207698_10115846 3300026142 Bacteria 2257
218 Ga0207698_10161729 3300026142 Bacteria 1959
219 Ga0268265_10000024 3300028380 Bacteria 266266
220 Ga0265338_10079749 3300028800 Bacteria 2753
221 Ga0265330_10102461 3300031235 Bacteria 1225
222 Ga0265325_10011674 3300031241 Bacteria 5041
223 Ga0265340_10044478 3300031247 Bacteria 2172
224 Ga0307514_10056760 3300031649 Bacteria 3003
225 Ga0316579_10004999 3300031691 Bacteria 5319
226 Ga0316579_10014531 3300031691 Bacteria 3406
227 Ga0265314_10051789 3300031711 Bacteria 2858
228 Ga0265342_10037249 3300031712 Bacteria 2967
229 Ga0316576_10000788 3300031727 Bacteria 15928
230 Ga0316576_10010618 3300031727 Bacteria 5995
231 Ga0316576_10047287 3300031727 Bacteria 3117
232 Ga0316578_10001133 3300031728 Bacteria 10445
233 Ga0316578_10002828 3300031728 Bacteria 7758
234 Ga0316577_10003953 3300031733 Bacteria 7578
235 Ga0316577_10193902 3300031733 Bacteria 1148
236 Ga0307413_10411219 3300031824 Bacteria 1063
237 Ga0307410_10015490 3300031852 Bacteria 4524
238 Ga0307406_10000833 3300031901 Bacteria 17322
239 Ga0307407_10035365 3300031903 Bacteria 2744
240 Ga0307409_100056726 3300031995 Bacteria 3030
241 Ga0307409_100446300 3300031995 Bacteria 1247
242 Ga0307409_100774845 3300031995 Bacteria 965
243 Ga0307416_100051319 3300032002 Bacteria 3294
244 Ga0307416_100060492 3300032002 Bacteria 3085
245 Ga0307414_10425427 3300032004 Bacteria 1159
246 Ga0316583_10010540 3300032133 Bacteria 3334
247 Ga0316583_10056409 3300032133 Bacteria 1380
248 Ga0316585_10003151 3300032137 Bacteria 4502
249 Ga0316585_10040948 3300032137 Bacteria 1476
250 Ga0316580_10004593 3300032139 Bacteria 4010
251 Ga0316580_10004781 3300032139 Bacteria 3935
252 Ga0373956_0002961 3300035119 Bacteria 6874
253 Ga0316574_0014337 3300035398 Bacteria 4578
254 Ga0316574_0042442 3300035398 Bacteria 2806
255 Ga0316574_0089402 3300035398 Bacteria 1962
256 Ga0373931_0100571 3300035691 Bacteria 1626
257 Ga0316582_0015780 3300036647 Bacteria 4329
258 Ga0316584_0013835 3300036712 Bacteria 5725
259 Ga0316584_0022197 3300036712 Bacteria 4626
260 Ga0316584_0047693 3300036712 Bacteria 3200
261 Ga0395899_0000786 3300037312 Bacteria 31058
262 Ga0395900_0012475 3300037418 Bacteria 8689
263 Ga0395900_0120195 3300037418 Bacteria 2696
264 Ga0395900_0363044 3300037418 Bacteria 1419
265 Ga0395900_0488961 3300037418 Bacteria 1182
266 Ga0395898_0000752 3300037466 Bacteria 56634
267 Ga0395898_0032253 3300037466 Bacteria 5228
268 Ga0395898_0128878 3300037466 Bacteria 2424
269 Ga0395905_0022729 3300037471 Bacteria 5930
270 Ga0436364_0514406 3300037853 Bacteria 1164
271 Ga0395901_0000920 3300038443 Bacteria 32069
272 Ga0395901_0013301 3300038443 Bacteria 8359
273 Ga0395901_0146054 3300038443 Bacteria 2486
274 Ga0395901_0189658 3300038443 Bacteria 2156
275 Ga0395901_0246637 3300038443 Bacteria 1861
276 Ga0395901_0397633 3300038443 Bacteria 1416
277 Ga0395901_0525919 3300038443 Bacteria 1201
278 Ga0451847_0757701 3300041503 Bacteria 1340
279 Ga0451853_4030682 3300041512 Bacteria 3322
280 Ga0466972_0046432 3300044658 Bacteria 2102
281 Ga0466965_0000002 3300044683 Bacteria 297957
282 Ga0466965_0008852 3300044683 Bacteria 4667
283 Ga0466965_0061679 3300044683 Bacteria 1874
284 Ga0466965_0079457 3300044683 Bacteria 1657
285 Ga0466965_0136936 3300044683 Bacteria 1273
286 Ga0466965_0193558 3300044683 Bacteria 1076
287 Ga0466966_0037291 3300044684 Bacteria 3136
288 Ga0466966_0216302 3300044684 Bacteria 1157
289 Ga0466961_0086236 3300044693 Bacteria 1984
290 Ga0466961_0141798 3300044693 Bacteria 1504
291 Ga0466961_0398898 3300044693 Bacteria 835
292 Ga0466963_0192750 3300044694 Bacteria 1424
293 Ga0466963_0238085 3300044694 Bacteria 1276
294 Ga0466963_0385502 3300044694 Bacteria 988
295 Ga0466971_0011351 3300044719 Bacteria 3901
296 Ga0466971_0020548 3300044719 Bacteria 2936
297 Ga0466970_0028362 3300044765 Bacteria 2940
298 Ga0466970_0031042 3300044765 Bacteria 2820
299 Ga0466957_0072866 3300044842 Bacteria 2128
300 Ga0466957_0073490 3300044842 Bacteria 2119
301 Ga0466957_0081118 3300044842 Bacteria 2020
302 Ga0466957_0081347 3300044842 Bacteria 2017
303 Ga0466957_0211079 3300044842 Bacteria 1278
304 Ga0466957_0452020 3300044842 Bacteria 885
305 Ga0466960_0031771 3300044901 Bacteria 2438
306 Ga0466960_0050687 3300044901 Bacteria 2002
307 Ga0466960_0124266 3300044901 Bacteria 1355
308 Ga0466959_0006345 3300045049 Bacteria 8181
309 Ga0466959_0060247 3300045049 Bacteria 2762
310 Ga0466959_0060679 3300045049 Bacteria 2751
311 Ga0466967_0136969 3300045976 Bacteria 2277
312 Ga0466967_0575049 3300045976 Bacteria 1110
313 Ga0466967_0666756 3300045976 Bacteria 1029
314 Ga0495638_0035399 3300046460 Bacteria 3183
315 Ga0495638_0303961 3300046460 Bacteria 858
316 Ga0495653_0108869 3300046463 Bacteria 1995
317 Ga0495650_0001330 3300046471 Bacteria 24757
318 Ga0495664_0286059 3300046477 Bacteria 996
319 Ga0495631_0078123 3300046518 Bacteria 1429
320 Ga0495644_0065000 3300046523 Bacteria 1371
321 Ga0495648_0050573 3300046524 Bacteria 2537
322 Ga0495645_0133853 3300046543 Bacteria 1735
323 Ga0495674_0140275 3300047319 Bacteria 2032
324 Ga0495672_0223123 3300047320 Bacteria 929
325 Ga0495680_0407044 3300047322 Bacteria 938
326 Ga0496100_0057068 3300048903 Bacteria 2556
327 Ga0496100_0210644 3300048903 Bacteria 1421
328 Ga0496101_0006557 3300048904 Bacteria 7496
329 Ga0496101_0064501 3300048904 Bacteria 2668
330 Ga0496102_0004392 3300048905 Bacteria 11911
331 Ga0496102_0090718 3300048905 Bacteria 2828
332 Ga0496102_0162231 3300048905 Bacteria 2103
333 Ga0496103_0024681 3300048906 Bacteria 3627
334 Ga0496104_0034030 3300048907 Bacteria 4750
335 Ga0496104_0084071 3300048907 Bacteria 3036
336 Ga0496104_0149351 3300048907 Bacteria 2244
337 Ga0496104_0355653 3300048907 Bacteria 1377
338 Ga0496104_0371191 3300048907 Bacteria 1343
339 Ga0496105_0004765 3300048908 Bacteria 10243
340 Ga0496105_0016210 3300048908 Bacteria 5946
341 Ga0496105_0066952 3300048908 Bacteria 2965
342 Ga0496105_0083622 3300048908 Bacteria 2636
343 Ga0496105_0155160 3300048908 Bacteria 1880
344 Ga0496106_0204881 3300048909 Bacteria 1571
345 Ga0496107_0192175 3300048910 Bacteria 1517
346 Ga0496107_0401191 3300048910 Bacteria 1020
347 Ga0496108_0284483 3300048911 Bacteria 1439
348 Ga0496109_0045917 3300048912 Bacteria 3966
349 Ga0496109_0342580 3300048912 Bacteria 1412
350 Ga0496110_0047567 3300048913 Bacteria 3758
351 Ga0496110_0083055 3300048913 Bacteria 2857
352 Ga0496111_0118286 3300048914 Bacteria 1956
353 Ga0496112_0623162 3300048915 Bacteria 1010
354 Ga0496113_0106604 3300048916 Bacteria 2177
355 Ga0496113_0184726 3300048916 Bacteria 1653
356 Ga0496113_0421628 3300048916 Bacteria 1072
357 Ga0496114_0006381 3300048917 Bacteria 9283
358 Ga0496114_0015458 3300048917 Bacteria 6138
359 Ga0496114_0022079 3300048917 Bacteria 5183
360 Ga0496114_0080488 3300048917 Bacteria 2751
361 Ga0496114_0216726 3300048917 Bacteria 1680
362 Ga0496115_0010135 3300048918 Bacteria 7032
363 Ga0496115_0032163 3300048918 Bacteria 4138
364 Ga0496115_0055536 3300048918 Bacteria 3181
365 Ga0496115_0073801 3300048918 Bacteria 2769
366 Ga0496117_0000235 3300048920 Bacteria 104830
367 Ga0496117_0010509 3300048920 Bacteria 8419
368 Ga0496117_0015928 3300048920 Bacteria 6370
369 Ga0496117_0022233 3300048920 Bacteria 5091
370 Ga0496117_0026168 3300048920 Bacteria 4570
371 Ga0496117_0029945 3300048920 Bacteria 4186
372 Ga0496118_0007162 3300048921 Bacteria 11930
373 Ga0496118_0008668 3300048921 Bacteria 10458
374 Ga0496118_0009005 3300048921 Bacteria 10183
375 Ga0496118_0023094 3300048921 Bacteria 5415
376 Ga0496118_0036549 3300048921 Bacteria 3969
377 Ga0496119_0004965 3300048922 Bacteria 12999
378 Ga0496119_0007470 3300048922 Bacteria 9832
379 Ga0496119_0015874 3300048922 Bacteria 5766
380 Ga0496119_0018367 3300048922 Bacteria 5208
381 Ga0496120_0000655 3300048923 Bacteria 50898
382 Ga0496120_0030306 3300048923 Bacteria 3290
383 Ga0496120_0040968 3300048923 Bacteria 2717
384 Ga0496121_0000277 3300048924 Bacteria 107014
385 Ga0496122_0000200 3300048925 Bacteria 133548
386 Ga0496122_0000360 3300048925 Bacteria 97913
387 Ga0496122_0043308 3300048925 Bacteria 3528
388 Ga0496123_0000076 3300048926 Bacteria 194050
389 Ga0496123_0002417 3300048926 Bacteria 23290
390 Ga0496124_0018523 3300048927 Bacteria 6518
391 Ga0496124_0125943 3300048927 Bacteria 2041
392 Ga0496126_0014990 3300048929 Bacteria 7815
393 Ga0496126_0033121 3300048929 Bacteria 4863
394 Ga0496126_0057518 3300048929 Bacteria 3510
395 Ga0496126_0074598 3300048929 Bacteria 3012
396 Ga0496126_0107727 3300048929 Bacteria 2430
397 Ga0501031_0009585 3300049568 Bacteria 6304
398 Ga0501031_0065675 3300049568 Bacteria 2364
399 Ga0501032_0002800 3300049569 Bacteria 13565
400 Ga0501032_0006994 3300049569 Bacteria 8272
401 Ga0501032_0017933 3300049569 Bacteria 4966
402 Ga0501032_0069724 3300049569 Bacteria 2346
403 Ga0501032_0085237 3300049569 Bacteria 2100
404 Ga0501033_0007753 3300049570 Bacteria 8321
405 Ga0501033_0012915 3300049570 Bacteria 6369
406 Ga0501033_0060490 3300049570 Bacteria 2794
407 Ga0501033_0162805 3300049570 Bacteria 1605
408 Ga0501034_0022284 3300049571 Bacteria 6456
409 Ga0501034_0024988 3300049571 Bacteria 6078
410 Ga0501034_0078018 3300049571 Bacteria 3317
411 Ga0501036_0017172 3300049572 Bacteria 6048
412 Ga0501036_0248761 3300049572 Bacteria 1490
413 Ga0501037_0006742 3300049573 Bacteria 8401
414 Ga0501037_0021415 3300049573 Bacteria 4777
415 Ga0501037_0038611 3300049573 Bacteria 3517
416 Ga0501037_0066006 3300049573 Bacteria 2636
417 Ga0501037_0089882 3300049573 Bacteria 2222
418 Ga0501037_0166930 3300049573 Bacteria 1567
419 Ga0501038_0033875 3300049574 Bacteria 4494
420 Ga0501038_0038126 3300049574 Bacteria 4209
421 Ga0501038_0038199 3300049574 Bacteria 4205
422 Ga0501038_0071682 3300049574 Bacteria 2938
423 Ga0501039_0153251 3300049575 Bacteria 1810
424 Ga0501039_0167174 3300049575 Bacteria 1729
425 Ga0501039_0449193 3300049575 Bacteria 1012
426 Ga0501042_0042640 3300049578 Bacteria 3230
427 Ga0501042_0043943 3300049578 Bacteria 3183
428 Ga0501042_0521754 3300049578 Bacteria 863
429 Ga0501043_0013204 3300049579 Bacteria 6460
430 Ga0501043_0021246 3300049579 Bacteria 5088
431 Ga0501043_0044171 3300049579 Bacteria 3503
432 Ga0501043_0091162 3300049579 Bacteria 2396
433 Ga0501043_0139025 3300049579 Bacteria 1902
434 Ga0501043_0263281 3300049579 Bacteria 1325
435 Ga0501046_0007020 3300049580 Bacteria 9921
436 Ga0501046_0016323 3300049580 Bacteria 6222
437 Ga0501046_0018795 3300049580 Bacteria 5741
438 Ga0501047_0006712 3300049581 Bacteria 10821
439 Ga0501047_0010036 3300049581 Bacteria 8953
440 Ga0501047_0010335 3300049581 Bacteria 8827
441 Ga0501047_0041412 3300049581 Bacteria 4451
442 Ga0501047_0043118 3300049581 Bacteria 4358
443 Ga0501047_0164540 3300049581 Bacteria 2089
444 Ga0501047_0230335 3300049581 Bacteria 1706
445 Ga0501047_0282473 3300049581 Bacteria 1504
446 Ga0501048_0008758 3300049582 Bacteria 7624
447 Ga0501067_0068932 3300049583 Bacteria 1959
448 Ga0501069_0067808 3300049585 Bacteria 1996
449 Ga0501070_0000088 3300049586 Bacteria 77423
450 Ga0501070_0016947 3300049586 Bacteria 6114
451 Ga0501070_0091215 3300049586 Bacteria 2522
452 Ga0501071_0000422 3300049587 Bacteria 21099
453 Ga0501073_0004953 3300049589 Bacteria 9993
454 Ga0501073_0090958 3300049589 Bacteria 2121
455 Ga0501073_0146193 3300049589 Bacteria 1638
456 Ga0501073_0250990 3300049589 Bacteria 1221
457 Ga0501074_0073678 3300049590 Bacteria 2453
458 Ga0501080_0048351 3300049742 Bacteria 3959
459 Ga0501080_0204660 3300049742 Bacteria 1811
460 Ga0501083_0000052 3300049744 Bacteria 84349
461 Ga0501083_0215903 3300049744 Bacteria 1250
462 Ga0501035_0005181 3300049822 Bacteria 12332
463 Ga0501035_0056307 3300049822 Bacteria 3508
464 Ga0501035_0060074 3300049822 Bacteria 3384
465 Ga0501035_0064364 3300049822 Bacteria 3259
466 Ga0501035_0112835 3300049822 Bacteria 2381
467 Ga0501035_0185140 3300049822 Bacteria 1792
468 Ga0501044_0031929 3300049823 Bacteria 5537
469 Ga0501044_0076027 3300049823 Bacteria 3409
470 Ga0501044_0077795 3300049823 Bacteria 3363
471 Ga0501044_0158170 3300049823 Bacteria 2244
472 Ga0501045_0020601 3300049824 Bacteria 4712
473 nmdc:mga00v17_15245_c1 3300050491 Bacteria 4310
474 nmdc:mga0yw44_16278_c1 3300050492 Bacteria 4013
475 nmdc:mga0yw44_26387_c1 3300050492 Bacteria 3318
476 nmdc:mga06z11_29106_c1 3300050494 Bacteria 2657
477 nmdc:mga07m45_127895_c1 3300050496 Bacteria 1469
478 nmdc:mga05p37_210191_c1 3300050507 Bacteria 2353
479 nmdc:mga05p37_9946_c1 3300050507 Bacteria 11294
480 nmdc:mga09592_11_c1 3300050508 Bacteria 73718
481 nmdc:mga0qj67_432383_c1 3300050509 Bacteria 1061
482 nmdc:mga06r32_1205_c1 3300050510 Bacteria 23293
483 nmdc:mga06r32_40772_c1 3300050510 Bacteria 4409
484 nmdc:mga06r32_5_c1 3300050510 Bacteria 79813
485 nmdc:mga06r32_900_c4 3300050510 Bacteria 7021
486 nmdc:mga08y16_236059_c1 3300050511 Bacteria 1891
487 nmdc:mga08y16_61508_c1 3300050511 Bacteria 3921
488 nmdc:mga0n895_16320_c1 3300050512 Bacteria 6811
489 nmdc:mga0rr50_26939_c1 3300050513 Bacteria 4019
490 nmdc:mga0a205_38341_c1 3300050515 Bacteria 4610
491 Ga0500635_0000013 3300053080 Bacteria 133088
492 Ga0495595_0031041 3300053084 Bacteria 2400
493 Ga0495619_0038942 3300053085 Bacteria 3103
494 Ga0500643_000953 3300053087 Bacteria 18072
495 Ga0500651_0000300 3300053093 Bacteria 28581
496 Ga0500562_004538 3300053108 Bacteria 3507
497 Ga0500593_076599 3300053117 Bacteria 1441
498 Ga0500559_0000156 3300053136 Bacteria 53941
499 Ga0500559_0000372 3300053136 Bacteria 33038
500 Ga0500559_0008624 3300053136 Bacteria 4459
501 Ga0500573_0007144 3300053140 Bacteria 6076
502 Ga0500573_0017995 3300053140 Bacteria 4026
503 Ga0500573_0023971 3300053140 Bacteria 3506
504 Ga0500573_0025310 3300053140 Bacteria 3412
505 Ga0500573_0034665 3300053140 Bacteria 2911
506 Ga0500573_0042920 3300053140 Bacteria 2611
507 Ga0500573_0061311 3300053140 Bacteria 2154
508 Ga0500577_0085660 3300053142 Bacteria 1264
509 Ga0500590_004686 3300053148 Bacteria 6493
510 Ga0500616_0084785 3300053153 Bacteria 1584
511 Ga0500620_000060 3300053155 Bacteria 20194
512 Ga0500636_0101218 3300053177 Bacteria 1638
513 2508675900 2508501039 Bacteria 9978592
514 2558911457 2558860112 Bacteria 9931328
515 2587862583 2585428094 Bacteria 3604039
516 2588108528 2585428157 Bacteria 3018951
517 2643848267 2643221566 Bacteria 3460379
518 2643885398 2643221575 Bacteria 4022601
519 2644095956 2643221616 Bacteria 4066575
520 2644609196 2643221711 Bacteria 4865335
521 2676475526 2675903058 Bacteria 6822861
522 2689956703 2687453737 Bacteria 11203906
523 2774380346 2773857758 Bacteria 3592392
524 2774848612 2773857921 Bacteria 9435764
525 2784472516 2784132109 Bacteria 3141763
526 2808874713 2808606365 Bacteria 4301966
527 2808885665 2808606368 Bacteria 3174172
528 2812374325 2811994882 Bacteria 4688362
529 2816424707 2816332119 Bacteria 8120218
530 2819427056 2818991318 Bacteria 5266538
531 2819666048 2818991458 Bacteria 4794049
532 2819692475 2818991462 Bacteria 4320267
533 2819728716 2818991469 Bacteria 4644110
534 2827631307 2827628540 Bacteria 6858585
535 2835188957 2835188231 Bacteria 3476928
536 2837271121 2837268691 Bacteria 7850704
537 2844842361 2844841374 Bacteria 3917147
538 2852634222 2852632344 Bacteria 3463163
539 2852645680 2852643534 Bacteria 3013378
540 2857484105 2857481737 Bacteria 4761446
541 2857728394 2857727296 Bacteria 2745552
542 2862995848 2862993130 Bacteria 3860849
543 2868091252 2868088558 Bacteria 7609351
544 2870623779 2870622029 Bacteria 3643329
545 2870630378 2870628048 Bacteria 3696012
546 2870784256 2870782633 Bacteria 9624083
547 2884765319 2884763398 Bacteria 4091164
548 2887446309 2887443736 Bacteria 4426037
549 2908680887 2908678064 Bacteria 3482747
550 2915358431 2915358134 Bacteria 6050864
551 2919058009 2919055335 Bacteria 3875751
552 2919071563 2919069694 Bacteria 3622919
553 2919447030 2919446982 Bacteria 3994487
554 2919524402 2919523602 Bacteria 3788128
555 2920883751 2920879853 Bacteria 4216831
556 2928123214 2928121344 Bacteria 3972376
557 2928155976 2928153084 Bacteria 4020257
558 2939658270 2939657138 Bacteria 3740283
559 2939664013 2939660829 Bacteria 3784848
560 2946080767 2946080515 Bacteria 4310960
561 2964329477 2964326757 Bacteria 3290868
562 2966922340 2966921586 Bacteria 3092803
563 2966925023 2966924647 Bacteria 3268643
564 3003003001 3002998708 Bacteria 11715108
565 8002775492 8002775197 Bacteria 10728764
566 8004214347 8004212874 Bacteria 2861420
567 8056039516 8056037122 Bacteria 3854319
568 Ga0081455_10004075
569 JGI24735J21928_10016514
570 JGI25164J39214_1002166
571 JGI25165J46597_1000002
572 Ga0006562J51391_1028901
573 Ga0006562J51391_1028902
574 Ga0006562J51391_1039029
575 Ga0006562J51391_1169475
576 Ga0006562J51391_1169476
577 Ga0055539_1000008
578 Ga0055533_1000001
579 Ga0055525_1000221
580 Ga0055525_1000365
581 Ga0055527_1000001
582 Ga0055529_1000018
583 Ga0055541_1009324
584 Ga0070658_10000833
585 Ga0070658_10075378
586 Ga0070658_10121672
587 Ga0070658_10168885
588 Ga0070683_100013636
589 Ga0070682_100164986
590 Ga0068868_100029730
591 Ga0070660_100133225
592 Ga0070661_100068570
593 Ga0070668_100313524
594 Ga0070659_100014108
595 Ga0070659_100409250
596 Ga0070659_100432560
597 Ga0070667_100027561
598 Ga0070705_100125586
599 Ga0070663_100003571
600 Ga0070663_100281656
601 Ga0070681_10395661
602 Ga0070679_100428066
603 Ga0068853_100028944
604 Ga0070672_100049351
605 Ga0070693_100034918
606 Ga0068855_100023298
607 Ga0068855_100226576
608 Ga0068857_100124317
609 Ga0068856_100017184
610 Ga0068856_100026572
611 Ga0068856_100121478
612 Ga0068856_100376118
613 Ga0070702_100002838
614 Ga0068852_100006614
615 Ga0068852_100024812
616 Ga0068852_100057001
617 Ga0068852_100110180
618 Ga0068864_100023638
619 Ga0068864_100367238
620 Ga0068861_100907337
621 Ga0068851_10000003
622 Ga0068863_100018229
623 Ga0068863_100380195
624 Ga0068858_100014735
625 Ga0068862_100001933
626 Ga0081455_10000363
627 Ga0081455_10076616
628 Ga0081538_10116964
629 Ga0075365_10000821
630 Ga0075365_10017154
631 Ga0075363_100068619
632 Ga0075364_10005149
633 Ga0070715_10009957
634 Ga0070716_100001544
635 Ga0075367_10018787
636 Ga0075431_100486470
637 Ga0075429_100006527
638 Ga0068865_100038939
639 Ga0097620_100000357
640 Ga0105240_10006064
641 Ga0105240_10060054
642 Ga0105240_10296905
643 Ga0111539_10010636
644 Ga0105245_10149847
645 Ga0105245_10467955
646 Ga0105247_10090946
647 Ga0105247_10531272
648 Ga0114129_10010043
649 Ga0105241_10001064
650 Ga0105242_10023921
651 Ga0105242_10379007
652 Ga0105242_10566617
653 Ga0105248_10001478
654 Ga0105248_10003592
655 Ga0105248_10315030
656 Ga0105237_10000131
657 Ga0105237_10052484
658 Ga0105237_10081585
659 Ga0105238_10420233
660 Ga0105249_10046438
661 Ga0105249_10776647
662 Ga0105239_10039388
663 Ga0105239_10394648
664 Ga0105239_10396574
665 Ga0157370_10040504
666 Ga0157369_10015044
667 Ga0157369_10046604
668 Ga0157369_10548092
669 Ga0157374_10384569
670 Ga0163162_10027684
671 Ga0163162_10659700
672 Ga0157372_10059728
673 Ga0157372_10398338
674 Ga0157372_10488787
675 Ga0163163_10012121
676 Ga0157380_10123667
677 Ga0157380_10168720
678 Ga0157379_10000058
679 Ga0157379_10017991
680 Ga0157376_10163493
681 Ga0163161_10172108
682 Ga0163161_10495716
683 Ga0206353_10742524
684 Ga0206353_11120836
685 Ga0206353_11696786
686 Ga0206353_11704794
687 Ga0209566_100026
688 Ga0209674_100001
689 Ga0209672_100006
690 Ga0209147_100868
691 Ga0209563_100001
692 Ga0209563_100461
693 Ga0207427_100329
694 Ga0209437_100739
695 Ga0209677_100001
696 Ga0209677_100523
697 Ga0209148_1000015
698 Ga0209148_1000828
699 Ga0209233_1000001
700 Ga0209233_1013893
701 Ga0209455_1000013
702 Ga0209455_1000979
703 Ga0209455_1019341
704 Ga0207656_10000002
705 Ga0207692_10344603
706 Ga0207647_10015825
707 Ga0207647_10044805
708 Ga0207685_10024569
709 Ga0207705_10000006
710 Ga0207705_10025267
711 Ga0207705_10082199
712 Ga0207705_10293633
713 Ga0207654_10000001
714 Ga0207707_10000220
715 Ga0207695_10006059
716 Ga0207695_10025529
717 Ga0207671_10000002
718 Ga0207671_10024829
719 Ga0207671_10026815
720 Ga0207693_10001931
721 Ga0207660_10000997
722 Ga0207662_10057162
723 Ga0207657_10025274
724 Ga0207657_10088806
725 Ga0207649_10017423
726 Ga0207652_10000471
727 Ga0207652_10160407
728 Ga0207694_10000092
729 Ga0207694_10163248
730 Ga0207650_10227902
731 Ga0207659_10436179
732 Ga0207687_10084305
733 Ga0207687_10111005
734 Ga0207687_10231320
735 Ga0207664_10014767
736 Ga0207664_10147835
737 Ga0207690_10001146
738 Ga0207690_10175044
739 Ga0207706_10324820
740 Ga0207665_10000952
741 Ga0207691_10060547
742 Ga0207711_10000060
743 Ga0207711_10004780
744 Ga0207711_10004873
745 Ga0207711_10080057
746 Ga0207661_10058908
747 Ga0207661_10102850
748 Ga0207667_10006393
749 Ga0207667_10014728
750 Ga0207712_10017638
751 Ga0207712_10149101
752 Ga0207668_10696407
753 Ga0207658_10009467
754 Ga0207658_10164439
755 Ga0207677_10020532
756 Ga0207677_10508549
757 Ga0207703_10000009
758 Ga0207703_10000031
759 Ga0207703_10208222
760 Ga0207639_10033026
761 Ga0207639_10260722
762 Ga0207678_10085543
763 Ga0207678_10102979
764 Ga0207678_10534638
765 Ga0207678_10924990
766 Ga0207708_10242050
767 Ga0207702_10070091
768 Ga0207702_10110798
769 Ga0207702_10189466
770 Ga0207641_10003481
771 Ga0207648_10080635
772 Ga0207674_10004399
773 Ga0207674_10033183
774 Ga0207674_10105779
775 Ga0207674_10107019
776 Ga0207674_10152334
777 Ga0207674_10480524
778 Ga0207675_100009028
779 Ga0207683_10033049
780 Ga0207683_10084642
781 Ga0207698_10000277
782 Ga0207698_10056228
783 Ga0207698_10057880
784 Ga0207698_10115846
785 Ga0207698_10161729
786 Ga0268265_10000024
787 Ga0265338_10079749
788 Ga0265330_10102461
789 Ga0265325_10011674
790 Ga0265340_10044478
791 Ga0307514_10056760
792 Ga0316579_10004999
793 Ga0316579_10014531
794 Ga0265314_10051789
795 Ga0265342_10037249
796 Ga0316576_10000788
797 Ga0316576_10010618
798 Ga0316576_10047287
799 Ga0316578_10001133
800 Ga0316578_10002828
801 Ga0316577_10003953
802 Ga0316577_10193902
803 Ga0307413_10411219
804 Ga0307410_10015490
805 Ga0307406_10000833
806 Ga0307407_10035365
807 Ga0307409_100056726
808 Ga0307409_100446300
809 Ga0307409_100774845
810 Ga0307416_100051319
811 Ga0307416_100060492
812 Ga0307414_10425427
813 Ga0316583_10010540
814 Ga0316583_10056409
815 Ga0316585_10003151
816 Ga0316585_10040948
817 Ga0316580_10004593
818 Ga0316580_10004781
819 Ga0373956_0002961
820 Ga0316574_0014337
821 Ga0316574_0042442
822 Ga0316574_0089402
823 Ga0373931_0100571
824 Ga0316582_0015780
825 Ga0316584_0013835
826 Ga0316584_0022197
827 Ga0316584_0047693
828 Ga0395899_0000786
829 Ga0395900_0012475
830 Ga0395900_0120195
831 Ga0395900_0363044
832 Ga0395900_0488961
833 Ga0395898_0000752
834 Ga0395898_0032253
835 Ga0395898_0128878
836 Ga0395905_0022729
837 Ga0436364_0514406
838 Ga0395901_0000920
839 Ga0395901_0013301
840 Ga0395901_0146054
841 Ga0395901_0189658
842 Ga0395901_0246637
843 Ga0395901_0397633
844 Ga0395901_0525919
845 Ga0451847_0757701
846 Ga0451853_4030682
847 Ga0466972_0046432
848 Ga0466965_0000002
849 Ga0466965_0008852
850 Ga0466965_0061679
851 Ga0466965_0079457
852 Ga0466965_0136936
853 Ga0466965_0193558
854 Ga0466966_0037291
855 Ga0466966_0216302
856 Ga0466961_0086236
857 Ga0466961_0141798
858 Ga0466961_0398898
859 Ga0466963_0192750
860 Ga0466963_0238085
861 Ga0466963_0385502
862 Ga0466971_0011351
863 Ga0466971_0020548
864 Ga0466970_0028362
865 Ga0466970_0031042
866 Ga0466957_0072866
867 Ga0466957_0073490
868 Ga0466957_0081118
869 Ga0466957_0081347
870 Ga0466957_0211079
871 Ga0466957_0452020
872 Ga0466960_0031771
873 Ga0466960_0050687
874 Ga0466960_0124266
875 Ga0466959_0006345
876 Ga0466959_0060247
877 Ga0466959_0060679
878 Ga0466967_0136969
879 Ga0466967_0575049
880 Ga0466967_0666756
881 Ga0495638_0035399
882 Ga0495638_0303961
883 Ga0495653_0108869
884 Ga0495650_0001330
885 Ga0495664_0286059
886 Ga0495631_0078123
887 Ga0495644_0065000
888 Ga0495648_0050573
889 Ga0495645_0133853
890 Ga0495674_0140275
891 Ga0495672_0223123
892 Ga0495680_0407044
893 Ga0496100_0057068
894 Ga0496100_0210644
895 Ga0496101_0006557
896 Ga0496101_0064501
897 Ga0496102_0004392
898 Ga0496102_0090718
899 Ga0496102_0162231
900 Ga0496103_0024681
901 Ga0496104_0034030
902 Ga0496104_0084071
903 Ga0496104_0149351
904 Ga0496104_0355653
905 Ga0496104_0371191
906 Ga0496105_0004765
907 Ga0496105_0016210
908 Ga0496105_0066952
909 Ga0496105_0083622
910 Ga0496105_0155160
911 Ga0496106_0204881
912 Ga0496107_0192175
913 Ga0496107_0401191
914 Ga0496108_0284483
915 Ga0496109_0045917
916 Ga0496109_0342580
917 Ga0496110_0047567
918 Ga0496110_0083055
919 Ga0496111_0118286
920 Ga0496112_0623162
921 Ga0496113_0106604
922 Ga0496113_0184726
923 Ga0496113_0421628
924 Ga0496114_0006381
925 Ga0496114_0015458
926 Ga0496114_0022079
927 Ga0496114_0080488
928 Ga0496114_0216726
929 Ga0496115_0010135
930 Ga0496115_0032163
931 Ga0496115_0055536
932 Ga0496115_0073801
933 Ga0496117_0000235
934 Ga0496117_0010509
935 Ga0496117_0015928
936 Ga0496117_0022233
937 Ga0496117_0026168
938 Ga0496117_0029945
939 Ga0496118_0007162
940 Ga0496118_0008668
941 Ga0496118_0009005
942 Ga0496118_0023094
943 Ga0496118_0036549
944 Ga0496119_0004965
945 Ga0496119_0007470
946 Ga0496119_0015874
947 Ga0496119_0018367
948 Ga0496120_0000655
949 Ga0496120_0030306
950 Ga0496120_0040968
951 Ga0496121_0000277
952 Ga0496122_0000200
953 Ga0496122_0000360
954 Ga0496122_0043308
955 Ga0496123_0000076
956 Ga0496123_0002417
957 Ga0496124_0018523
958 Ga0496124_0125943
959 Ga0496126_0014990
960 Ga0496126_0033121
961 Ga0496126_0057518
962 Ga0496126_0074598
963 Ga0496126_0107727
964 Ga0501031_0009585
965 Ga0501031_0065675
966 Ga0501032_0002800
967 Ga0501032_0006994
968 Ga0501032_0017933
969 Ga0501032_0069724
970 Ga0501032_0085237
971 Ga0501033_0007753
972 Ga0501033_0012915
973 Ga0501033_0060490
974 Ga0501033_0162805
975 Ga0501034_0022284
976 Ga0501034_0024988
977 Ga0501034_0078018
978 Ga0501036_0017172
979 Ga0501036_0248761
980 Ga0501037_0006742
981 Ga0501037_0021415
982 Ga0501037_0038611
983 Ga0501037_0066006
984 Ga0501037_0089882
985 Ga0501037_0166930
986 Ga0501038_0033875
987 Ga0501038_0038126
988 Ga0501038_0038199
989 Ga0501038_0071682
990 Ga0501039_0153251
991 Ga0501039_0167174
992 Ga0501039_0449193
993 Ga0501042_0042640
994 Ga0501042_0043943
995 Ga0501042_0521754
996 Ga0501043_0013204
997 Ga0501043_0021246
998 Ga0501043_0044171
999 Ga0501043_0091162
1000 Ga0501043_0139025
1001 Ga0501043_0263281
1002 Ga0501046_0007020
1003 Ga0501046_0016323
1004 Ga0501046_0018795
1005 Ga0501047_0006712
1006 Ga0501047_0010036
1007 Ga0501047_0010335
1008 Ga0501047_0041412
1009 Ga0501047_0043118
1010 Ga0501047_0164540
1011 Ga0501047_0230335
1012 Ga0501047_0282473
1013 Ga0501048_0008758
1014 Ga0501067_0068932
1015 Ga0501069_0067808
1016 Ga0501070_0000088
1017 Ga0501070_0016947
1018 Ga0501070_0091215
1019 Ga0501071_0000422
1020 Ga0501073_0004953
1021 Ga0501073_0090958
1022 Ga0501073_0146193
1023 Ga0501073_0250990
1024 Ga0501074_0073678
1025 Ga0501080_0048351
1026 Ga0501080_0204660
1027 Ga0501083_0000052
1028 Ga0501083_0215903
1029 Ga0501035_0005181
1030 Ga0501035_0056307
1031 Ga0501035_0060074
1032 Ga0501035_0064364
1033 Ga0501035_0112835
1034 Ga0501035_0185140
1035 Ga0501044_0031929
1036 Ga0501044_0076027
1037 Ga0501044_0077795
1038 Ga0501044_0158170
1039 Ga0501045_0020601
1040 nmdc:mga00v17_15245_c1
1041 nmdc:mga0yw44_16278_c1
1042 nmdc:mga0yw44_26387_c1
1043 nmdc:mga06z11_29106_c1
1044 nmdc:mga07m45_127895_c1
1045 nmdc:mga05p37_210191_c1
1046 nmdc:mga05p37_9946_c1
1047 nmdc:mga09592_11_c1
1048 nmdc:mga0qj67_432383_c1
1049 nmdc:mga06r32_1205_c1
1050 nmdc:mga06r32_40772_c1
1051 nmdc:mga06r32_5_c1
1052 nmdc:mga06r32_900_c4
1053 nmdc:mga08y16_236059_c1
1054 nmdc:mga08y16_61508_c1
1055 nmdc:mga0n895_16320_c1
1056 nmdc:mga0rr50_26939_c1
1057 nmdc:mga0a205_38341_c1
1058 Ga0500635_0000013
1059 Ga0495595_0031041
1060 Ga0495619_0038942
1061 Ga0500643_000953
1062 Ga0500651_0000300
1063 Ga0500562_004538
1064 Ga0500593_076599
1065 Ga0500559_0000156
1066 Ga0500559_0000372
1067 Ga0500559_0008624
1068 Ga0500573_0007144
1069 Ga0500573_0017995
1070 Ga0500573_0023971
1071 Ga0500573_0025310
1072 Ga0500573_0034665
1073 Ga0500573_0042920
1074 Ga0500573_0061311
1075 Ga0500577_0085660
1076 Ga0500590_004686
1077 Ga0500616_0084785
1078 Ga0500620_000060
1079 Ga0500636_0101218
1080 2508675900
1081 2558911457
1082 2587862583
1083 2588108528
1084 2643848267
1085 2643885398
1086 2644095956
1087 2644609196
1088 2676475526
1089 2689956703
1090 2774380346
1091 2774848612
1092 2784472516
1093 2808874713
1094 2808885665
1095 2812374325
1096 2816424707
1097 2819427056
1098 2819666048
1099 2819692475
1100 2819728716
1101 2827631307
1102 2835188957
1103 2837271121
1104 2844842361
1105 2852634222
1106 2852645680
1107 2857484105
1108 2857728394
1109 2862995848
1110 2868091252
1111 2870623779
1112 2870630378
1113 2870784256
1114 2884765319
1115 2887446309
1116 2908680887
1117 2915358431
1118 2919058009
1119 2919071563
1120 2919447030
1121 2919524402
1122 2920883751
1123 2928123214
1124 2928155976
1125 2939658270
1126 2939664013
1127 2946080767
1128 2964329477
1129 2966922340
1130 2966925023
1131 3003003001
1132 8002775492
1133 8004214347
1134 8056039516

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

32

242

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4onc-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9737 20 257
4onc-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9684 20 261
7cpn-assembly2.cif.gz_D crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca 0.9653 24 254
2vg3-assembly1.cif.gz_A rv2361 with citronellyl pyrophosphate 0.9617 20 261
7cpn-assembly2.cif.gz_D crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca 0.9568 24 254
ID Description Score Start End Superfamily
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9694 20 254 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9604 31 254 3.40.1180.10
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9513 32 252 3.40.1180.10
5hxoA00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9506 33 254 3.40.1180.10
af_Q5FC21_4_262_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9496 32 252 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A6B3IRB1-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9943 41 162 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-A0A7K0Z2S2-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9879 40 207 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-A0A6B3IRB1-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9863 41 162 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-A0A382VUM9-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9827 33 166 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A519WDT9-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9776 32 202 GO:0008834
GO:0016094
GO:0045547

Map