F464494
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 312 | 1134 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10004075|Ga0081455_1000407513 |
| Length | 259 |
| Sequence | MSRGYRPPAPHPSGARPPVVPASGLPGHVALIMDGNGRWAKQRGLPRTKGHEAGEAALFDVIEGALEVGVRYLSAYAFSTENWRRSPDEVRFLMGFNRAVIRRRRDELHAMGVRVRWSGRPGRLWKSVIDELRSAEEMTRRNDALTLQFCVNYGGRAELADAVRINPDRIDERTIRRYLYAPEIPDVDLFIRSSGEQRTSNFLLWQSSYAEMAFIPTLWPDFDRRHLWAAIEWYADRDRRFGSAIPNPVPGTGVTPSAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 132 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 136 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 137 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 138 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 146 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 147 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 148 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 152 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 160 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 161 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 162 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 165 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 166 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 167 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 168 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 169 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 187 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 188 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 189 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 190 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 199 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 200 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 201 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 202 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 203 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 204 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 205 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 206 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 207 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 208 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 233 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 234 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 235 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 236 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 245 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 248 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 249 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 250 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 251 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 252 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 253 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 254 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 255 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 256 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 257 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 258 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 259 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 260 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 261 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 262 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 263 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 264 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 265 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 266 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 267 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 268 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 269 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 270 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 271 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 272 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 273 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 274 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 275 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 276 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 277 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 278 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 279 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 280 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 281 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 282 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 283 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 284 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 285 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 286 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 287 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 288 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 289 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 290 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 291 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 292 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 293 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 294 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 295 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 296 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 297 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 298 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 299 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 300 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 301 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 302 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 303 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 304 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 305 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 306 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 307 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 308 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 309 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 310 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 311 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 312 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.71 |
| Metatranscriptomes | 1.59 |
| Isolates | 9.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.88 |
| Nodule | 0.71 |
| Rhizoplane | 7.05 |
| Rhizosphere | 71.08 |
| Stem | 0 |
| Stem Tuber | 0.18 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10004075 | 3300005937 | Bacteria | 16549 |
| 2 | JGI24735J21928_10016514 | 3300002067 | Bacteria | 2289 |
| 3 | JGI25164J39214_1002166 | 3300002772 | Bacteria | 3264 |
| 4 | JGI25165J46597_1000002 | 3300003214 | Bacteria | 765387 |
| 5 | Ga0006562J51391_1028901 | 3300003578 | Bacteria | 3870 |
| 6 | Ga0006562J51391_1028902 | 3300003578 | Bacteria | 2357 |
| 7 | Ga0006562J51391_1039029 | 3300003578 | Bacteria | 3280 |
| 8 | Ga0006562J51391_1169475 | 3300003578 | Bacteria | 2100 |
| 9 | Ga0006562J51391_1169476 | 3300003578 | Bacteria | 2030 |
| 10 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 11 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 12 | Ga0055525_1000221 | 3300003759 | Bacteria | 62301 |
| 13 | Ga0055525_1000365 | 3300003759 | Bacteria | 30386 |
| 14 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 15 | Ga0055529_1000018 | 3300003763 | Bacteria | 344344 |
| 16 | Ga0055541_1009324 | 3300003841 | Bacteria | 1523 |
| 17 | Ga0070658_10000833 | 3300005327 | Bacteria | 26391 |
| 18 | Ga0070658_10075378 | 3300005327 | Bacteria | 2767 |
| 19 | Ga0070658_10121672 | 3300005327 | Bacteria | 2169 |
| 20 | Ga0070658_10168885 | 3300005327 | Bacteria | 1837 |
| 21 | Ga0070683_100013636 | 3300005329 | Bacteria | 7094 |
| 22 | Ga0070682_100164986 | 3300005337 | Bacteria | 1534 |
| 23 | Ga0068868_100029730 | 3300005338 | Bacteria | 4186 |
| 24 | Ga0070660_100133225 | 3300005339 | Bacteria | 1990 |
| 25 | Ga0070661_100068570 | 3300005344 | Bacteria | 2607 |
| 26 | Ga0070668_100313524 | 3300005347 | Bacteria | 1319 |
| 27 | Ga0070659_100014108 | 3300005366 | Bacteria | 5963 |
| 28 | Ga0070659_100409250 | 3300005366 | Bacteria | 1146 |
| 29 | Ga0070659_100432560 | 3300005366 | Bacteria | 1114 |
| 30 | Ga0070667_100027561 | 3300005367 | Bacteria | 4727 |
| 31 | Ga0070705_100125586 | 3300005440 | Bacteria | 1665 |
| 32 | Ga0070663_100003571 | 3300005455 | Bacteria | 8983 |
| 33 | Ga0070663_100281656 | 3300005455 | Bacteria | 1325 |
| 34 | Ga0070681_10395661 | 3300005458 | Bacteria | 1293 |
| 35 | Ga0070679_100428066 | 3300005530 | Bacteria | 1269 |
| 36 | Ga0068853_100028944 | 3300005539 | Bacteria | 4663 |
| 37 | Ga0070672_100049351 | 3300005543 | Bacteria | 3274 |
| 38 | Ga0070693_100034918 | 3300005547 | Bacteria | 2785 |
| 39 | Ga0068855_100023298 | 3300005563 | Bacteria | 7415 |
| 40 | Ga0068855_100226576 | 3300005563 | Bacteria | 2095 |
| 41 | Ga0068857_100124317 | 3300005577 | Bacteria | 2324 |
| 42 | Ga0068856_100017184 | 3300005614 | Bacteria | 7009 |
| 43 | Ga0068856_100026572 | 3300005614 | Bacteria | 5644 |
| 44 | Ga0068856_100121478 | 3300005614 | Bacteria | 2614 |
| 45 | Ga0068856_100376118 | 3300005614 | Bacteria | 1439 |
| 46 | Ga0070702_100002838 | 3300005615 | Bacteria | 7602 |
| 47 | Ga0068852_100006614 | 3300005616 | Bacteria | 8395 |
| 48 | Ga0068852_100024812 | 3300005616 | Bacteria | 4850 |
| 49 | Ga0068852_100057001 | 3300005616 | Bacteria | 3379 |
| 50 | Ga0068852_100110180 | 3300005616 | Bacteria | 2501 |
| 51 | Ga0068864_100023638 | 3300005618 | Bacteria | 5163 |
| 52 | Ga0068864_100367238 | 3300005618 | Bacteria | 1361 |
| 53 | Ga0068861_100907337 | 3300005719 | Bacteria | 835 |
| 54 | Ga0068851_10000003 | 3300005834 | Bacteria | 293018 |
| 55 | Ga0068863_100018229 | 3300005841 | Bacteria | 6721 |
| 56 | Ga0068863_100380195 | 3300005841 | Bacteria | 1379 |
| 57 | Ga0068858_100014735 | 3300005842 | Bacteria | 7358 |
| 58 | Ga0068862_100001933 | 3300005844 | Bacteria | 18801 |
| 59 | Ga0081455_10000363 | 3300005937 | Bacteria | 59814 |
| 60 | Ga0081455_10076616 | 3300005937 | Bacteria | 2754 |
| 61 | Ga0081538_10116964 | 3300005981 | Bacteria | 1292 |
| 62 | Ga0075365_10000821 | 3300006038 | Bacteria | 12815 |
| 63 | Ga0075365_10017154 | 3300006038 | Bacteria | 4422 |
| 64 | Ga0075363_100068619 | 3300006048 | Bacteria | 1923 |
| 65 | Ga0075364_10005149 | 3300006051 | Bacteria | 7580 |
| 66 | Ga0070715_10009957 | 3300006163 | Bacteria | 3371 |
| 67 | Ga0070716_100001544 | 3300006173 | Bacteria | 10324 |
| 68 | Ga0075367_10018787 | 3300006178 | Bacteria | 3820 |
| 69 | Ga0075431_100486470 | 3300006847 | Bacteria | 1226 |
| 70 | Ga0075429_100006527 | 3300006880 | Bacteria | 10092 |
| 71 | Ga0068865_100038939 | 3300006881 | Bacteria | 3221 |
| 72 | Ga0097620_100000357 | 3300006931 | Bacteria | 45626 |
| 73 | Ga0105240_10006064 | 3300009093 | Bacteria | 17858 |
| 74 | Ga0105240_10060054 | 3300009093 | Bacteria | 4741 |
| 75 | Ga0105240_10296905 | 3300009093 | Bacteria | 1850 |
| 76 | Ga0111539_10010636 | 3300009094 | Bacteria | 11585 |
| 77 | Ga0105245_10149847 | 3300009098 | Bacteria | 2205 |
| 78 | Ga0105245_10467955 | 3300009098 | Bacteria | 1272 |
| 79 | Ga0105247_10090946 | 3300009101 | Bacteria | 1937 |
| 80 | Ga0105247_10531272 | 3300009101 | Bacteria | 862 |
| 81 | Ga0114129_10010043 | 3300009147 | Bacteria | 13495 |
| 82 | Ga0105241_10001064 | 3300009174 | Bacteria | 20907 |
| 83 | Ga0105242_10023921 | 3300009176 | Bacteria | 4821 |
| 84 | Ga0105242_10379007 | 3300009176 | Bacteria | 1314 |
| 85 | Ga0105242_10566617 | 3300009176 | Bacteria | 1092 |
| 86 | Ga0105248_10001478 | 3300009177 | Bacteria | 26153 |
| 87 | Ga0105248_10003592 | 3300009177 | Bacteria | 17186 |
| 88 | Ga0105248_10315030 | 3300009177 | Bacteria | 1762 |
| 89 | Ga0105237_10000131 | 3300009545 | Bacteria | 105010 |
| 90 | Ga0105237_10052484 | 3300009545 | Bacteria | 4093 |
| 91 | Ga0105237_10081585 | 3300009545 | Bacteria | 3225 |
| 92 | Ga0105238_10420233 | 3300009551 | Bacteria | 1332 |
| 93 | Ga0105249_10046438 | 3300009553 | Bacteria | 3952 |
| 94 | Ga0105249_10776647 | 3300009553 | Bacteria | 1021 |
| 95 | Ga0105239_10039388 | 3300010375 | Bacteria | 5178 |
| 96 | Ga0105239_10394648 | 3300010375 | Bacteria | 1565 |
| 97 | Ga0105239_10396574 | 3300010375 | Bacteria | 1561 |
| 98 | Ga0157370_10040504 | 3300013104 | Bacteria | 4498 |
| 99 | Ga0157369_10015044 | 3300013105 | Bacteria | 8731 |
| 100 | Ga0157369_10046604 | 3300013105 | Bacteria | 4711 |
| 101 | Ga0157369_10548092 | 3300013105 | Bacteria | 1195 |
| 102 | Ga0157374_10384569 | 3300013296 | Bacteria | 1398 |
| 103 | Ga0163162_10027684 | 3300013306 | Bacteria | 5607 |
| 104 | Ga0163162_10659700 | 3300013306 | Bacteria | 1169 |
| 105 | Ga0157372_10059728 | 3300013307 | Bacteria | 4266 |
| 106 | Ga0157372_10398338 | 3300013307 | Bacteria | 1604 |
| 107 | Ga0157372_10488787 | 3300013307 | Bacteria | 1435 |
| 108 | Ga0163163_10012121 | 3300014325 | Bacteria | 7845 |
| 109 | Ga0157380_10123667 | 3300014326 | Bacteria | 2196 |
| 110 | Ga0157380_10168720 | 3300014326 | Bacteria | 1910 |
| 111 | Ga0157379_10000058 | 3300014968 | Bacteria | 69871 |
| 112 | Ga0157379_10017991 | 3300014968 | Bacteria | 6229 |
| 113 | Ga0157376_10163493 | 3300014969 | Bacteria | 2020 |
| 114 | Ga0163161_10172108 | 3300017792 | Bacteria | 1656 |
| 115 | Ga0163161_10495716 | 3300017792 | Bacteria | 994 |
| 116 | Ga0206353_10742524 | 3300020082 | Bacteria | 1170 |
| 117 | Ga0206353_11120836 | 3300020082 | Bacteria | 19200 |
| 118 | Ga0206353_11696786 | 3300020082 | Bacteria | 1734 |
| 119 | Ga0206353_11704794 | 3300020082 | Bacteria | 1155 |
| 120 | Ga0209566_100026 | 3300025225 | Bacteria | 367457 |
| 121 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 122 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 123 | Ga0209147_100868 | 3300025229 | Bacteria | 14017 |
| 124 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 125 | Ga0209563_100461 | 3300025230 | Bacteria | 14011 |
| 126 | Ga0207427_100329 | 3300025231 | Bacteria | 31805 |
| 127 | Ga0209437_100739 | 3300025233 | Bacteria | 16245 |
| 128 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 129 | Ga0209677_100523 | 3300025253 | Bacteria | 21334 |
| 130 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 131 | Ga0209148_1000828 | 3300025254 | Bacteria | 22166 |
| 132 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 133 | Ga0209233_1013893 | 3300025261 | Bacteria | 2288 |
| 134 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 135 | Ga0209455_1000979 | 3300025272 | Bacteria | 14449 |
| 136 | Ga0209455_1019341 | 3300025272 | Bacteria | 1379 |
| 137 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 138 | Ga0207692_10344603 | 3300025898 | Bacteria | 917 |
| 139 | Ga0207647_10015825 | 3300025904 | Bacteria | 5162 |
| 140 | Ga0207647_10044805 | 3300025904 | Bacteria | 2762 |
| 141 | Ga0207685_10024569 | 3300025905 | Bacteria | 2068 |
| 142 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 143 | Ga0207705_10025267 | 3300025909 | Bacteria | 4241 |
| 144 | Ga0207705_10082199 | 3300025909 | Bacteria | 2349 |
| 145 | Ga0207705_10293633 | 3300025909 | Bacteria | 1245 |
| 146 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 147 | Ga0207707_10000220 | 3300025912 | Bacteria | 61279 |
| 148 | Ga0207695_10006059 | 3300025913 | Bacteria | 15782 |
| 149 | Ga0207695_10025529 | 3300025913 | Bacteria | 6612 |
| 150 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 151 | Ga0207671_10024829 | 3300025914 | Bacteria | 4504 |
| 152 | Ga0207671_10026815 | 3300025914 | Bacteria | 4311 |
| 153 | Ga0207693_10001931 | 3300025915 | Bacteria | 18156 |
| 154 | Ga0207660_10000997 | 3300025917 | Bacteria | 18782 |
| 155 | Ga0207662_10057162 | 3300025918 | Bacteria | 2331 |
| 156 | Ga0207657_10025274 | 3300025919 | Bacteria | 5480 |
| 157 | Ga0207657_10088806 | 3300025919 | Bacteria | 2583 |
| 158 | Ga0207649_10017423 | 3300025920 | Bacteria | 4071 |
| 159 | Ga0207652_10000471 | 3300025921 | Bacteria | 41340 |
| 160 | Ga0207652_10160407 | 3300025921 | Bacteria | 2016 |
| 161 | Ga0207694_10000092 | 3300025924 | Bacteria | 100605 |
| 162 | Ga0207694_10163248 | 3300025924 | Bacteria | 1800 |
| 163 | Ga0207650_10227902 | 3300025925 | Bacteria | 1502 |
| 164 | Ga0207659_10436179 | 3300025926 | Bacteria | 1101 |
| 165 | Ga0207687_10084305 | 3300025927 | Bacteria | 2303 |
| 166 | Ga0207687_10111005 | 3300025927 | Bacteria | 2035 |
| 167 | Ga0207687_10231320 | 3300025927 | Bacteria | 1460 |
| 168 | Ga0207664_10014767 | 3300025929 | Bacteria | 5653 |
| 169 | Ga0207664_10147835 | 3300025929 | Bacteria | 1994 |
| 170 | Ga0207690_10001146 | 3300025932 | Bacteria | 16853 |
| 171 | Ga0207690_10175044 | 3300025932 | Bacteria | 1611 |
| 172 | Ga0207706_10324820 | 3300025933 | Bacteria | 1339 |
| 173 | Ga0207665_10000952 | 3300025939 | Bacteria | 19599 |
| 174 | Ga0207691_10060547 | 3300025940 | Bacteria | 3439 |
| 175 | Ga0207711_10000060 | 3300025941 | Bacteria | 127720 |
| 176 | Ga0207711_10004780 | 3300025941 | Bacteria | 11496 |
| 177 | Ga0207711_10004873 | 3300025941 | Bacteria | 11391 |
| 178 | Ga0207711_10080057 | 3300025941 | Bacteria | 2853 |
| 179 | Ga0207661_10058908 | 3300025944 | Bacteria | 3093 |
| 180 | Ga0207661_10102850 | 3300025944 | Bacteria | 2403 |
| 181 | Ga0207667_10006393 | 3300025949 | Bacteria | 14282 |
| 182 | Ga0207667_10014728 | 3300025949 | Bacteria | 8899 |
| 183 | Ga0207712_10017638 | 3300025961 | Bacteria | 4641 |
| 184 | Ga0207712_10149101 | 3300025961 | Bacteria | 1805 |
| 185 | Ga0207668_10696407 | 3300025972 | Bacteria | 893 |
| 186 | Ga0207658_10009467 | 3300025986 | Bacteria | 6609 |
| 187 | Ga0207658_10164439 | 3300025986 | Bacteria | 1821 |
| 188 | Ga0207677_10020532 | 3300026023 | Bacteria | 4013 |
| 189 | Ga0207677_10508549 | 3300026023 | Bacteria | 1043 |
| 190 | Ga0207703_10000009 | 3300026035 | Bacteria | 343983 |
| 191 | Ga0207703_10000031 | 3300026035 | Bacteria | 196940 |
| 192 | Ga0207703_10208222 | 3300026035 | Bacteria | 1742 |
| 193 | Ga0207639_10033026 | 3300026041 | Bacteria | 3814 |
| 194 | Ga0207639_10260722 | 3300026041 | Bacteria | 1516 |
| 195 | Ga0207678_10085543 | 3300026067 | Bacteria | 2696 |
| 196 | Ga0207678_10102979 | 3300026067 | Bacteria | 2437 |
| 197 | Ga0207678_10534638 | 3300026067 | Bacteria | 1024 |
| 198 | Ga0207678_10924990 | 3300026067 | Bacteria | 771 |
| 199 | Ga0207708_10242050 | 3300026075 | Bacteria | 1451 |
| 200 | Ga0207702_10070091 | 3300026078 | Bacteria | 3015 |
| 201 | Ga0207702_10110798 | 3300026078 | Bacteria | 2440 |
| 202 | Ga0207702_10189466 | 3300026078 | Bacteria | 1899 |
| 203 | Ga0207641_10003481 | 3300026088 | Bacteria | 13948 |
| 204 | Ga0207648_10080635 | 3300026089 | Bacteria | 2839 |
| 205 | Ga0207674_10004399 | 3300026116 | Bacteria | 16981 |
| 206 | Ga0207674_10033183 | 3300026116 | Bacteria | 5405 |
| 207 | Ga0207674_10105779 | 3300026116 | Bacteria | 2792 |
| 208 | Ga0207674_10107019 | 3300026116 | Bacteria | 2773 |
| 209 | Ga0207674_10152334 | 3300026116 | Bacteria | 2269 |
| 210 | Ga0207674_10480524 | 3300026116 | Bacteria | 1201 |
| 211 | Ga0207675_100009028 | 3300026118 | Bacteria | 9353 |
| 212 | Ga0207683_10033049 | 3300026121 | Bacteria | 4493 |
| 213 | Ga0207683_10084642 | 3300026121 | Bacteria | 2819 |
| 214 | Ga0207698_10000277 | 3300026142 | Bacteria | 31170 |
| 215 | Ga0207698_10056228 | 3300026142 | Bacteria | 3037 |
| 216 | Ga0207698_10057880 | 3300026142 | Bacteria | 3001 |
| 217 | Ga0207698_10115846 | 3300026142 | Bacteria | 2257 |
| 218 | Ga0207698_10161729 | 3300026142 | Bacteria | 1959 |
| 219 | Ga0268265_10000024 | 3300028380 | Bacteria | 266266 |
| 220 | Ga0265338_10079749 | 3300028800 | Bacteria | 2753 |
| 221 | Ga0265330_10102461 | 3300031235 | Bacteria | 1225 |
| 222 | Ga0265325_10011674 | 3300031241 | Bacteria | 5041 |
| 223 | Ga0265340_10044478 | 3300031247 | Bacteria | 2172 |
| 224 | Ga0307514_10056760 | 3300031649 | Bacteria | 3003 |
| 225 | Ga0316579_10004999 | 3300031691 | Bacteria | 5319 |
| 226 | Ga0316579_10014531 | 3300031691 | Bacteria | 3406 |
| 227 | Ga0265314_10051789 | 3300031711 | Bacteria | 2858 |
| 228 | Ga0265342_10037249 | 3300031712 | Bacteria | 2967 |
| 229 | Ga0316576_10000788 | 3300031727 | Bacteria | 15928 |
| 230 | Ga0316576_10010618 | 3300031727 | Bacteria | 5995 |
| 231 | Ga0316576_10047287 | 3300031727 | Bacteria | 3117 |
| 232 | Ga0316578_10001133 | 3300031728 | Bacteria | 10445 |
| 233 | Ga0316578_10002828 | 3300031728 | Bacteria | 7758 |
| 234 | Ga0316577_10003953 | 3300031733 | Bacteria | 7578 |
| 235 | Ga0316577_10193902 | 3300031733 | Bacteria | 1148 |
| 236 | Ga0307413_10411219 | 3300031824 | Bacteria | 1063 |
| 237 | Ga0307410_10015490 | 3300031852 | Bacteria | 4524 |
| 238 | Ga0307406_10000833 | 3300031901 | Bacteria | 17322 |
| 239 | Ga0307407_10035365 | 3300031903 | Bacteria | 2744 |
| 240 | Ga0307409_100056726 | 3300031995 | Bacteria | 3030 |
| 241 | Ga0307409_100446300 | 3300031995 | Bacteria | 1247 |
| 242 | Ga0307409_100774845 | 3300031995 | Bacteria | 965 |
| 243 | Ga0307416_100051319 | 3300032002 | Bacteria | 3294 |
| 244 | Ga0307416_100060492 | 3300032002 | Bacteria | 3085 |
| 245 | Ga0307414_10425427 | 3300032004 | Bacteria | 1159 |
| 246 | Ga0316583_10010540 | 3300032133 | Bacteria | 3334 |
| 247 | Ga0316583_10056409 | 3300032133 | Bacteria | 1380 |
| 248 | Ga0316585_10003151 | 3300032137 | Bacteria | 4502 |
| 249 | Ga0316585_10040948 | 3300032137 | Bacteria | 1476 |
| 250 | Ga0316580_10004593 | 3300032139 | Bacteria | 4010 |
| 251 | Ga0316580_10004781 | 3300032139 | Bacteria | 3935 |
| 252 | Ga0373956_0002961 | 3300035119 | Bacteria | 6874 |
| 253 | Ga0316574_0014337 | 3300035398 | Bacteria | 4578 |
| 254 | Ga0316574_0042442 | 3300035398 | Bacteria | 2806 |
| 255 | Ga0316574_0089402 | 3300035398 | Bacteria | 1962 |
| 256 | Ga0373931_0100571 | 3300035691 | Bacteria | 1626 |
| 257 | Ga0316582_0015780 | 3300036647 | Bacteria | 4329 |
| 258 | Ga0316584_0013835 | 3300036712 | Bacteria | 5725 |
| 259 | Ga0316584_0022197 | 3300036712 | Bacteria | 4626 |
| 260 | Ga0316584_0047693 | 3300036712 | Bacteria | 3200 |
| 261 | Ga0395899_0000786 | 3300037312 | Bacteria | 31058 |
| 262 | Ga0395900_0012475 | 3300037418 | Bacteria | 8689 |
| 263 | Ga0395900_0120195 | 3300037418 | Bacteria | 2696 |
| 264 | Ga0395900_0363044 | 3300037418 | Bacteria | 1419 |
| 265 | Ga0395900_0488961 | 3300037418 | Bacteria | 1182 |
| 266 | Ga0395898_0000752 | 3300037466 | Bacteria | 56634 |
| 267 | Ga0395898_0032253 | 3300037466 | Bacteria | 5228 |
| 268 | Ga0395898_0128878 | 3300037466 | Bacteria | 2424 |
| 269 | Ga0395905_0022729 | 3300037471 | Bacteria | 5930 |
| 270 | Ga0436364_0514406 | 3300037853 | Bacteria | 1164 |
| 271 | Ga0395901_0000920 | 3300038443 | Bacteria | 32069 |
| 272 | Ga0395901_0013301 | 3300038443 | Bacteria | 8359 |
| 273 | Ga0395901_0146054 | 3300038443 | Bacteria | 2486 |
| 274 | Ga0395901_0189658 | 3300038443 | Bacteria | 2156 |
| 275 | Ga0395901_0246637 | 3300038443 | Bacteria | 1861 |
| 276 | Ga0395901_0397633 | 3300038443 | Bacteria | 1416 |
| 277 | Ga0395901_0525919 | 3300038443 | Bacteria | 1201 |
| 278 | Ga0451847_0757701 | 3300041503 | Bacteria | 1340 |
| 279 | Ga0451853_4030682 | 3300041512 | Bacteria | 3322 |
| 280 | Ga0466972_0046432 | 3300044658 | Bacteria | 2102 |
| 281 | Ga0466965_0000002 | 3300044683 | Bacteria | 297957 |
| 282 | Ga0466965_0008852 | 3300044683 | Bacteria | 4667 |
| 283 | Ga0466965_0061679 | 3300044683 | Bacteria | 1874 |
| 284 | Ga0466965_0079457 | 3300044683 | Bacteria | 1657 |
| 285 | Ga0466965_0136936 | 3300044683 | Bacteria | 1273 |
| 286 | Ga0466965_0193558 | 3300044683 | Bacteria | 1076 |
| 287 | Ga0466966_0037291 | 3300044684 | Bacteria | 3136 |
| 288 | Ga0466966_0216302 | 3300044684 | Bacteria | 1157 |
| 289 | Ga0466961_0086236 | 3300044693 | Bacteria | 1984 |
| 290 | Ga0466961_0141798 | 3300044693 | Bacteria | 1504 |
| 291 | Ga0466961_0398898 | 3300044693 | Bacteria | 835 |
| 292 | Ga0466963_0192750 | 3300044694 | Bacteria | 1424 |
| 293 | Ga0466963_0238085 | 3300044694 | Bacteria | 1276 |
| 294 | Ga0466963_0385502 | 3300044694 | Bacteria | 988 |
| 295 | Ga0466971_0011351 | 3300044719 | Bacteria | 3901 |
| 296 | Ga0466971_0020548 | 3300044719 | Bacteria | 2936 |
| 297 | Ga0466970_0028362 | 3300044765 | Bacteria | 2940 |
| 298 | Ga0466970_0031042 | 3300044765 | Bacteria | 2820 |
| 299 | Ga0466957_0072866 | 3300044842 | Bacteria | 2128 |
| 300 | Ga0466957_0073490 | 3300044842 | Bacteria | 2119 |
| 301 | Ga0466957_0081118 | 3300044842 | Bacteria | 2020 |
| 302 | Ga0466957_0081347 | 3300044842 | Bacteria | 2017 |
| 303 | Ga0466957_0211079 | 3300044842 | Bacteria | 1278 |
| 304 | Ga0466957_0452020 | 3300044842 | Bacteria | 885 |
| 305 | Ga0466960_0031771 | 3300044901 | Bacteria | 2438 |
| 306 | Ga0466960_0050687 | 3300044901 | Bacteria | 2002 |
| 307 | Ga0466960_0124266 | 3300044901 | Bacteria | 1355 |
| 308 | Ga0466959_0006345 | 3300045049 | Bacteria | 8181 |
| 309 | Ga0466959_0060247 | 3300045049 | Bacteria | 2762 |
| 310 | Ga0466959_0060679 | 3300045049 | Bacteria | 2751 |
| 311 | Ga0466967_0136969 | 3300045976 | Bacteria | 2277 |
| 312 | Ga0466967_0575049 | 3300045976 | Bacteria | 1110 |
| 313 | Ga0466967_0666756 | 3300045976 | Bacteria | 1029 |
| 314 | Ga0495638_0035399 | 3300046460 | Bacteria | 3183 |
| 315 | Ga0495638_0303961 | 3300046460 | Bacteria | 858 |
| 316 | Ga0495653_0108869 | 3300046463 | Bacteria | 1995 |
| 317 | Ga0495650_0001330 | 3300046471 | Bacteria | 24757 |
| 318 | Ga0495664_0286059 | 3300046477 | Bacteria | 996 |
| 319 | Ga0495631_0078123 | 3300046518 | Bacteria | 1429 |
| 320 | Ga0495644_0065000 | 3300046523 | Bacteria | 1371 |
| 321 | Ga0495648_0050573 | 3300046524 | Bacteria | 2537 |
| 322 | Ga0495645_0133853 | 3300046543 | Bacteria | 1735 |
| 323 | Ga0495674_0140275 | 3300047319 | Bacteria | 2032 |
| 324 | Ga0495672_0223123 | 3300047320 | Bacteria | 929 |
| 325 | Ga0495680_0407044 | 3300047322 | Bacteria | 938 |
| 326 | Ga0496100_0057068 | 3300048903 | Bacteria | 2556 |
| 327 | Ga0496100_0210644 | 3300048903 | Bacteria | 1421 |
| 328 | Ga0496101_0006557 | 3300048904 | Bacteria | 7496 |
| 329 | Ga0496101_0064501 | 3300048904 | Bacteria | 2668 |
| 330 | Ga0496102_0004392 | 3300048905 | Bacteria | 11911 |
| 331 | Ga0496102_0090718 | 3300048905 | Bacteria | 2828 |
| 332 | Ga0496102_0162231 | 3300048905 | Bacteria | 2103 |
| 333 | Ga0496103_0024681 | 3300048906 | Bacteria | 3627 |
| 334 | Ga0496104_0034030 | 3300048907 | Bacteria | 4750 |
| 335 | Ga0496104_0084071 | 3300048907 | Bacteria | 3036 |
| 336 | Ga0496104_0149351 | 3300048907 | Bacteria | 2244 |
| 337 | Ga0496104_0355653 | 3300048907 | Bacteria | 1377 |
| 338 | Ga0496104_0371191 | 3300048907 | Bacteria | 1343 |
| 339 | Ga0496105_0004765 | 3300048908 | Bacteria | 10243 |
| 340 | Ga0496105_0016210 | 3300048908 | Bacteria | 5946 |
| 341 | Ga0496105_0066952 | 3300048908 | Bacteria | 2965 |
| 342 | Ga0496105_0083622 | 3300048908 | Bacteria | 2636 |
| 343 | Ga0496105_0155160 | 3300048908 | Bacteria | 1880 |
| 344 | Ga0496106_0204881 | 3300048909 | Bacteria | 1571 |
| 345 | Ga0496107_0192175 | 3300048910 | Bacteria | 1517 |
| 346 | Ga0496107_0401191 | 3300048910 | Bacteria | 1020 |
| 347 | Ga0496108_0284483 | 3300048911 | Bacteria | 1439 |
| 348 | Ga0496109_0045917 | 3300048912 | Bacteria | 3966 |
| 349 | Ga0496109_0342580 | 3300048912 | Bacteria | 1412 |
| 350 | Ga0496110_0047567 | 3300048913 | Bacteria | 3758 |
| 351 | Ga0496110_0083055 | 3300048913 | Bacteria | 2857 |
| 352 | Ga0496111_0118286 | 3300048914 | Bacteria | 1956 |
| 353 | Ga0496112_0623162 | 3300048915 | Bacteria | 1010 |
| 354 | Ga0496113_0106604 | 3300048916 | Bacteria | 2177 |
| 355 | Ga0496113_0184726 | 3300048916 | Bacteria | 1653 |
| 356 | Ga0496113_0421628 | 3300048916 | Bacteria | 1072 |
| 357 | Ga0496114_0006381 | 3300048917 | Bacteria | 9283 |
| 358 | Ga0496114_0015458 | 3300048917 | Bacteria | 6138 |
| 359 | Ga0496114_0022079 | 3300048917 | Bacteria | 5183 |
| 360 | Ga0496114_0080488 | 3300048917 | Bacteria | 2751 |
| 361 | Ga0496114_0216726 | 3300048917 | Bacteria | 1680 |
| 362 | Ga0496115_0010135 | 3300048918 | Bacteria | 7032 |
| 363 | Ga0496115_0032163 | 3300048918 | Bacteria | 4138 |
| 364 | Ga0496115_0055536 | 3300048918 | Bacteria | 3181 |
| 365 | Ga0496115_0073801 | 3300048918 | Bacteria | 2769 |
| 366 | Ga0496117_0000235 | 3300048920 | Bacteria | 104830 |
| 367 | Ga0496117_0010509 | 3300048920 | Bacteria | 8419 |
| 368 | Ga0496117_0015928 | 3300048920 | Bacteria | 6370 |
| 369 | Ga0496117_0022233 | 3300048920 | Bacteria | 5091 |
| 370 | Ga0496117_0026168 | 3300048920 | Bacteria | 4570 |
| 371 | Ga0496117_0029945 | 3300048920 | Bacteria | 4186 |
| 372 | Ga0496118_0007162 | 3300048921 | Bacteria | 11930 |
| 373 | Ga0496118_0008668 | 3300048921 | Bacteria | 10458 |
| 374 | Ga0496118_0009005 | 3300048921 | Bacteria | 10183 |
| 375 | Ga0496118_0023094 | 3300048921 | Bacteria | 5415 |
| 376 | Ga0496118_0036549 | 3300048921 | Bacteria | 3969 |
| 377 | Ga0496119_0004965 | 3300048922 | Bacteria | 12999 |
| 378 | Ga0496119_0007470 | 3300048922 | Bacteria | 9832 |
| 379 | Ga0496119_0015874 | 3300048922 | Bacteria | 5766 |
| 380 | Ga0496119_0018367 | 3300048922 | Bacteria | 5208 |
| 381 | Ga0496120_0000655 | 3300048923 | Bacteria | 50898 |
| 382 | Ga0496120_0030306 | 3300048923 | Bacteria | 3290 |
| 383 | Ga0496120_0040968 | 3300048923 | Bacteria | 2717 |
| 384 | Ga0496121_0000277 | 3300048924 | Bacteria | 107014 |
| 385 | Ga0496122_0000200 | 3300048925 | Bacteria | 133548 |
| 386 | Ga0496122_0000360 | 3300048925 | Bacteria | 97913 |
| 387 | Ga0496122_0043308 | 3300048925 | Bacteria | 3528 |
| 388 | Ga0496123_0000076 | 3300048926 | Bacteria | 194050 |
| 389 | Ga0496123_0002417 | 3300048926 | Bacteria | 23290 |
| 390 | Ga0496124_0018523 | 3300048927 | Bacteria | 6518 |
| 391 | Ga0496124_0125943 | 3300048927 | Bacteria | 2041 |
| 392 | Ga0496126_0014990 | 3300048929 | Bacteria | 7815 |
| 393 | Ga0496126_0033121 | 3300048929 | Bacteria | 4863 |
| 394 | Ga0496126_0057518 | 3300048929 | Bacteria | 3510 |
| 395 | Ga0496126_0074598 | 3300048929 | Bacteria | 3012 |
| 396 | Ga0496126_0107727 | 3300048929 | Bacteria | 2430 |
| 397 | Ga0501031_0009585 | 3300049568 | Bacteria | 6304 |
| 398 | Ga0501031_0065675 | 3300049568 | Bacteria | 2364 |
| 399 | Ga0501032_0002800 | 3300049569 | Bacteria | 13565 |
| 400 | Ga0501032_0006994 | 3300049569 | Bacteria | 8272 |
| 401 | Ga0501032_0017933 | 3300049569 | Bacteria | 4966 |
| 402 | Ga0501032_0069724 | 3300049569 | Bacteria | 2346 |
| 403 | Ga0501032_0085237 | 3300049569 | Bacteria | 2100 |
| 404 | Ga0501033_0007753 | 3300049570 | Bacteria | 8321 |
| 405 | Ga0501033_0012915 | 3300049570 | Bacteria | 6369 |
| 406 | Ga0501033_0060490 | 3300049570 | Bacteria | 2794 |
| 407 | Ga0501033_0162805 | 3300049570 | Bacteria | 1605 |
| 408 | Ga0501034_0022284 | 3300049571 | Bacteria | 6456 |
| 409 | Ga0501034_0024988 | 3300049571 | Bacteria | 6078 |
| 410 | Ga0501034_0078018 | 3300049571 | Bacteria | 3317 |
| 411 | Ga0501036_0017172 | 3300049572 | Bacteria | 6048 |
| 412 | Ga0501036_0248761 | 3300049572 | Bacteria | 1490 |
| 413 | Ga0501037_0006742 | 3300049573 | Bacteria | 8401 |
| 414 | Ga0501037_0021415 | 3300049573 | Bacteria | 4777 |
| 415 | Ga0501037_0038611 | 3300049573 | Bacteria | 3517 |
| 416 | Ga0501037_0066006 | 3300049573 | Bacteria | 2636 |
| 417 | Ga0501037_0089882 | 3300049573 | Bacteria | 2222 |
| 418 | Ga0501037_0166930 | 3300049573 | Bacteria | 1567 |
| 419 | Ga0501038_0033875 | 3300049574 | Bacteria | 4494 |
| 420 | Ga0501038_0038126 | 3300049574 | Bacteria | 4209 |
| 421 | Ga0501038_0038199 | 3300049574 | Bacteria | 4205 |
| 422 | Ga0501038_0071682 | 3300049574 | Bacteria | 2938 |
| 423 | Ga0501039_0153251 | 3300049575 | Bacteria | 1810 |
| 424 | Ga0501039_0167174 | 3300049575 | Bacteria | 1729 |
| 425 | Ga0501039_0449193 | 3300049575 | Bacteria | 1012 |
| 426 | Ga0501042_0042640 | 3300049578 | Bacteria | 3230 |
| 427 | Ga0501042_0043943 | 3300049578 | Bacteria | 3183 |
| 428 | Ga0501042_0521754 | 3300049578 | Bacteria | 863 |
| 429 | Ga0501043_0013204 | 3300049579 | Bacteria | 6460 |
| 430 | Ga0501043_0021246 | 3300049579 | Bacteria | 5088 |
| 431 | Ga0501043_0044171 | 3300049579 | Bacteria | 3503 |
| 432 | Ga0501043_0091162 | 3300049579 | Bacteria | 2396 |
| 433 | Ga0501043_0139025 | 3300049579 | Bacteria | 1902 |
| 434 | Ga0501043_0263281 | 3300049579 | Bacteria | 1325 |
| 435 | Ga0501046_0007020 | 3300049580 | Bacteria | 9921 |
| 436 | Ga0501046_0016323 | 3300049580 | Bacteria | 6222 |
| 437 | Ga0501046_0018795 | 3300049580 | Bacteria | 5741 |
| 438 | Ga0501047_0006712 | 3300049581 | Bacteria | 10821 |
| 439 | Ga0501047_0010036 | 3300049581 | Bacteria | 8953 |
| 440 | Ga0501047_0010335 | 3300049581 | Bacteria | 8827 |
| 441 | Ga0501047_0041412 | 3300049581 | Bacteria | 4451 |
| 442 | Ga0501047_0043118 | 3300049581 | Bacteria | 4358 |
| 443 | Ga0501047_0164540 | 3300049581 | Bacteria | 2089 |
| 444 | Ga0501047_0230335 | 3300049581 | Bacteria | 1706 |
| 445 | Ga0501047_0282473 | 3300049581 | Bacteria | 1504 |
| 446 | Ga0501048_0008758 | 3300049582 | Bacteria | 7624 |
| 447 | Ga0501067_0068932 | 3300049583 | Bacteria | 1959 |
| 448 | Ga0501069_0067808 | 3300049585 | Bacteria | 1996 |
| 449 | Ga0501070_0000088 | 3300049586 | Bacteria | 77423 |
| 450 | Ga0501070_0016947 | 3300049586 | Bacteria | 6114 |
| 451 | Ga0501070_0091215 | 3300049586 | Bacteria | 2522 |
| 452 | Ga0501071_0000422 | 3300049587 | Bacteria | 21099 |
| 453 | Ga0501073_0004953 | 3300049589 | Bacteria | 9993 |
| 454 | Ga0501073_0090958 | 3300049589 | Bacteria | 2121 |
| 455 | Ga0501073_0146193 | 3300049589 | Bacteria | 1638 |
| 456 | Ga0501073_0250990 | 3300049589 | Bacteria | 1221 |
| 457 | Ga0501074_0073678 | 3300049590 | Bacteria | 2453 |
| 458 | Ga0501080_0048351 | 3300049742 | Bacteria | 3959 |
| 459 | Ga0501080_0204660 | 3300049742 | Bacteria | 1811 |
| 460 | Ga0501083_0000052 | 3300049744 | Bacteria | 84349 |
| 461 | Ga0501083_0215903 | 3300049744 | Bacteria | 1250 |
| 462 | Ga0501035_0005181 | 3300049822 | Bacteria | 12332 |
| 463 | Ga0501035_0056307 | 3300049822 | Bacteria | 3508 |
| 464 | Ga0501035_0060074 | 3300049822 | Bacteria | 3384 |
| 465 | Ga0501035_0064364 | 3300049822 | Bacteria | 3259 |
| 466 | Ga0501035_0112835 | 3300049822 | Bacteria | 2381 |
| 467 | Ga0501035_0185140 | 3300049822 | Bacteria | 1792 |
| 468 | Ga0501044_0031929 | 3300049823 | Bacteria | 5537 |
| 469 | Ga0501044_0076027 | 3300049823 | Bacteria | 3409 |
| 470 | Ga0501044_0077795 | 3300049823 | Bacteria | 3363 |
| 471 | Ga0501044_0158170 | 3300049823 | Bacteria | 2244 |
| 472 | Ga0501045_0020601 | 3300049824 | Bacteria | 4712 |
| 473 | nmdc:mga00v17_15245_c1 | 3300050491 | Bacteria | 4310 |
| 474 | nmdc:mga0yw44_16278_c1 | 3300050492 | Bacteria | 4013 |
| 475 | nmdc:mga0yw44_26387_c1 | 3300050492 | Bacteria | 3318 |
| 476 | nmdc:mga06z11_29106_c1 | 3300050494 | Bacteria | 2657 |
| 477 | nmdc:mga07m45_127895_c1 | 3300050496 | Bacteria | 1469 |
| 478 | nmdc:mga05p37_210191_c1 | 3300050507 | Bacteria | 2353 |
| 479 | nmdc:mga05p37_9946_c1 | 3300050507 | Bacteria | 11294 |
| 480 | nmdc:mga09592_11_c1 | 3300050508 | Bacteria | 73718 |
| 481 | nmdc:mga0qj67_432383_c1 | 3300050509 | Bacteria | 1061 |
| 482 | nmdc:mga06r32_1205_c1 | 3300050510 | Bacteria | 23293 |
| 483 | nmdc:mga06r32_40772_c1 | 3300050510 | Bacteria | 4409 |
| 484 | nmdc:mga06r32_5_c1 | 3300050510 | Bacteria | 79813 |
| 485 | nmdc:mga06r32_900_c4 | 3300050510 | Bacteria | 7021 |
| 486 | nmdc:mga08y16_236059_c1 | 3300050511 | Bacteria | 1891 |
| 487 | nmdc:mga08y16_61508_c1 | 3300050511 | Bacteria | 3921 |
| 488 | nmdc:mga0n895_16320_c1 | 3300050512 | Bacteria | 6811 |
| 489 | nmdc:mga0rr50_26939_c1 | 3300050513 | Bacteria | 4019 |
| 490 | nmdc:mga0a205_38341_c1 | 3300050515 | Bacteria | 4610 |
| 491 | Ga0500635_0000013 | 3300053080 | Bacteria | 133088 |
| 492 | Ga0495595_0031041 | 3300053084 | Bacteria | 2400 |
| 493 | Ga0495619_0038942 | 3300053085 | Bacteria | 3103 |
| 494 | Ga0500643_000953 | 3300053087 | Bacteria | 18072 |
| 495 | Ga0500651_0000300 | 3300053093 | Bacteria | 28581 |
| 496 | Ga0500562_004538 | 3300053108 | Bacteria | 3507 |
| 497 | Ga0500593_076599 | 3300053117 | Bacteria | 1441 |
| 498 | Ga0500559_0000156 | 3300053136 | Bacteria | 53941 |
| 499 | Ga0500559_0000372 | 3300053136 | Bacteria | 33038 |
| 500 | Ga0500559_0008624 | 3300053136 | Bacteria | 4459 |
| 501 | Ga0500573_0007144 | 3300053140 | Bacteria | 6076 |
| 502 | Ga0500573_0017995 | 3300053140 | Bacteria | 4026 |
| 503 | Ga0500573_0023971 | 3300053140 | Bacteria | 3506 |
| 504 | Ga0500573_0025310 | 3300053140 | Bacteria | 3412 |
| 505 | Ga0500573_0034665 | 3300053140 | Bacteria | 2911 |
| 506 | Ga0500573_0042920 | 3300053140 | Bacteria | 2611 |
| 507 | Ga0500573_0061311 | 3300053140 | Bacteria | 2154 |
| 508 | Ga0500577_0085660 | 3300053142 | Bacteria | 1264 |
| 509 | Ga0500590_004686 | 3300053148 | Bacteria | 6493 |
| 510 | Ga0500616_0084785 | 3300053153 | Bacteria | 1584 |
| 511 | Ga0500620_000060 | 3300053155 | Bacteria | 20194 |
| 512 | Ga0500636_0101218 | 3300053177 | Bacteria | 1638 |
| 513 | 2508675900 | 2508501039 | Bacteria | 9978592 |
| 514 | 2558911457 | 2558860112 | Bacteria | 9931328 |
| 515 | 2587862583 | 2585428094 | Bacteria | 3604039 |
| 516 | 2588108528 | 2585428157 | Bacteria | 3018951 |
| 517 | 2643848267 | 2643221566 | Bacteria | 3460379 |
| 518 | 2643885398 | 2643221575 | Bacteria | 4022601 |
| 519 | 2644095956 | 2643221616 | Bacteria | 4066575 |
| 520 | 2644609196 | 2643221711 | Bacteria | 4865335 |
| 521 | 2676475526 | 2675903058 | Bacteria | 6822861 |
| 522 | 2689956703 | 2687453737 | Bacteria | 11203906 |
| 523 | 2774380346 | 2773857758 | Bacteria | 3592392 |
| 524 | 2774848612 | 2773857921 | Bacteria | 9435764 |
| 525 | 2784472516 | 2784132109 | Bacteria | 3141763 |
| 526 | 2808874713 | 2808606365 | Bacteria | 4301966 |
| 527 | 2808885665 | 2808606368 | Bacteria | 3174172 |
| 528 | 2812374325 | 2811994882 | Bacteria | 4688362 |
| 529 | 2816424707 | 2816332119 | Bacteria | 8120218 |
| 530 | 2819427056 | 2818991318 | Bacteria | 5266538 |
| 531 | 2819666048 | 2818991458 | Bacteria | 4794049 |
| 532 | 2819692475 | 2818991462 | Bacteria | 4320267 |
| 533 | 2819728716 | 2818991469 | Bacteria | 4644110 |
| 534 | 2827631307 | 2827628540 | Bacteria | 6858585 |
| 535 | 2835188957 | 2835188231 | Bacteria | 3476928 |
| 536 | 2837271121 | 2837268691 | Bacteria | 7850704 |
| 537 | 2844842361 | 2844841374 | Bacteria | 3917147 |
| 538 | 2852634222 | 2852632344 | Bacteria | 3463163 |
| 539 | 2852645680 | 2852643534 | Bacteria | 3013378 |
| 540 | 2857484105 | 2857481737 | Bacteria | 4761446 |
| 541 | 2857728394 | 2857727296 | Bacteria | 2745552 |
| 542 | 2862995848 | 2862993130 | Bacteria | 3860849 |
| 543 | 2868091252 | 2868088558 | Bacteria | 7609351 |
| 544 | 2870623779 | 2870622029 | Bacteria | 3643329 |
| 545 | 2870630378 | 2870628048 | Bacteria | 3696012 |
| 546 | 2870784256 | 2870782633 | Bacteria | 9624083 |
| 547 | 2884765319 | 2884763398 | Bacteria | 4091164 |
| 548 | 2887446309 | 2887443736 | Bacteria | 4426037 |
| 549 | 2908680887 | 2908678064 | Bacteria | 3482747 |
| 550 | 2915358431 | 2915358134 | Bacteria | 6050864 |
| 551 | 2919058009 | 2919055335 | Bacteria | 3875751 |
| 552 | 2919071563 | 2919069694 | Bacteria | 3622919 |
| 553 | 2919447030 | 2919446982 | Bacteria | 3994487 |
| 554 | 2919524402 | 2919523602 | Bacteria | 3788128 |
| 555 | 2920883751 | 2920879853 | Bacteria | 4216831 |
| 556 | 2928123214 | 2928121344 | Bacteria | 3972376 |
| 557 | 2928155976 | 2928153084 | Bacteria | 4020257 |
| 558 | 2939658270 | 2939657138 | Bacteria | 3740283 |
| 559 | 2939664013 | 2939660829 | Bacteria | 3784848 |
| 560 | 2946080767 | 2946080515 | Bacteria | 4310960 |
| 561 | 2964329477 | 2964326757 | Bacteria | 3290868 |
| 562 | 2966922340 | 2966921586 | Bacteria | 3092803 |
| 563 | 2966925023 | 2966924647 | Bacteria | 3268643 |
| 564 | 3003003001 | 3002998708 | Bacteria | 11715108 |
| 565 | 8002775492 | 8002775197 | Bacteria | 10728764 |
| 566 | 8004214347 | 8004212874 | Bacteria | 2861420 |
| 567 | 8056039516 | 8056037122 | Bacteria | 3854319 |
| 568 | Ga0081455_10004075 | |||
| 569 | JGI24735J21928_10016514 | |||
| 570 | JGI25164J39214_1002166 | |||
| 571 | JGI25165J46597_1000002 | |||
| 572 | Ga0006562J51391_1028901 | |||
| 573 | Ga0006562J51391_1028902 | |||
| 574 | Ga0006562J51391_1039029 | |||
| 575 | Ga0006562J51391_1169475 | |||
| 576 | Ga0006562J51391_1169476 | |||
| 577 | Ga0055539_1000008 | |||
| 578 | Ga0055533_1000001 | |||
| 579 | Ga0055525_1000221 | |||
| 580 | Ga0055525_1000365 | |||
| 581 | Ga0055527_1000001 | |||
| 582 | Ga0055529_1000018 | |||
| 583 | Ga0055541_1009324 | |||
| 584 | Ga0070658_10000833 | |||
| 585 | Ga0070658_10075378 | |||
| 586 | Ga0070658_10121672 | |||
| 587 | Ga0070658_10168885 | |||
| 588 | Ga0070683_100013636 | |||
| 589 | Ga0070682_100164986 | |||
| 590 | Ga0068868_100029730 | |||
| 591 | Ga0070660_100133225 | |||
| 592 | Ga0070661_100068570 | |||
| 593 | Ga0070668_100313524 | |||
| 594 | Ga0070659_100014108 | |||
| 595 | Ga0070659_100409250 | |||
| 596 | Ga0070659_100432560 | |||
| 597 | Ga0070667_100027561 | |||
| 598 | Ga0070705_100125586 | |||
| 599 | Ga0070663_100003571 | |||
| 600 | Ga0070663_100281656 | |||
| 601 | Ga0070681_10395661 | |||
| 602 | Ga0070679_100428066 | |||
| 603 | Ga0068853_100028944 | |||
| 604 | Ga0070672_100049351 | |||
| 605 | Ga0070693_100034918 | |||
| 606 | Ga0068855_100023298 | |||
| 607 | Ga0068855_100226576 | |||
| 608 | Ga0068857_100124317 | |||
| 609 | Ga0068856_100017184 | |||
| 610 | Ga0068856_100026572 | |||
| 611 | Ga0068856_100121478 | |||
| 612 | Ga0068856_100376118 | |||
| 613 | Ga0070702_100002838 | |||
| 614 | Ga0068852_100006614 | |||
| 615 | Ga0068852_100024812 | |||
| 616 | Ga0068852_100057001 | |||
| 617 | Ga0068852_100110180 | |||
| 618 | Ga0068864_100023638 | |||
| 619 | Ga0068864_100367238 | |||
| 620 | Ga0068861_100907337 | |||
| 621 | Ga0068851_10000003 | |||
| 622 | Ga0068863_100018229 | |||
| 623 | Ga0068863_100380195 | |||
| 624 | Ga0068858_100014735 | |||
| 625 | Ga0068862_100001933 | |||
| 626 | Ga0081455_10000363 | |||
| 627 | Ga0081455_10076616 | |||
| 628 | Ga0081538_10116964 | |||
| 629 | Ga0075365_10000821 | |||
| 630 | Ga0075365_10017154 | |||
| 631 | Ga0075363_100068619 | |||
| 632 | Ga0075364_10005149 | |||
| 633 | Ga0070715_10009957 | |||
| 634 | Ga0070716_100001544 | |||
| 635 | Ga0075367_10018787 | |||
| 636 | Ga0075431_100486470 | |||
| 637 | Ga0075429_100006527 | |||
| 638 | Ga0068865_100038939 | |||
| 639 | Ga0097620_100000357 | |||
| 640 | Ga0105240_10006064 | |||
| 641 | Ga0105240_10060054 | |||
| 642 | Ga0105240_10296905 | |||
| 643 | Ga0111539_10010636 | |||
| 644 | Ga0105245_10149847 | |||
| 645 | Ga0105245_10467955 | |||
| 646 | Ga0105247_10090946 | |||
| 647 | Ga0105247_10531272 | |||
| 648 | Ga0114129_10010043 | |||
| 649 | Ga0105241_10001064 | |||
| 650 | Ga0105242_10023921 | |||
| 651 | Ga0105242_10379007 | |||
| 652 | Ga0105242_10566617 | |||
| 653 | Ga0105248_10001478 | |||
| 654 | Ga0105248_10003592 | |||
| 655 | Ga0105248_10315030 | |||
| 656 | Ga0105237_10000131 | |||
| 657 | Ga0105237_10052484 | |||
| 658 | Ga0105237_10081585 | |||
| 659 | Ga0105238_10420233 | |||
| 660 | Ga0105249_10046438 | |||
| 661 | Ga0105249_10776647 | |||
| 662 | Ga0105239_10039388 | |||
| 663 | Ga0105239_10394648 | |||
| 664 | Ga0105239_10396574 | |||
| 665 | Ga0157370_10040504 | |||
| 666 | Ga0157369_10015044 | |||
| 667 | Ga0157369_10046604 | |||
| 668 | Ga0157369_10548092 | |||
| 669 | Ga0157374_10384569 | |||
| 670 | Ga0163162_10027684 | |||
| 671 | Ga0163162_10659700 | |||
| 672 | Ga0157372_10059728 | |||
| 673 | Ga0157372_10398338 | |||
| 674 | Ga0157372_10488787 | |||
| 675 | Ga0163163_10012121 | |||
| 676 | Ga0157380_10123667 | |||
| 677 | Ga0157380_10168720 | |||
| 678 | Ga0157379_10000058 | |||
| 679 | Ga0157379_10017991 | |||
| 680 | Ga0157376_10163493 | |||
| 681 | Ga0163161_10172108 | |||
| 682 | Ga0163161_10495716 | |||
| 683 | Ga0206353_10742524 | |||
| 684 | Ga0206353_11120836 | |||
| 685 | Ga0206353_11696786 | |||
| 686 | Ga0206353_11704794 | |||
| 687 | Ga0209566_100026 | |||
| 688 | Ga0209674_100001 | |||
| 689 | Ga0209672_100006 | |||
| 690 | Ga0209147_100868 | |||
| 691 | Ga0209563_100001 | |||
| 692 | Ga0209563_100461 | |||
| 693 | Ga0207427_100329 | |||
| 694 | Ga0209437_100739 | |||
| 695 | Ga0209677_100001 | |||
| 696 | Ga0209677_100523 | |||
| 697 | Ga0209148_1000015 | |||
| 698 | Ga0209148_1000828 | |||
| 699 | Ga0209233_1000001 | |||
| 700 | Ga0209233_1013893 | |||
| 701 | Ga0209455_1000013 | |||
| 702 | Ga0209455_1000979 | |||
| 703 | Ga0209455_1019341 | |||
| 704 | Ga0207656_10000002 | |||
| 705 | Ga0207692_10344603 | |||
| 706 | Ga0207647_10015825 | |||
| 707 | Ga0207647_10044805 | |||
| 708 | Ga0207685_10024569 | |||
| 709 | Ga0207705_10000006 | |||
| 710 | Ga0207705_10025267 | |||
| 711 | Ga0207705_10082199 | |||
| 712 | Ga0207705_10293633 | |||
| 713 | Ga0207654_10000001 | |||
| 714 | Ga0207707_10000220 | |||
| 715 | Ga0207695_10006059 | |||
| 716 | Ga0207695_10025529 | |||
| 717 | Ga0207671_10000002 | |||
| 718 | Ga0207671_10024829 | |||
| 719 | Ga0207671_10026815 | |||
| 720 | Ga0207693_10001931 | |||
| 721 | Ga0207660_10000997 | |||
| 722 | Ga0207662_10057162 | |||
| 723 | Ga0207657_10025274 | |||
| 724 | Ga0207657_10088806 | |||
| 725 | Ga0207649_10017423 | |||
| 726 | Ga0207652_10000471 | |||
| 727 | Ga0207652_10160407 | |||
| 728 | Ga0207694_10000092 | |||
| 729 | Ga0207694_10163248 | |||
| 730 | Ga0207650_10227902 | |||
| 731 | Ga0207659_10436179 | |||
| 732 | Ga0207687_10084305 | |||
| 733 | Ga0207687_10111005 | |||
| 734 | Ga0207687_10231320 | |||
| 735 | Ga0207664_10014767 | |||
| 736 | Ga0207664_10147835 | |||
| 737 | Ga0207690_10001146 | |||
| 738 | Ga0207690_10175044 | |||
| 739 | Ga0207706_10324820 | |||
| 740 | Ga0207665_10000952 | |||
| 741 | Ga0207691_10060547 | |||
| 742 | Ga0207711_10000060 | |||
| 743 | Ga0207711_10004780 | |||
| 744 | Ga0207711_10004873 | |||
| 745 | Ga0207711_10080057 | |||
| 746 | Ga0207661_10058908 | |||
| 747 | Ga0207661_10102850 | |||
| 748 | Ga0207667_10006393 | |||
| 749 | Ga0207667_10014728 | |||
| 750 | Ga0207712_10017638 | |||
| 751 | Ga0207712_10149101 | |||
| 752 | Ga0207668_10696407 | |||
| 753 | Ga0207658_10009467 | |||
| 754 | Ga0207658_10164439 | |||
| 755 | Ga0207677_10020532 | |||
| 756 | Ga0207677_10508549 | |||
| 757 | Ga0207703_10000009 | |||
| 758 | Ga0207703_10000031 | |||
| 759 | Ga0207703_10208222 | |||
| 760 | Ga0207639_10033026 | |||
| 761 | Ga0207639_10260722 | |||
| 762 | Ga0207678_10085543 | |||
| 763 | Ga0207678_10102979 | |||
| 764 | Ga0207678_10534638 | |||
| 765 | Ga0207678_10924990 | |||
| 766 | Ga0207708_10242050 | |||
| 767 | Ga0207702_10070091 | |||
| 768 | Ga0207702_10110798 | |||
| 769 | Ga0207702_10189466 | |||
| 770 | Ga0207641_10003481 | |||
| 771 | Ga0207648_10080635 | |||
| 772 | Ga0207674_10004399 | |||
| 773 | Ga0207674_10033183 | |||
| 774 | Ga0207674_10105779 | |||
| 775 | Ga0207674_10107019 | |||
| 776 | Ga0207674_10152334 | |||
| 777 | Ga0207674_10480524 | |||
| 778 | Ga0207675_100009028 | |||
| 779 | Ga0207683_10033049 | |||
| 780 | Ga0207683_10084642 | |||
| 781 | Ga0207698_10000277 | |||
| 782 | Ga0207698_10056228 | |||
| 783 | Ga0207698_10057880 | |||
| 784 | Ga0207698_10115846 | |||
| 785 | Ga0207698_10161729 | |||
| 786 | Ga0268265_10000024 | |||
| 787 | Ga0265338_10079749 | |||
| 788 | Ga0265330_10102461 | |||
| 789 | Ga0265325_10011674 | |||
| 790 | Ga0265340_10044478 | |||
| 791 | Ga0307514_10056760 | |||
| 792 | Ga0316579_10004999 | |||
| 793 | Ga0316579_10014531 | |||
| 794 | Ga0265314_10051789 | |||
| 795 | Ga0265342_10037249 | |||
| 796 | Ga0316576_10000788 | |||
| 797 | Ga0316576_10010618 | |||
| 798 | Ga0316576_10047287 | |||
| 799 | Ga0316578_10001133 | |||
| 800 | Ga0316578_10002828 | |||
| 801 | Ga0316577_10003953 | |||
| 802 | Ga0316577_10193902 | |||
| 803 | Ga0307413_10411219 | |||
| 804 | Ga0307410_10015490 | |||
| 805 | Ga0307406_10000833 | |||
| 806 | Ga0307407_10035365 | |||
| 807 | Ga0307409_100056726 | |||
| 808 | Ga0307409_100446300 | |||
| 809 | Ga0307409_100774845 | |||
| 810 | Ga0307416_100051319 | |||
| 811 | Ga0307416_100060492 | |||
| 812 | Ga0307414_10425427 | |||
| 813 | Ga0316583_10010540 | |||
| 814 | Ga0316583_10056409 | |||
| 815 | Ga0316585_10003151 | |||
| 816 | Ga0316585_10040948 | |||
| 817 | Ga0316580_10004593 | |||
| 818 | Ga0316580_10004781 | |||
| 819 | Ga0373956_0002961 | |||
| 820 | Ga0316574_0014337 | |||
| 821 | Ga0316574_0042442 | |||
| 822 | Ga0316574_0089402 | |||
| 823 | Ga0373931_0100571 | |||
| 824 | Ga0316582_0015780 | |||
| 825 | Ga0316584_0013835 | |||
| 826 | Ga0316584_0022197 | |||
| 827 | Ga0316584_0047693 | |||
| 828 | Ga0395899_0000786 | |||
| 829 | Ga0395900_0012475 | |||
| 830 | Ga0395900_0120195 | |||
| 831 | Ga0395900_0363044 | |||
| 832 | Ga0395900_0488961 | |||
| 833 | Ga0395898_0000752 | |||
| 834 | Ga0395898_0032253 | |||
| 835 | Ga0395898_0128878 | |||
| 836 | Ga0395905_0022729 | |||
| 837 | Ga0436364_0514406 | |||
| 838 | Ga0395901_0000920 | |||
| 839 | Ga0395901_0013301 | |||
| 840 | Ga0395901_0146054 | |||
| 841 | Ga0395901_0189658 | |||
| 842 | Ga0395901_0246637 | |||
| 843 | Ga0395901_0397633 | |||
| 844 | Ga0395901_0525919 | |||
| 845 | Ga0451847_0757701 | |||
| 846 | Ga0451853_4030682 | |||
| 847 | Ga0466972_0046432 | |||
| 848 | Ga0466965_0000002 | |||
| 849 | Ga0466965_0008852 | |||
| 850 | Ga0466965_0061679 | |||
| 851 | Ga0466965_0079457 | |||
| 852 | Ga0466965_0136936 | |||
| 853 | Ga0466965_0193558 | |||
| 854 | Ga0466966_0037291 | |||
| 855 | Ga0466966_0216302 | |||
| 856 | Ga0466961_0086236 | |||
| 857 | Ga0466961_0141798 | |||
| 858 | Ga0466961_0398898 | |||
| 859 | Ga0466963_0192750 | |||
| 860 | Ga0466963_0238085 | |||
| 861 | Ga0466963_0385502 | |||
| 862 | Ga0466971_0011351 | |||
| 863 | Ga0466971_0020548 | |||
| 864 | Ga0466970_0028362 | |||
| 865 | Ga0466970_0031042 | |||
| 866 | Ga0466957_0072866 | |||
| 867 | Ga0466957_0073490 | |||
| 868 | Ga0466957_0081118 | |||
| 869 | Ga0466957_0081347 | |||
| 870 | Ga0466957_0211079 | |||
| 871 | Ga0466957_0452020 | |||
| 872 | Ga0466960_0031771 | |||
| 873 | Ga0466960_0050687 | |||
| 874 | Ga0466960_0124266 | |||
| 875 | Ga0466959_0006345 | |||
| 876 | Ga0466959_0060247 | |||
| 877 | Ga0466959_0060679 | |||
| 878 | Ga0466967_0136969 | |||
| 879 | Ga0466967_0575049 | |||
| 880 | Ga0466967_0666756 | |||
| 881 | Ga0495638_0035399 | |||
| 882 | Ga0495638_0303961 | |||
| 883 | Ga0495653_0108869 | |||
| 884 | Ga0495650_0001330 | |||
| 885 | Ga0495664_0286059 | |||
| 886 | Ga0495631_0078123 | |||
| 887 | Ga0495644_0065000 | |||
| 888 | Ga0495648_0050573 | |||
| 889 | Ga0495645_0133853 | |||
| 890 | Ga0495674_0140275 | |||
| 891 | Ga0495672_0223123 | |||
| 892 | Ga0495680_0407044 | |||
| 893 | Ga0496100_0057068 | |||
| 894 | Ga0496100_0210644 | |||
| 895 | Ga0496101_0006557 | |||
| 896 | Ga0496101_0064501 | |||
| 897 | Ga0496102_0004392 | |||
| 898 | Ga0496102_0090718 | |||
| 899 | Ga0496102_0162231 | |||
| 900 | Ga0496103_0024681 | |||
| 901 | Ga0496104_0034030 | |||
| 902 | Ga0496104_0084071 | |||
| 903 | Ga0496104_0149351 | |||
| 904 | Ga0496104_0355653 | |||
| 905 | Ga0496104_0371191 | |||
| 906 | Ga0496105_0004765 | |||
| 907 | Ga0496105_0016210 | |||
| 908 | Ga0496105_0066952 | |||
| 909 | Ga0496105_0083622 | |||
| 910 | Ga0496105_0155160 | |||
| 911 | Ga0496106_0204881 | |||
| 912 | Ga0496107_0192175 | |||
| 913 | Ga0496107_0401191 | |||
| 914 | Ga0496108_0284483 | |||
| 915 | Ga0496109_0045917 | |||
| 916 | Ga0496109_0342580 | |||
| 917 | Ga0496110_0047567 | |||
| 918 | Ga0496110_0083055 | |||
| 919 | Ga0496111_0118286 | |||
| 920 | Ga0496112_0623162 | |||
| 921 | Ga0496113_0106604 | |||
| 922 | Ga0496113_0184726 | |||
| 923 | Ga0496113_0421628 | |||
| 924 | Ga0496114_0006381 | |||
| 925 | Ga0496114_0015458 | |||
| 926 | Ga0496114_0022079 | |||
| 927 | Ga0496114_0080488 | |||
| 928 | Ga0496114_0216726 | |||
| 929 | Ga0496115_0010135 | |||
| 930 | Ga0496115_0032163 | |||
| 931 | Ga0496115_0055536 | |||
| 932 | Ga0496115_0073801 | |||
| 933 | Ga0496117_0000235 | |||
| 934 | Ga0496117_0010509 | |||
| 935 | Ga0496117_0015928 | |||
| 936 | Ga0496117_0022233 | |||
| 937 | Ga0496117_0026168 | |||
| 938 | Ga0496117_0029945 | |||
| 939 | Ga0496118_0007162 | |||
| 940 | Ga0496118_0008668 | |||
| 941 | Ga0496118_0009005 | |||
| 942 | Ga0496118_0023094 | |||
| 943 | Ga0496118_0036549 | |||
| 944 | Ga0496119_0004965 | |||
| 945 | Ga0496119_0007470 | |||
| 946 | Ga0496119_0015874 | |||
| 947 | Ga0496119_0018367 | |||
| 948 | Ga0496120_0000655 | |||
| 949 | Ga0496120_0030306 | |||
| 950 | Ga0496120_0040968 | |||
| 951 | Ga0496121_0000277 | |||
| 952 | Ga0496122_0000200 | |||
| 953 | Ga0496122_0000360 | |||
| 954 | Ga0496122_0043308 | |||
| 955 | Ga0496123_0000076 | |||
| 956 | Ga0496123_0002417 | |||
| 957 | Ga0496124_0018523 | |||
| 958 | Ga0496124_0125943 | |||
| 959 | Ga0496126_0014990 | |||
| 960 | Ga0496126_0033121 | |||
| 961 | Ga0496126_0057518 | |||
| 962 | Ga0496126_0074598 | |||
| 963 | Ga0496126_0107727 | |||
| 964 | Ga0501031_0009585 | |||
| 965 | Ga0501031_0065675 | |||
| 966 | Ga0501032_0002800 | |||
| 967 | Ga0501032_0006994 | |||
| 968 | Ga0501032_0017933 | |||
| 969 | Ga0501032_0069724 | |||
| 970 | Ga0501032_0085237 | |||
| 971 | Ga0501033_0007753 | |||
| 972 | Ga0501033_0012915 | |||
| 973 | Ga0501033_0060490 | |||
| 974 | Ga0501033_0162805 | |||
| 975 | Ga0501034_0022284 | |||
| 976 | Ga0501034_0024988 | |||
| 977 | Ga0501034_0078018 | |||
| 978 | Ga0501036_0017172 | |||
| 979 | Ga0501036_0248761 | |||
| 980 | Ga0501037_0006742 | |||
| 981 | Ga0501037_0021415 | |||
| 982 | Ga0501037_0038611 | |||
| 983 | Ga0501037_0066006 | |||
| 984 | Ga0501037_0089882 | |||
| 985 | Ga0501037_0166930 | |||
| 986 | Ga0501038_0033875 | |||
| 987 | Ga0501038_0038126 | |||
| 988 | Ga0501038_0038199 | |||
| 989 | Ga0501038_0071682 | |||
| 990 | Ga0501039_0153251 | |||
| 991 | Ga0501039_0167174 | |||
| 992 | Ga0501039_0449193 | |||
| 993 | Ga0501042_0042640 | |||
| 994 | Ga0501042_0043943 | |||
| 995 | Ga0501042_0521754 | |||
| 996 | Ga0501043_0013204 | |||
| 997 | Ga0501043_0021246 | |||
| 998 | Ga0501043_0044171 | |||
| 999 | Ga0501043_0091162 | |||
| 1000 | Ga0501043_0139025 | |||
| 1001 | Ga0501043_0263281 | |||
| 1002 | Ga0501046_0007020 | |||
| 1003 | Ga0501046_0016323 | |||
| 1004 | Ga0501046_0018795 | |||
| 1005 | Ga0501047_0006712 | |||
| 1006 | Ga0501047_0010036 | |||
| 1007 | Ga0501047_0010335 | |||
| 1008 | Ga0501047_0041412 | |||
| 1009 | Ga0501047_0043118 | |||
| 1010 | Ga0501047_0164540 | |||
| 1011 | Ga0501047_0230335 | |||
| 1012 | Ga0501047_0282473 | |||
| 1013 | Ga0501048_0008758 | |||
| 1014 | Ga0501067_0068932 | |||
| 1015 | Ga0501069_0067808 | |||
| 1016 | Ga0501070_0000088 | |||
| 1017 | Ga0501070_0016947 | |||
| 1018 | Ga0501070_0091215 | |||
| 1019 | Ga0501071_0000422 | |||
| 1020 | Ga0501073_0004953 | |||
| 1021 | Ga0501073_0090958 | |||
| 1022 | Ga0501073_0146193 | |||
| 1023 | Ga0501073_0250990 | |||
| 1024 | Ga0501074_0073678 | |||
| 1025 | Ga0501080_0048351 | |||
| 1026 | Ga0501080_0204660 | |||
| 1027 | Ga0501083_0000052 | |||
| 1028 | Ga0501083_0215903 | |||
| 1029 | Ga0501035_0005181 | |||
| 1030 | Ga0501035_0056307 | |||
| 1031 | Ga0501035_0060074 | |||
| 1032 | Ga0501035_0064364 | |||
| 1033 | Ga0501035_0112835 | |||
| 1034 | Ga0501035_0185140 | |||
| 1035 | Ga0501044_0031929 | |||
| 1036 | Ga0501044_0076027 | |||
| 1037 | Ga0501044_0077795 | |||
| 1038 | Ga0501044_0158170 | |||
| 1039 | Ga0501045_0020601 | |||
| 1040 | nmdc:mga00v17_15245_c1 | |||
| 1041 | nmdc:mga0yw44_16278_c1 | |||
| 1042 | nmdc:mga0yw44_26387_c1 | |||
| 1043 | nmdc:mga06z11_29106_c1 | |||
| 1044 | nmdc:mga07m45_127895_c1 | |||
| 1045 | nmdc:mga05p37_210191_c1 | |||
| 1046 | nmdc:mga05p37_9946_c1 | |||
| 1047 | nmdc:mga09592_11_c1 | |||
| 1048 | nmdc:mga0qj67_432383_c1 | |||
| 1049 | nmdc:mga06r32_1205_c1 | |||
| 1050 | nmdc:mga06r32_40772_c1 | |||
| 1051 | nmdc:mga06r32_5_c1 | |||
| 1052 | nmdc:mga06r32_900_c4 | |||
| 1053 | nmdc:mga08y16_236059_c1 | |||
| 1054 | nmdc:mga08y16_61508_c1 | |||
| 1055 | nmdc:mga0n895_16320_c1 | |||
| 1056 | nmdc:mga0rr50_26939_c1 | |||
| 1057 | nmdc:mga0a205_38341_c1 | |||
| 1058 | Ga0500635_0000013 | |||
| 1059 | Ga0495595_0031041 | |||
| 1060 | Ga0495619_0038942 | |||
| 1061 | Ga0500643_000953 | |||
| 1062 | Ga0500651_0000300 | |||
| 1063 | Ga0500562_004538 | |||
| 1064 | Ga0500593_076599 | |||
| 1065 | Ga0500559_0000156 | |||
| 1066 | Ga0500559_0000372 | |||
| 1067 | Ga0500559_0008624 | |||
| 1068 | Ga0500573_0007144 | |||
| 1069 | Ga0500573_0017995 | |||
| 1070 | Ga0500573_0023971 | |||
| 1071 | Ga0500573_0025310 | |||
| 1072 | Ga0500573_0034665 | |||
| 1073 | Ga0500573_0042920 | |||
| 1074 | Ga0500573_0061311 | |||
| 1075 | Ga0500577_0085660 | |||
| 1076 | Ga0500590_004686 | |||
| 1077 | Ga0500616_0084785 | |||
| 1078 | Ga0500620_000060 | |||
| 1079 | Ga0500636_0101218 | |||
| 1080 | 2508675900 | |||
| 1081 | 2558911457 | |||
| 1082 | 2587862583 | |||
| 1083 | 2588108528 | |||
| 1084 | 2643848267 | |||
| 1085 | 2643885398 | |||
| 1086 | 2644095956 | |||
| 1087 | 2644609196 | |||
| 1088 | 2676475526 | |||
| 1089 | 2689956703 | |||
| 1090 | 2774380346 | |||
| 1091 | 2774848612 | |||
| 1092 | 2784472516 | |||
| 1093 | 2808874713 | |||
| 1094 | 2808885665 | |||
| 1095 | 2812374325 | |||
| 1096 | 2816424707 | |||
| 1097 | 2819427056 | |||
| 1098 | 2819666048 | |||
| 1099 | 2819692475 | |||
| 1100 | 2819728716 | |||
| 1101 | 2827631307 | |||
| 1102 | 2835188957 | |||
| 1103 | 2837271121 | |||
| 1104 | 2844842361 | |||
| 1105 | 2852634222 | |||
| 1106 | 2852645680 | |||
| 1107 | 2857484105 | |||
| 1108 | 2857728394 | |||
| 1109 | 2862995848 | |||
| 1110 | 2868091252 | |||
| 1111 | 2870623779 | |||
| 1112 | 2870630378 | |||
| 1113 | 2870784256 | |||
| 1114 | 2884765319 | |||
| 1115 | 2887446309 | |||
| 1116 | 2908680887 | |||
| 1117 | 2915358431 | |||
| 1118 | 2919058009 | |||
| 1119 | 2919071563 | |||
| 1120 | 2919447030 | |||
| 1121 | 2919524402 | |||
| 1122 | 2920883751 | |||
| 1123 | 2928123214 | |||
| 1124 | 2928155976 | |||
| 1125 | 2939658270 | |||
| 1126 | 2939664013 | |||
| 1127 | 2946080767 | |||
| 1128 | 2964329477 | |||
| 1129 | 2966922340 | |||
| 1130 | 2966925023 | |||
| 1131 | 3003003001 | |||
| 1132 | 8002775492 | |||
| 1133 | 8004214347 | |||
| 1134 | 8056039516 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4onc-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 | 0.9737 | 20 | 257 |
| 4onc-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 | 0.9684 | 20 | 261 |
| 7cpn-assembly2.cif.gz_D | crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca | 0.9653 | 24 | 254 |
| 2vg3-assembly1.cif.gz_A | rv2361 with citronellyl pyrophosphate | 0.9617 | 20 | 261 |
| 7cpn-assembly2.cif.gz_D | crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca | 0.9568 | 24 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vg2A01 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9694 | 20 | 254 | 3.40.1180.10 |
| 5hc7A00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9604 | 31 | 254 | 3.40.1180.10 |
| af_O14171_12_259_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9513 | 32 | 252 | 3.40.1180.10 |
| 5hxoA00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9506 | 33 | 254 | 3.40.1180.10 |
| af_Q5FC21_4_262_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9496 | 32 | 252 | 3.40.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3IRB1-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9943 | 41 | 162 |
GO:0000287
GO:0005829 GO:0005886 GO:0008834 GO:0016094 GO:0030145 GO:0033850 GO:0045547 |
| AF-A0A7K0Z2S2-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9879 | 40 | 207 |
GO:0000287
GO:0005829 GO:0005886 GO:0008834 GO:0016094 GO:0030145 GO:0033850 GO:0045547 |
| AF-A0A6B3IRB1-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9863 | 41 | 162 |
GO:0000287
GO:0005829 GO:0005886 GO:0008834 GO:0016094 GO:0030145 GO:0033850 GO:0045547 |
| AF-A0A382VUM9-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.9827 | 33 | 166 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0045547 |
| AF-A0A519WDT9-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9776 | 32 | 202 |
GO:0008834
GO:0016094 GO:0045547 |