F464498

General Info

Members Datasets Scaffolds Average Seq Length
567 296 557 74

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10015848|Ga0075364_100158486
Length 86
Sequence MMTNDDLALPALPAPVGAGVFNVYTGAEMGAAAGTVIPTAAQLGLEPPRFCAECGRRMIVQVRPTGWWAKCSRHGQVDSTDLDTQR

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
6 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
7 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
8 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
9 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
10 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
204 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
290 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.17
Nodule 0
Rhizoplane 8.11
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10149906 3300001989 Bacteria 690
2 JGI24743J22301_10013785 3300001991 Bacteria 1484
3 JGI24743J22301_10026481 3300001991 Bacteria 1129
4 JGI24750J21931_1064298 3300002070 Bacteria 591
5 JGI24745J21846_1005539 3300002073 Bacteria 1380
6 JGI24745J21846_1023849 3300002073 Bacteria 725
7 JGI24748J21848_1003107 3300002074 Bacteria 1894
8 JGI24738J21930_10031244 3300002075 Bacteria 1086
9 JGI24749J21850_1036210 3300002076 Bacteria 716
10 JGI24744J21845_10000326 3300002077 Bacteria 7991
11 JGI24744J21845_10007820 3300002077 Bacteria 2208
12 JGI24034J26672_10002872 3300002239 Bacteria 2381
13 JGI24034J26672_10065718 3300002239 Bacteria 643
14 JGI24034J26672_10109193 3300002239 Bacteria 527
15 JGI24742J22300_10034482 3300002244 Bacteria 891
16 JGI24742J22300_10035213 3300002244 Bacteria 883
17 Ga0070676_10005389 3300005328 Bacteria 6815
18 Ga0070690_100093070 3300005330 Bacteria 1988
19 Ga0070677_10277549 3300005333 Bacteria 843
20 Ga0068869_100022937 3300005334 Bacteria 4305
21 Ga0068869_100304569 3300005334 Bacteria 1288
22 Ga0068869_101962096 3300005334 Bacteria 525
23 Ga0070666_10070086 3300005335 Bacteria 2385
24 Ga0070666_10571337 3300005335 Bacteria 824
25 Ga0070680_100346574 3300005336 Bacteria 1263
26 Ga0070682_100073685 3300005337 Bacteria 2191
27 Ga0070682_100908613 3300005337 Bacteria 724
28 Ga0068868_100005485 3300005338 Bacteria 8923
29 Ga0070660_100340161 3300005339 Bacteria 1235
30 Ga0070660_100440923 3300005339 Bacteria 1080
31 Ga0070660_100487332 3300005339 Bacteria 1025
32 Ga0070689_100093245 3300005340 Bacteria 2376
33 Ga0070689_102154154 3300005340 Bacteria 511
34 Ga0070691_10001448 3300005341 Bacteria 10161
35 Ga0070691_10036792 3300005341 Bacteria 2308
36 Ga0070661_101358241 3300005344 Bacteria 597
37 Ga0070692_10203194 3300005345 Bacteria 1162
38 Ga0070668_100000568 3300005347 Bacteria 24706
39 Ga0070668_100158634 3300005347 Bacteria 1834
40 Ga0070668_100964326 3300005347 Bacteria 765
41 Ga0070668_101999122 3300005347 Bacteria 535
42 Ga0070668_102214655 3300005347 Bacteria 508
43 Ga0070669_100009018 3300005353 Bacteria 7114
44 Ga0070671_100447989 3300005355 Bacteria 1107
45 Ga0070674_100208716 3300005356 Bacteria 1512
46 Ga0070674_100228360 3300005356 Bacteria 1451
47 Ga0070673_100136666 3300005364 Bacteria 2064
48 Ga0070688_100015882 3300005365 Bacteria 4293
49 Ga0070688_101481042 3300005365 Bacteria 552
50 Ga0070659_100099965 3300005366 Bacteria 2334
51 Ga0070659_100509377 3300005366 Bacteria 1026
52 Ga0070667_100018217 3300005367 Bacteria 5822
53 Ga0070667_100066477 3300005367 Bacteria 3063
54 Ga0070667_100218834 3300005367 Bacteria 1695
55 Ga0070709_11009046 3300005434 Bacteria 662
56 Ga0070714_100043677 3300005435 Bacteria 3792
57 Ga0070714_100234486 3300005435 Bacteria 1692
58 Ga0070714_100399721 3300005435 Bacteria 1298
59 Ga0070714_100582117 3300005435 Bacteria 1074
60 Ga0070714_101695198 3300005435 Bacteria 617
61 Ga0070713_100114593 3300005436 Bacteria 2355
62 Ga0070713_100691974 3300005436 Bacteria 973
63 Ga0070710_10000932 3300005437 Bacteria 13915
64 Ga0070710_10034170 3300005437 Bacteria 2765
65 Ga0070710_10073090 3300005437 Bacteria 1982
66 Ga0070701_10003743 3300005438 Bacteria 6073
67 Ga0070711_100001643 3300005439 Bacteria 12357
68 Ga0070711_100876414 3300005439 Bacteria 765
69 Ga0070705_100073895 3300005440 Bacteria 2070
70 Ga0070705_101444344 3300005440 Bacteria 574
71 Ga0070700_100002582 3300005441 Bacteria 9259
72 Ga0070700_100736146 3300005441 Bacteria 788
73 Ga0070694_100583328 3300005444 Bacteria 899
74 Ga0070663_100094540 3300005455 Bacteria 2220
75 Ga0070663_100383312 3300005455 Bacteria 1145
76 Ga0070678_100070238 3300005456 Bacteria 2617
77 Ga0070678_100103789 3300005456 Bacteria 2209
78 Ga0070678_100255189 3300005456 Bacteria 1472
79 Ga0070678_100378025 3300005456 Bacteria 1225
80 Ga0070662_100539258 3300005457 Bacteria 977
81 Ga0070662_101321408 3300005457 Bacteria 621
82 Ga0068867_100010113 3300005459 Bacteria 6649
83 Ga0068867_101379143 3300005459 Bacteria 653
84 Ga0070685_10218105 3300005466 Bacteria 1248
85 Ga0070697_100167052 3300005536 Bacteria 1861
86 Ga0068853_100010926 3300005539 Bacteria 7359
87 Ga0068853_100360912 3300005539 Bacteria 1353
88 Ga0070672_101695381 3300005543 Bacteria 568
89 Ga0070686_100271670 3300005544 Bacteria 1247
90 Ga0070695_100027005 3300005545 Bacteria 3554
91 Ga0070695_100116189 3300005545 Bacteria 1824
92 Ga0070696_100017971 3300005546 Bacteria 4776
93 Ga0070693_100012592 3300005547 Bacteria 4283
94 Ga0070693_101085200 3300005547 Bacteria 610
95 Ga0070665_100027133 3300005548 Bacteria 5768
96 Ga0070665_100034595 3300005548 Bacteria 5081
97 Ga0070665_102091460 3300005548 Bacteria 571
98 Ga0070704_100012664 3300005549 Bacteria 5218
99 Ga0070704_100368931 3300005549 Bacteria 1216
100 Ga0068855_100039696 3300005563 Bacteria 5588
101 Ga0068855_101779329 3300005563 Bacteria 626
102 Ga0068854_100000704 3300005578 Bacteria 19787
103 Ga0068854_100602011 3300005578 Bacteria 938
104 Ga0068854_101396440 3300005578 Bacteria 633
105 Ga0068856_100269132 3300005614 Bacteria 1720
106 Ga0068856_101855566 3300005614 Bacteria 614
107 Ga0070702_100027914 3300005615 Bacteria 3051
108 Ga0070702_100091423 3300005615 Bacteria 1846
109 Ga0070702_100421505 3300005615 Bacteria 961
110 Ga0070702_101773115 3300005615 Bacteria 515
111 Ga0068852_100080920 3300005616 Bacteria 2882
112 Ga0068852_100094052 3300005616 Bacteria 2688
113 Ga0068859_100005722 3300005617 Bacteria 12646
114 Ga0068859_100198524 3300005617 Bacteria 2090
115 Ga0068859_102217843 3300005617 Bacteria 606
116 Ga0068864_101001874 3300005618 Bacteria 829
117 Ga0068866_10001957 3300005718 Bacteria 8588
118 Ga0068866_10132306 3300005718 Bacteria 1420
119 Ga0068861_100000622 3300005719 Bacteria 20950
120 Ga0068861_100118366 3300005719 Bacteria 2133
121 Ga0068851_10102500 3300005834 Bacteria 1520
122 Ga0068858_100102636 3300005842 Bacteria 2668
123 Ga0068858_100535183 3300005842 Bacteria 1134
124 Ga0068858_100902568 3300005842 Bacteria 864
125 Ga0068860_100013606 3300005843 Bacteria 7976
126 Ga0068860_100344139 3300005843 Bacteria 1466
127 Ga0068860_100417454 3300005843 Bacteria 1329
128 Ga0068860_102788905 3300005843 Bacteria 507
129 Ga0068862_100030020 3300005844 Bacteria 4580
130 Ga0070717_11821895 3300006028 Bacteria 550
131 Ga0075365_10011492 3300006038 Bacteria 5209
132 Ga0075365_10114963 3300006038 Bacteria 1852
133 Ga0075365_10560495 3300006038 Bacteria 808
134 Ga0075365_10673062 3300006038 Bacteria 731
135 Ga0075363_100094957 3300006048 Bacteria 1644
136 Ga0075363_100165959 3300006048 Bacteria 1252
137 Ga0075363_100296835 3300006048 Bacteria 937
138 Ga0075364_10015848 3300006051 Bacteria 4678
139 Ga0075364_10049989 3300006051 Bacteria 2728
140 Ga0075364_10213810 3300006051 Bacteria 1308
141 Ga0075364_10288613 3300006051 Bacteria 1116
142 Ga0075364_10655135 3300006051 Bacteria 717
143 Ga0070715_10066647 3300006163 Bacteria 1597
144 Ga0070716_100008355 3300006173 Bacteria 5135
145 Ga0070716_100352951 3300006173 Bacteria 1042
146 Ga0070716_100543756 3300006173 Bacteria 865
147 Ga0070716_100686072 3300006173 Bacteria 781
148 Ga0070712_100017986 3300006175 Bacteria 4583
149 Ga0070712_100098504 3300006175 Bacteria 2156
150 Ga0075362_10007434 3300006177 Bacteria 4150
151 Ga0075369_10058053 3300006186 Bacteria 1685
152 Ga0075369_10064045 3300006186 Bacteria 1609
153 Ga0075369_10570179 3300006186 Bacteria 541
154 Ga0097621_100896590 3300006237 Bacteria 826
155 Ga0075370_10045795 3300006353 Bacteria 2474
156 Ga0068871_100276916 3300006358 Bacteria 1467
157 Ga0068865_100004019 3300006881 Bacteria 8836
158 Ga0068865_100035559 3300006881 Bacteria 3351
159 Ga0097620_100005722 3300006931 Bacteria 12646
160 Ga0097620_100198530 3300006931 Bacteria 2090
161 Ga0097620_102217525 3300006931 Bacteria 606
162 Ga0105250_10139696 3300009092 Bacteria 1003
163 Ga0105240_10104635 3300009093 Bacteria 3437
164 Ga0105240_11005306 3300009093 Bacteria 892
165 Ga0111539_12317784 3300009094 Bacteria 623
166 Ga0105245_10007406 3300009098 Bacteria 9613
167 Ga0105245_10187766 3300009098 Bacteria 1978
168 Ga0105245_10942767 3300009098 Bacteria 906
169 Ga0105247_10003220 3300009101 Bacteria 10742
170 Ga0105247_10164368 3300009101 Bacteria 1472
171 Ga0105247_10940859 3300009101 Bacteria 670
172 Ga0105243_10007329 3300009148 Bacteria 8481
173 Ga0105243_10082248 3300009148 Bacteria 2631
174 Ga0105243_11495025 3300009148 Bacteria 699
175 Ga0105243_12843284 3300009148 Bacteria 525
176 Ga0105241_10025326 3300009174 Bacteria 4409
177 Ga0105241_10755396 3300009174 Bacteria 892
178 Ga0105242_10001104 3300009176 Bacteria 21251
179 Ga0105242_12618241 3300009176 Bacteria 553
180 Ga0105248_10010806 3300009177 Bacteria 10081
181 Ga0105237_10030464 3300009545 Bacteria 5480
182 Ga0105237_11395220 3300009545 Bacteria 707
183 Ga0105237_12568820 3300009545 Bacteria 520
184 Ga0105238_10210781 3300009551 Bacteria 1919
185 Ga0105249_10000571 3300009553 Bacteria 33782
186 Ga0105249_10032430 3300009553 Bacteria 4726
187 Ga0105239_10394117 3300010375 Bacteria 1566
188 Ga0105239_10873966 3300010375 Bacteria 1031
189 Ga0105246_10023371 3300011119 Bacteria 3999
190 Ga0105246_11304378 3300011119 Bacteria 673
191 Ga0157373_11292926 3300013100 Bacteria 552
192 Ga0157371_10455848 3300013102 Bacteria 941
193 Ga0157369_10122651 3300013105 Bacteria 2756
194 Ga0157369_10336002 3300013105 Bacteria 1569
195 Ga0157369_11006439 3300013105 Bacteria 853
196 Ga0157378_10043733 3300013297 Bacteria 3977
197 Ga0157378_10232121 3300013297 Bacteria 1759
198 Ga0163162_10137615 3300013306 Bacteria 2554
199 Ga0163162_12682781 3300013306 Bacteria 573
200 Ga0157372_11368680 3300013307 Bacteria 816
201 Ga0157375_10042543 3300013308 Bacteria 4397
202 Ga0157375_10899181 3300013308 Bacteria 1029
203 Ga0157375_12752539 3300013308 Bacteria 588
204 Ga0163163_10465955 3300014325 Bacteria 1324
205 Ga0163163_10777345 3300014325 Bacteria 1021
206 Ga0163163_11198006 3300014325 Bacteria 822
207 Ga0157380_10000597 3300014326 Bacteria 22234
208 Ga0182008_10514743 3300014497 Bacteria 660
209 Ga0157377_10047699 3300014745 Bacteria 2400
210 Ga0157377_10266754 3300014745 Bacteria 1116
211 Ga0157379_10018092 3300014968 Bacteria 6210
212 Ga0157379_10252695 3300014968 Bacteria 1601
213 Ga0157379_10556392 3300014968 Bacteria 1068
214 Ga0157376_10907174 3300014969 Bacteria 899
215 Ga0163161_10006021 3300017792 Bacteria 8404
216 Ga0163161_10578724 3300017792 Bacteria 923
217 Ga0209051_1096263 3300025303 Bacteria 808
218 Ga0207697_10390295 3300025315 Bacteria 618
219 Ga0207656_10154169 3300025321 Bacteria 1090
220 Ga0207653_10033595 3300025885 Bacteria 1664
221 Ga0207692_10007629 3300025898 Bacteria 4439
222 Ga0207692_10066799 3300025898 Bacteria 1881
223 Ga0207692_10189941 3300025898 Bacteria 1202
224 Ga0207642_10000205 3300025899 Bacteria 17391
225 Ga0207710_10004260 3300025900 Bacteria 6263
226 Ga0207710_10107289 3300025900 Bacteria 1323
227 Ga0207710_10333284 3300025900 Bacteria 771
228 Ga0207688_10003825 3300025901 Bacteria 8212
229 Ga0207688_10004459 3300025901 Bacteria 7623
230 Ga0207680_10241784 3300025903 Bacteria 1244
231 Ga0207647_10013855 3300025904 Bacteria 5583
232 Ga0207647_10032885 3300025904 Bacteria 3327
233 Ga0207647_10236297 3300025904 Bacteria 1050
234 Ga0207685_10045627 3300025905 Bacteria 1663
235 Ga0207699_10079667 3300025906 Bacteria 2027
236 Ga0207645_10023364 3300025907 Bacteria 4019
237 Ga0207645_10075446 3300025907 Bacteria 2158
238 Ga0207643_10979186 3300025908 Bacteria 547
239 Ga0207654_10016336 3300025911 Bacteria 3864
240 Ga0207654_10938003 3300025911 Bacteria 628
241 Ga0207695_11494871 3300025913 Bacteria 556
242 Ga0207671_10063989 3300025914 Bacteria 2734
243 Ga0207693_10000705 3300025915 Bacteria 30041
244 Ga0207693_10014488 3300025915 Bacteria 6337
245 Ga0207663_10012077 3300025916 Bacteria 4657
246 Ga0207663_10036477 3300025916 Bacteria 2958
247 Ga0207663_10223299 3300025916 Bacteria 1372
248 Ga0207660_10212161 3300025917 Bacteria 1517
249 Ga0207662_10042550 3300025918 Bacteria 2678
250 Ga0207657_10264694 3300025919 Bacteria 1368
251 Ga0207681_10019220 3300025923 Bacteria 4315
252 Ga0207694_10407905 3300025924 Bacteria 1130
253 Ga0207694_10752049 3300025924 Bacteria 823
254 Ga0207659_10645944 3300025926 Bacteria 904
255 Ga0207659_11221445 3300025926 Bacteria 646
256 Ga0207687_10002750 3300025927 Bacteria 11926
257 Ga0207687_10245396 3300025927 Bacteria 1421
258 Ga0207700_10761709 3300025928 Bacteria 865
259 Ga0207664_10116929 3300025929 Bacteria 2225
260 Ga0207664_10881835 3300025929 Bacteria 804
261 Ga0207664_11108804 3300025929 Bacteria 707
262 Ga0207644_10484073 3300025931 Bacteria 1019
263 Ga0207690_10157873 3300025932 Bacteria 1688
264 Ga0207706_10122796 3300025933 Bacteria 2284
265 Ga0207706_10142306 3300025933 Bacteria 2110
266 Ga0207686_10040315 3300025934 Bacteria 2838
267 Ga0207686_11613863 3300025934 Bacteria 536
268 Ga0207709_10008492 3300025935 Bacteria 5681
269 Ga0207709_10383785 3300025935 Bacteria 1070
270 Ga0207670_11524807 3300025936 Bacteria 568
271 Ga0207669_10000318 3300025937 Bacteria 22011
272 Ga0207669_10013923 3300025937 Bacteria 4015
273 Ga0207669_10596041 3300025937 Bacteria 897
274 Ga0207704_10001564 3300025938 Bacteria 10254
275 Ga0207665_10136793 3300025939 Bacteria 1744
276 Ga0207665_10501737 3300025939 Bacteria 937
277 Ga0207691_10497271 3300025940 Bacteria 1036
278 Ga0207711_10072577 3300025941 Bacteria 2990
279 Ga0207711_10336827 3300025941 Bacteria 1396
280 Ga0207711_10556838 3300025941 Bacteria 1069
281 Ga0207689_10008722 3300025942 Bacteria 8823
282 Ga0207689_10052197 3300025942 Bacteria 3370
283 Ga0207679_12120200 3300025945 Bacteria 511
284 Ga0207667_10084343 3300025949 Bacteria 3289
285 Ga0207651_10192997 3300025960 Bacteria 1626
286 Ga0207712_10097042 3300025961 Bacteria 2183
287 Ga0207712_10147110 3300025961 Bacteria 1815
288 Ga0207668_10063791 3300025972 Bacteria 2600
289 Ga0207668_10751311 3300025972 Bacteria 860
290 Ga0207640_10000920 3300025981 Bacteria 16509
291 Ga0207658_10007579 3300025986 Bacteria 7394
292 Ga0207658_10307397 3300025986 Bacteria 1368
293 Ga0207677_10001170 3300026023 Bacteria 14261
294 Ga0207677_10067731 3300026023 Bacteria 2502
295 Ga0207703_10018029 3300026035 Bacteria 5513
296 Ga0207703_10484620 3300026035 Bacteria 1159
297 Ga0207703_10889197 3300026035 Bacteria 853
298 Ga0207639_10072000 3300026041 Bacteria 2706
299 Ga0207639_10117959 3300026041 Bacteria 2175
300 Ga0207678_10003485 3300026067 Bacteria 14158
301 Ga0207708_10003132 3300026075 Bacteria 12174
302 Ga0207708_10078454 3300026075 Bacteria 2536
303 Ga0207648_10010874 3300026089 Bacteria 8603
304 Ga0207648_12208047 3300026089 Bacteria 511
305 Ga0207675_100000941 3300026118 Bacteria 29074
306 Ga0207675_100020330 3300026118 Bacteria 6189
307 Ga0207683_10027074 3300026121 Bacteria 4955
308 Ga0207698_10132787 3300026142 Bacteria 2131
309 Ga0207698_12700485 3300026142 Bacteria 505
310 Ga0268266_10033590 3300028379 Bacteria 4361
311 Ga0268266_10049602 3300028379 Bacteria 3600
312 Ga0268266_11983100 3300028379 Bacteria 556
313 Ga0268265_10005537 3300028380 Bacteria 8621
314 Ga0268264_10004799 3300028381 Bacteria 11468
315 Ga0268264_10168335 3300028381 Bacteria 1980
316 Ga0265327_10000081 3300031251 Bacteria 205988
317 Ga0265327_10009711 3300031251 Bacteria 6892
318 Ga0307408_102457974 3300031548 Bacteria 506
319 Ga0316579_10506410 3300031691 Bacteria 584
320 Ga0316578_10329255 3300031728 Bacteria 911
321 Ga0307406_10099386 3300031901 Bacteria 1978
322 Ga0307406_10412082 3300031901 Bacteria 1074
323 Ga0307406_11427850 3300031901 Bacteria 607
324 Ga0307416_103678548 3300032002 Bacteria 513
325 Ga0307414_12051271 3300032004 Bacteria 534
326 Ga0307415_100239738 3300032126 Bacteria 1466
327 Ga0373928_0064638 3300035084 Bacteria 892
328 Ga0373929_0220861 3300035085 Bacteria 539
329 Ga0373940_0145333 3300035088 Bacteria 752
330 Ga0373952_0250296 3300035092 Bacteria 536
331 Ga0373941_0139590 3300035115 Bacteria 880
332 Ga0373960_0249558 3300035121 Bacteria 644
333 Ga0373942_0073698 3300035207 Bacteria 1002
334 Ga0373961_0221235 3300035241 Bacteria 675
335 Ga0316574_0383710 3300035398 Bacteria 886
336 Ga0373931_0020790 3300035691 Bacteria 3286
337 Ga0373931_0662850 3300035691 Bacteria 686
338 Ga0316584_0120309 3300036712 Bacteria 1962
339 Ga0436364_0273491 3300037853 Bacteria 1628
340 Ga0436364_0610518 3300037853 Bacteria 13173
341 Ga0436364_1115493 3300037853 Bacteria 769
342 Ga0436365_0280180 3300039437 Bacteria 835
343 Ga0436365_1696994 3300039437 Bacteria 4160
344 Ga0436365_1896310 3300039437 Bacteria 4303
345 Ga0436360_0497156 3300039438 Bacteria 1076
346 Ga0436360_0729409 3300039438 Bacteria 501
347 Ga0436361_0638357 3300039447 Bacteria 553
348 Ga0436361_0897672 3300039447 Bacteria 832
349 Ga0436363_0130242 3300039450 Bacteria 2167
350 Ga0439461_0000435 3300041410 Bacteria 6003
351 Ga0439466_0017914 3300041411 Bacteria 2546
352 Ga0439465_0009389 3300041413 Bacteria 3080
353 Ga0439431_0002555 3300041997 Bacteria 4017
354 Ga0439445_0001715 3300042004 Bacteria 4820
355 Ga0439448_0297977 3300042005 Bacteria 572
356 Ga0439434_0020654 3300042435 Bacteria 1978
357 Ga0466969_0141606 3300044656 Bacteria 1111
358 Ga0466969_0394524 3300044656 Bacteria 628
359 Ga0466969_0516392 3300044656 Bacteria 546
360 Ga0466972_0022960 3300044658 Bacteria 3104
361 Ga0466972_0260320 3300044658 Bacteria 811
362 Ga0466972_0311424 3300044658 Bacteria 736
363 Ga0466965_0000977 3300044683 Bacteria 11071
364 Ga0466965_0008391 3300044683 Bacteria 4779
365 Ga0466965_0384490 3300044683 Bacteria 773
366 Ga0466966_0030434 3300044684 Bacteria 3506
367 Ga0466966_0033245 3300044684 Bacteria 3339
368 Ga0466961_0049072 3300044693 Bacteria 2698
369 Ga0466961_0202714 3300044693 Bacteria 1226
370 Ga0466963_0053388 3300044694 Bacteria 2683
371 Ga0466963_1307540 3300044694 Bacteria 509
372 Ga0466964_0126579 3300044706 Bacteria 1158
373 Ga0466964_0262692 3300044706 Bacteria 856
374 Ga0466964_0444635 3300044706 Bacteria 686
375 Ga0466964_0767852 3300044706 Bacteria 542
376 Ga0466971_0087548 3300044719 Bacteria 1424
377 Ga0466971_0229653 3300044719 Bacteria 881
378 Ga0466968_0001250 3300044735 Bacteria 9032
379 Ga0466968_0005889 3300044735 Bacteria 4602
380 Ga0466968_0141465 3300044735 Bacteria 1101
381 Ga0466968_0299122 3300044735 Bacteria 773
382 Ga0466970_0020643 3300044765 Bacteria 3424
383 Ga0466970_0136300 3300044765 Bacteria 1350
384 Ga0466970_0172418 3300044765 Bacteria 1199
385 Ga0466957_0004000 3300044842 Bacteria 8149
386 Ga0466957_0019061 3300044842 Bacteria 4034
387 Ga0466957_0145888 3300044842 Bacteria 1528
388 Ga0466957_0561008 3300044842 Bacteria 796
389 Ga0466957_0669524 3300044842 Bacteria 731
390 Ga0466960_0000150 3300044901 Bacteria 23737
391 Ga0466960_0015817 3300044901 Bacteria 3260
392 Ga0466959_0008385 3300045049 Bacteria 7304
393 Ga0466959_0008423 3300045049 Bacteria 7291
394 Ga0466959_0023497 3300045049 Bacteria 4561
395 Ga0466958_0036476 3300045836 Bacteria 2943
396 Ga0466958_0212903 3300045836 Bacteria 1232
397 Ga0466958_0429535 3300045836 Bacteria 854
398 Ga0466958_0437539 3300045836 Bacteria 846
399 Ga0466958_0643682 3300045836 Bacteria 690
400 Ga0466958_1087591 3300045836 Bacteria 522
401 Ga0466958_1098780 3300045836 Bacteria 519
402 Ga0466967_0002298 3300045976 Bacteria 11805
403 Ga0466967_0008237 3300045976 Bacteria 7615
404 Ga0466967_0011056 3300045976 Bacteria 6813
405 Ga0466967_0107084 3300045976 Bacteria 2564
406 Ga0466967_0257249 3300045976 Bacteria 1669
407 Ga0466967_1140213 3300045976 Bacteria 777
408 Ga0466967_1772513 3300045976 Bacteria 615
409 Ga0495638_0030522 3300046460 Bacteria 3469
410 Ga0495618_0588312 3300046514 Bacteria 663
411 Ga0495621_0519457 3300046539 Bacteria 515
412 Ga0495649_0378951 3300046694 Bacteria 712
413 Ga0495674_0758019 3300047319 Bacteria 758
414 Ga0495672_0077710 3300047320 Bacteria 1859
415 Ga0495602_0360943 3300048088 Bacteria 1046
416 Ga0495626_0179203 3300048091 Bacteria 879
417 Ga0496100_0027855 3300048903 Bacteria 3478
418 Ga0496100_0522999 3300048903 Bacteria 916
419 Ga0496100_0646190 3300048903 Bacteria 823
420 Ga0496101_0012357 3300048904 Bacteria 5697
421 Ga0496101_0030556 3300048904 Bacteria 3779
422 Ga0496101_0119027 3300048904 Bacteria 1995
423 Ga0496101_0143376 3300048904 Bacteria 1822
424 Ga0496101_0764148 3300048904 Bacteria 762
425 Ga0496102_0005951 3300048905 Bacteria 10387
426 Ga0496102_0173271 3300048905 Bacteria 2031
427 Ga0496102_0430388 3300048905 Bacteria 1239
428 Ga0496103_0000932 3300048906 Bacteria 20970
429 Ga0496104_0100919 3300048907 Bacteria 2763
430 Ga0496104_0221836 3300048907 Bacteria 1803
431 Ga0496104_0544049 3300048907 Bacteria 1072
432 Ga0496104_0580203 3300048907 Bacteria 1032
433 Ga0496105_0072825 3300048908 Bacteria 2839
434 Ga0496106_0009592 3300048909 Bacteria 7146
435 Ga0496106_0038341 3300048909 Bacteria 3585
436 Ga0496106_0081969 3300048909 Bacteria 2479
437 Ga0496106_0252927 3300048909 Bacteria 1409
438 Ga0496106_0325178 3300048909 Bacteria 1234
439 Ga0496106_1038721 3300048909 Bacteria 644
440 Ga0496107_0001310 3300048910 Bacteria 15256
441 Ga0496107_0208427 3300048910 Bacteria 1453
442 Ga0496108_0000404 3300048911 Bacteria 35603
443 Ga0496108_0129414 3300048911 Bacteria 2170
444 Ga0496108_0268994 3300048911 Bacteria 1483
445 Ga0496109_0000670 3300048912 Bacteria 28362
446 Ga0496109_0049676 3300048912 Bacteria 3820
447 Ga0496109_0610993 3300048912 Bacteria 1027
448 Ga0496110_0097586 3300048913 Bacteria 2633
449 Ga0496110_1013782 3300048913 Bacteria 738
450 Ga0496111_0490113 3300048914 Bacteria 905
451 Ga0496111_1298238 3300048914 Bacteria 513
452 Ga0496112_0068714 3300048915 Bacteria 3499
453 Ga0496112_0516874 3300048915 Bacteria 1129
454 Ga0496112_0795893 3300048915 Bacteria 870
455 Ga0496113_0043659 3300048916 Bacteria 3318
456 Ga0496114_0002700 3300048917 Bacteria 13558
457 Ga0496114_0169767 3300048917 Bacteria 1901
458 Ga0496114_0285102 3300048917 Bacteria 1457
459 Ga0496114_0694585 3300048917 Bacteria 893
460 Ga0496115_0020339 3300048918 Bacteria 5119
461 Ga0496115_0531507 3300048918 Bacteria 942
462 Ga0496115_0537960 3300048918 Bacteria 935
463 Ga0496117_0564341 3300048920 Bacteria 539
464 Ga0496119_0090437 3300048922 Bacteria 1741
465 Ga0496122_0024627 3300048925 Bacteria 5261
466 Ga0496123_0006092 3300048926 Bacteria 11831
467 Ga0496125_0395886 3300048928 Bacteria 809
468 Ga0496126_0006189 3300048929 Bacteria 13394
469 Ga0496126_0158087 3300048929 Bacteria 1938
470 Ga0501031_0261930 3300049568 Bacteria 1123
471 Ga0501032_0008663 3300049569 Bacteria 7413
472 Ga0501032_0016051 3300049569 Bacteria 5273
473 Ga0501032_0026234 3300049569 Bacteria 4010
474 Ga0501033_0088689 3300049570 Bacteria 2263
475 Ga0501033_0139368 3300049570 Bacteria 1754
476 Ga0501033_0170475 3300049570 Bacteria 1563
477 Ga0501034_0002996 3300049571 Bacteria 19542
478 Ga0501034_0013493 3300049571 Bacteria 8411
479 Ga0501034_0048428 3300049571 Bacteria 4289
480 Ga0501036_0009512 3300049572 Bacteria 7996
481 Ga0501036_0111723 3300049572 Bacteria 2309
482 Ga0501036_0555674 3300049572 Bacteria 954
483 Ga0501037_0005727 3300049573 Bacteria 9068
484 Ga0501037_0017959 3300049573 Bacteria 5206
485 Ga0501037_0079814 3300049573 Bacteria 2375
486 Ga0501038_0046860 3300049574 Bacteria 3746
487 Ga0501038_0334922 3300049574 Bacteria 1181
488 Ga0501038_0728780 3300049574 Bacteria 741
489 Ga0501039_0001425 3300049575 Bacteria 17614
490 Ga0501039_0772481 3300049575 Bacteria 750
491 Ga0501043_0000337 3300049579 Bacteria 42520
492 Ga0501043_0271960 3300049579 Bacteria 1300
493 Ga0501043_0532674 3300049579 Bacteria 874
494 Ga0501046_0008004 3300049580 Bacteria 9238
495 Ga0501047_0002406 3300049581 Bacteria 17883
496 Ga0501047_0012600 3300049581 Bacteria 8011
497 Ga0501047_0126125 3300049581 Bacteria 2440
498 Ga0501047_0276401 3300049581 Bacteria 1525
499 Ga0501048_0568694 3300049582 Bacteria 813
500 Ga0501048_1113764 3300049582 Bacteria 568
501 Ga0501067_0098142 3300049583 Bacteria 1627
502 Ga0501068_0057078 3300049584 Bacteria 2367
503 Ga0501069_0022738 3300049585 Bacteria 3414
504 Ga0501069_0035338 3300049585 Bacteria 2753
505 Ga0501070_0000642 3300049586 Bacteria 32168
506 Ga0501070_0005878 3300049586 Bacteria 10463
507 Ga0501070_0809585 3300049586 Bacteria 735
508 Ga0501071_0253507 3300049587 Bacteria 1329
509 Ga0501073_0016559 3300049589 Bacteria 5343
510 Ga0501077_0714166 3300049593 Bacteria 644
511 Ga0501080_0095347 3300049742 Bacteria 2763
512 Ga0501035_0000279 3300049822 Bacteria 60584
513 Ga0501035_0004831 3300049822 Bacteria 12782
514 Ga0501044_0000637 3300049823 Bacteria 42365
515 Ga0501044_0003653 3300049823 Bacteria 17312
516 Ga0501044_0014514 3300049823 Bacteria 8498
517 Ga0501044_0033874 3300049823 Bacteria 5363
518 Ga0501044_0071845 3300049823 Bacteria 3519
519 nmdc:mga03683_233901_c1 3300050489 Bacteria 850
520 nmdc:mga03683_258155_c1 3300050489 Bacteria 810
521 nmdc:mga03n38_778012_c1 3300050490 Bacteria 556
522 nmdc:mga03n38_83293_c1 3300050490 Bacteria 1508
523 nmdc:mga03n38_950027_c1 3300050490 Bacteria 507
524 nmdc:mga00v17_178913_c1 3300050491 Bacteria 958
525 nmdc:mga00v17_33218_c1 3300050491 Bacteria 2544
526 nmdc:mga00v17_3681_c1 3300050491 Bacteria 7919
527 nmdc:mga0yw44_104045_c1 3300050492 Bacteria 1811
528 nmdc:mga0yw44_155474_c1 3300050492 Bacteria 1494
529 nmdc:mga0yw44_181596_c1 3300050492 Bacteria 1385
530 nmdc:mga0yw44_28241_c1 3300050492 Bacteria 3225
531 nmdc:mga0yw44_516685_c1 3300050492 Bacteria 810
532 nmdc:mga07m45_25292_c1 3300050496 Bacteria 3255
533 nmdc:mga07m45_499923_c1 3300050496 Bacteria 704
534 nmdc:mga0sz30_26439_c2 3300050516 Bacteria 1991
535 nmdc:mga0sz30_505175_c1 3300050516 Bacteria 544
536 nmdc:mga0sz30_507492_c1 3300050516 Bacteria 543
537 Ga0495601_0845506 3300053077 Bacteria 580
538 Ga0500635_0005811 3300053080 Bacteria 3263
539 Ga0500635_0448813 3300053080 Bacteria 511
540 Ga0495655_0035940 3300053083 Bacteria 1236
541 Ga0500643_043243 3300053087 Bacteria 1314
542 Ga0500583_0450319 3300053092 Bacteria 611
543 Ga0500641_0042822 3300053096 Bacteria 1836
544 Ga0500641_0220558 3300053096 Bacteria 804
545 Ga0500594_0199295 3300053118 Bacteria 657
546 Ga0500652_000985 3300053131 Bacteria 9378
547 Ga0500652_022549 3300053131 Bacteria 2384
548 Ga0500559_0164184 3300053136 Bacteria 1044
549 Ga0500559_0438984 3300053136 Bacteria 604
550 Ga0500568_0304617 3300053139 Bacteria 578
551 Ga0500622_0427570 3300053156 Bacteria 532
552 Ga0500627_0050332 3300053158 Bacteria 1814
553 Ga0500645_000030 3300053730 Bacteria 121213
554 Ga0500645_040989 3300053730 Bacteria 1368
555 Ga0466962_0011963 3300061719 Bacteria 4174
556 Ga0466962_0013769 3300061719 Bacteria 3894
557 Ga0466962_0236493 3300061719 Bacteria 896

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0610518 Ga0436364_0610518_6678_6881 62
2 3300039437 Ga0436365_1696994 Ga0436365_1696994_1422_1625 62
3 3300039447 Ga0436361_0897672 Ga0436361_0897672_586_792 62
4 iso_pu_bacteria 2751185725 2753038653 64
5 iso_pu_bacteria 2751185792 2753327165 64
6 3300006177 Ga0075362_10007434 Ga0075362_100074345 66
7 3300050489 nmdc:mga03683_233901_c1 nmdc:mga03683_233901_c1_303_533 66
8 3300050489 nmdc:mga03683_258155_c1 nmdc:mga03683_258155_c1_122_337 66
9 3300050516 nmdc:mga0sz30_507492_c1 nmdc:mga0sz30_507492_c1_258_473 66
10 3300005367 Ga0070667_100066477 Ga0070667_1000664774 68
11 3300005544 Ga0070686_100271670 Ga0070686_1002716702 68
12 3300005843 Ga0068860_102788905 Ga0068860_1027889052 68
13 3300009553 Ga0105249_10032430 Ga0105249_100324302 68
14 3300014325 Ga0163163_10465955 Ga0163163_104659551 68
15 3300014497 Ga0182008_10514743 Ga0182008_105147432 68
16 3300014968 Ga0157379_10252695 Ga0157379_102526951 68
17 3300039438 Ga0436360_0497156 Ga0436360_0497156_323_562 68
18 3300039447 Ga0436361_0638357 Ga0436361_0638357_97_336 68
19 3300048920 Ga0496117_0564341 Ga0496117_0564341_95_328 68
20 3300006038 Ga0075365_10011492 Ga0075365_100114922 69
21 3300006048 Ga0075363_100296835 Ga0075363_1002968352 69
22 3300009545 Ga0105237_11395220 Ga0105237_113952201 69
23 3300049581 Ga0501047_0126125 Ga0501047_0126125_1970_2206 69
24 3300049585 Ga0501069_0022738 Ga0501069_0022738_11_247 69
25 3300049586 Ga0501070_0809585 Ga0501070_0809585_42_278 69
26 3300050490 nmdc:mga03n38_950027_c1 nmdc:mga03n38_950027_c1_199_435 69
27 3300001989 JGI24739J22299_10149906 JGI24739J22299_101499062 70
28 3300001991 JGI24743J22301_10013785 JGI24743J22301_100137851 70
29 3300001991 JGI24743J22301_10026481 JGI24743J22301_100264812 70
30 3300002070 JGI24750J21931_1064298 JGI24750J21931_10642981 70
31 3300002073 JGI24745J21846_1005539 JGI24745J21846_10055392 70
32 3300002073 JGI24745J21846_1023849 JGI24745J21846_10238492 70
33 3300002074 JGI24748J21848_1003107 JGI24748J21848_10031073 70
34 3300002075 JGI24738J21930_10031244 JGI24738J21930_100312442 70
35 3300002076 JGI24749J21850_1036210 JGI24749J21850_10362102 70
36 3300002077 JGI24744J21845_10000326 JGI24744J21845_100003269 70
37 3300002077 JGI24744J21845_10007820 JGI24744J21845_100078203 70
38 3300002239 JGI24034J26672_10002872 JGI24034J26672_100028721 70
39 3300002239 JGI24034J26672_10065718 JGI24034J26672_100657182 70
40 3300002239 JGI24034J26672_10109193 JGI24034J26672_101091931 70
41 3300002244 JGI24742J22300_10034482 JGI24742J22300_100344822 70
42 3300002244 JGI24742J22300_10035213 JGI24742J22300_100352132 70
43 3300005328 Ga0070676_10005389 Ga0070676_100053893 70
44 3300005330 Ga0070690_100093070 Ga0070690_1000930703 70
45 3300005333 Ga0070677_10277549 Ga0070677_102775492 70
46 3300005334 Ga0068869_100022937 Ga0068869_1000229375 70
47 3300005334 Ga0068869_100304569 Ga0068869_1003045691 70
48 3300005334 Ga0068869_101962096 Ga0068869_1019620961 70
49 3300005335 Ga0070666_10070086 Ga0070666_100700863 70
50 3300005335 Ga0070666_10571337 Ga0070666_105713371 70
51 3300005336 Ga0070680_100346574 Ga0070680_1003465742 70
52 3300005337 Ga0070682_100073685 Ga0070682_1000736852 70
53 3300005337 Ga0070682_100908613 Ga0070682_1009086132 70
54 3300005338 Ga0068868_100005485 Ga0068868_1000054859 70
55 3300005339 Ga0070660_100340161 Ga0070660_1003401612 70
56 3300005339 Ga0070660_100440923 Ga0070660_1004409231 70
57 3300005339 Ga0070660_100487332 Ga0070660_1004873322 70
58 3300005340 Ga0070689_100093245 Ga0070689_1000932451 70
59 3300005340 Ga0070689_102154154 Ga0070689_1021541542 70
60 3300005341 Ga0070691_10001448 Ga0070691_100014485 70
61 3300005341 Ga0070691_10036792 Ga0070691_100367923 70
62 3300005344 Ga0070661_101358241 Ga0070661_1013582412 70
63 3300005345 Ga0070692_10203194 Ga0070692_102031941 70
64 3300005347 Ga0070668_100000568 Ga0070668_10000056810 70
65 3300005347 Ga0070668_100158634 Ga0070668_1001586342 70
66 3300005347 Ga0070668_100964326 Ga0070668_1009643262 70
67 3300005347 Ga0070668_101999122 Ga0070668_1019991222 70
68 3300005347 Ga0070668_102214655 Ga0070668_1022146551 70
69 3300005353 Ga0070669_100009018 Ga0070669_1000090187 70
70 3300005355 Ga0070671_100447989 Ga0070671_1004479893 70
71 3300005356 Ga0070674_100208716 Ga0070674_1002087162 70
72 3300005356 Ga0070674_100228360 Ga0070674_1002283601 70
73 3300005364 Ga0070673_100136666 Ga0070673_1001366662 70
74 3300005365 Ga0070688_100015882 Ga0070688_1000158825 70
75 3300005365 Ga0070688_101481042 Ga0070688_1014810421 70
76 3300005366 Ga0070659_100099965 Ga0070659_1000999654 70
77 3300005366 Ga0070659_100509377 Ga0070659_1005093771 70
78 3300005367 Ga0070667_100018217 Ga0070667_1000182176 70
79 3300005367 Ga0070667_100218834 Ga0070667_1002188343 70
80 3300005434 Ga0070709_11009046 Ga0070709_110090461 70
81 3300005435 Ga0070714_100043677 Ga0070714_1000436773 70
82 3300005435 Ga0070714_100234486 Ga0070714_1002344862 70
83 3300005435 Ga0070714_100399721 Ga0070714_1003997213 70
84 3300005435 Ga0070714_100582117 Ga0070714_1005821172 70
85 3300005435 Ga0070714_101695198 Ga0070714_1016951982 70
86 3300005436 Ga0070713_100114593 Ga0070713_1001145933 70
87 3300005436 Ga0070713_100691974 Ga0070713_1006919742 70
88 3300005437 Ga0070710_10000932 Ga0070710_1000093210 70
89 3300005437 Ga0070710_10034170 Ga0070710_100341703 70
90 3300005437 Ga0070710_10073090 Ga0070710_100730902 70
91 3300005438 Ga0070701_10003743 Ga0070701_100037436 70
92 3300005439 Ga0070711_100001643 Ga0070711_1000016432 70
93 3300005439 Ga0070711_100876414 Ga0070711_1008764142 70
94 3300005440 Ga0070705_100073895 Ga0070705_1000738952 70
95 3300005440 Ga0070705_101444344 Ga0070705_1014443442 70
96 3300005441 Ga0070700_100002582 Ga0070700_1000025827 70
97 3300005441 Ga0070700_100736146 Ga0070700_1007361462 70
98 3300005444 Ga0070694_100583328 Ga0070694_1005833281 70
99 3300005455 Ga0070663_100094540 Ga0070663_1000945402 70
100 3300005455 Ga0070663_100383312 Ga0070663_1003833122 70
101 3300005456 Ga0070678_100070238 Ga0070678_1000702382 70
102 3300005456 Ga0070678_100103789 Ga0070678_1001037893 70
103 3300005456 Ga0070678_100255189 Ga0070678_1002551892 70
104 3300005456 Ga0070678_100378025 Ga0070678_1003780253 70
105 3300005457 Ga0070662_100539258 Ga0070662_1005392582 70
106 3300005457 Ga0070662_101321408 Ga0070662_1013214082 70
107 3300005459 Ga0068867_100010113 Ga0068867_1000101137 70
108 3300005459 Ga0068867_101379143 Ga0068867_1013791432 70
109 3300005466 Ga0070685_10218105 Ga0070685_102181052 70
110 3300005536 Ga0070697_100167052 Ga0070697_1001670522 70
111 3300005539 Ga0068853_100010926 Ga0068853_1000109267 70
112 3300005539 Ga0068853_100360912 Ga0068853_1003609122 70
113 3300005543 Ga0070672_101695381 Ga0070672_1016953812 70
114 3300005545 Ga0070695_100027005 Ga0070695_1000270055 70
115 3300005545 Ga0070695_100116189 Ga0070695_1001161892 70
116 3300005546 Ga0070696_100017971 Ga0070696_1000179713 70
117 3300005547 Ga0070693_100012592 Ga0070693_1000125922 70
118 3300005547 Ga0070693_101085200 Ga0070693_1010852001 70
119 3300005548 Ga0070665_100027133 Ga0070665_1000271333 70
120 3300005548 Ga0070665_100034595 Ga0070665_1000345953 70
121 3300005548 Ga0070665_102091460 Ga0070665_1020914602 70
122 3300005549 Ga0070704_100012664 Ga0070704_1000126641 70
123 3300005549 Ga0070704_100368931 Ga0070704_1003689312 70
124 3300005563 Ga0068855_100039696 Ga0068855_1000396962 70
125 3300005563 Ga0068855_101779329 Ga0068855_1017793292 70
126 3300005578 Ga0068854_100000704 Ga0068854_1000007049 70
127 3300005578 Ga0068854_100602011 Ga0068854_1006020112 70
128 3300005578 Ga0068854_101396440 Ga0068854_1013964402 70
129 3300005614 Ga0068856_100269132 Ga0068856_1002691322 70
130 3300005614 Ga0068856_101855566 Ga0068856_1018555662 70
131 3300005615 Ga0070702_100027914 Ga0070702_1000279142 70
132 3300005615 Ga0070702_100091423 Ga0070702_1000914232 70
133 3300005615 Ga0070702_100421505 Ga0070702_1004215052 70
134 3300005615 Ga0070702_101773115 Ga0070702_1017731151 70
135 3300005616 Ga0068852_100080920 Ga0068852_1000809202 70
136 3300005616 Ga0068852_100094052 Ga0068852_1000940522 70
137 3300005617 Ga0068859_100005722 Ga0068859_1000057228 70
138 3300005617 Ga0068859_100198524 Ga0068859_1001985243 70
139 3300005617 Ga0068859_102217843 Ga0068859_1022178432 70
140 3300005618 Ga0068864_101001874 Ga0068864_1010018742 70
141 3300005718 Ga0068866_10001957 Ga0068866_100019576 70
142 3300005718 Ga0068866_10132306 Ga0068866_101323063 70
143 3300005719 Ga0068861_100000622 Ga0068861_10000062225 70
144 3300005719 Ga0068861_100118366 Ga0068861_1001183663 70
145 3300005834 Ga0068851_10102500 Ga0068851_101025002 70
146 3300005842 Ga0068858_100102636 Ga0068858_1001026361 70
147 3300005842 Ga0068858_100535183 Ga0068858_1005351832 70
148 3300005842 Ga0068858_100902568 Ga0068858_1009025682 70
149 3300005843 Ga0068860_100013606 Ga0068860_1000136065 70
150 3300005843 Ga0068860_100344139 Ga0068860_1003441392 70
151 3300005843 Ga0068860_100417454 Ga0068860_1004174542 70
152 3300005844 Ga0068862_100030020 Ga0068862_1000300206 70
153 3300006028 Ga0070717_11821895 Ga0070717_118218951 70
154 3300006038 Ga0075365_10114963 Ga0075365_101149632 70
155 3300006038 Ga0075365_10560495 Ga0075365_105604952 70
156 3300006038 Ga0075365_10673062 Ga0075365_106730622 70
157 3300006048 Ga0075363_100094957 Ga0075363_1000949572 70
158 3300006048 Ga0075363_100165959 Ga0075363_1001659592 70
159 3300006051 Ga0075364_10015848 Ga0075364_100158486 70
160 3300006051 Ga0075364_10049989 Ga0075364_100499893 70
161 3300006051 Ga0075364_10213810 Ga0075364_102138102 70
162 3300006051 Ga0075364_10288613 Ga0075364_102886132 70
163 3300006051 Ga0075364_10655135 Ga0075364_106551351 70
164 3300006163 Ga0070715_10066647 Ga0070715_100666471 70
165 3300006173 Ga0070716_100008355 Ga0070716_1000083556 70
166 3300006173 Ga0070716_100352951 Ga0070716_1003529512 70
167 3300006173 Ga0070716_100543756 Ga0070716_1005437562 70
168 3300006173 Ga0070716_100686072 Ga0070716_1006860722 70
169 3300006175 Ga0070712_100017986 Ga0070712_1000179862 70
170 3300006175 Ga0070712_100098504 Ga0070712_1000985042 70
171 3300006186 Ga0075369_10058053 Ga0075369_100580532 70
172 3300006186 Ga0075369_10064045 Ga0075369_100640453 70
173 3300006186 Ga0075369_10570179 Ga0075369_105701792 70
174 3300006237 Ga0097621_100896590 Ga0097621_1008965902 70
175 3300006353 Ga0075370_10045795 Ga0075370_100457954 70
176 3300006358 Ga0068871_100276916 Ga0068871_1002769162 70
177 3300006881 Ga0068865_100004019 Ga0068865_1000040199 70
178 3300006881 Ga0068865_100035559 Ga0068865_1000355592 70
179 3300006931 Ga0097620_100005722 Ga0097620_1000057228 70
180 3300006931 Ga0097620_100198530 Ga0097620_1001985303 70
181 3300006931 Ga0097620_102217525 Ga0097620_1022175252 70
182 3300009092 Ga0105250_10139696 Ga0105250_101396962 70
183 3300009093 Ga0105240_10104635 Ga0105240_101046352 70
184 3300009093 Ga0105240_11005306 Ga0105240_110053062 70
185 3300009094 Ga0111539_12317784 Ga0111539_123177842 70
186 3300009098 Ga0105245_10007406 Ga0105245_1000740610 70
187 3300009098 Ga0105245_10187766 Ga0105245_101877662 70
188 3300009098 Ga0105245_10942767 Ga0105245_109427671 70
189 3300009101 Ga0105247_10003220 Ga0105247_100032206 70
190 3300009101 Ga0105247_10164368 Ga0105247_101643683 70
191 3300009101 Ga0105247_10940859 Ga0105247_109408592 70
192 3300009148 Ga0105243_10007329 Ga0105243_100073298 70
193 3300009148 Ga0105243_10082248 Ga0105243_100822484 70
194 3300009148 Ga0105243_11495025 Ga0105243_114950252 70
195 3300009148 Ga0105243_12843284 Ga0105243_128432841 70
196 3300009174 Ga0105241_10025326 Ga0105241_100253265 70
197 3300009174 Ga0105241_10755396 Ga0105241_107553962 70
198 3300009176 Ga0105242_10001104 Ga0105242_1000110424 70
199 3300009176 Ga0105242_12618241 Ga0105242_126182412 70
200 3300009177 Ga0105248_10010806 Ga0105248_100108064 70
201 3300009545 Ga0105237_10030464 Ga0105237_100304646 70
202 3300009545 Ga0105237_12568820 Ga0105237_125688201 70
203 3300009551 Ga0105238_10210781 Ga0105238_102107813 70
204 3300009553 Ga0105249_10000571 Ga0105249_100005718 70
205 3300010375 Ga0105239_10394117 Ga0105239_103941172 70
206 3300010375 Ga0105239_10873966 Ga0105239_108739662 70
207 3300011119 Ga0105246_10023371 Ga0105246_100233713 70
208 3300011119 Ga0105246_11304378 Ga0105246_113043782 70
209 3300013100 Ga0157373_11292926 Ga0157373_112929262 70
210 3300013102 Ga0157371_10455848 Ga0157371_104558482 70
211 3300013105 Ga0157369_10122651 Ga0157369_101226512 70
212 3300013105 Ga0157369_10336002 Ga0157369_103360022 70
213 3300013105 Ga0157369_11006439 Ga0157369_110064392 70
214 3300013297 Ga0157378_10043733 Ga0157378_100437335 70
215 3300013297 Ga0157378_10232121 Ga0157378_102321213 70
216 3300013306 Ga0163162_10137615 Ga0163162_101376152 70
217 3300013306 Ga0163162_12682781 Ga0163162_126827812 70
218 3300013307 Ga0157372_11368680 Ga0157372_113686802 70
219 3300013308 Ga0157375_10042543 Ga0157375_100425433 70
220 3300013308 Ga0157375_10899181 Ga0157375_108991812 70
221 3300013308 Ga0157375_12752539 Ga0157375_127525392 70
222 3300014325 Ga0163163_10777345 Ga0163163_107773451 70
223 3300014325 Ga0163163_11198006 Ga0163163_111980062 70
224 3300014326 Ga0157380_10000597 Ga0157380_100005972 70
225 3300014745 Ga0157377_10047699 Ga0157377_100476992 70
226 3300014745 Ga0157377_10266754 Ga0157377_102667543 70
227 3300014968 Ga0157379_10018092 Ga0157379_100180927 70
228 3300014968 Ga0157379_10556392 Ga0157379_105563922 70
229 3300014969 Ga0157376_10907174 Ga0157376_109071742 70
230 3300017792 Ga0163161_10006021 Ga0163161_100060212 70
231 3300017792 Ga0163161_10578724 Ga0163161_105787242 70
232 3300025303 Ga0209051_1096263 Ga0209051_10962632 70
233 3300025315 Ga0207697_10390295 Ga0207697_103902952 70
234 3300025321 Ga0207656_10154169 Ga0207656_101541692 70
235 3300025885 Ga0207653_10033595 Ga0207653_100335952 70
236 3300025898 Ga0207692_10007629 Ga0207692_100076293 70
237 3300025898 Ga0207692_10066799 Ga0207692_100667993 70
238 3300025898 Ga0207692_10189941 Ga0207692_101899412 70
239 3300025899 Ga0207642_10000205 Ga0207642_1000020514 70
240 3300025900 Ga0207710_10004260 Ga0207710_100042606 70
241 3300025900 Ga0207710_10107289 Ga0207710_101072892 70
242 3300025900 Ga0207710_10333284 Ga0207710_103332842 70
243 3300025901 Ga0207688_10003825 Ga0207688_100038259 70
244 3300025901 Ga0207688_10004459 Ga0207688_100044599 70
245 3300025903 Ga0207680_10241784 Ga0207680_102417842 70
246 3300025904 Ga0207647_10013855 Ga0207647_100138556 70
247 3300025904 Ga0207647_10032885 Ga0207647_100328853 70
248 3300025904 Ga0207647_10236297 Ga0207647_102362972 70
249 3300025905 Ga0207685_10045627 Ga0207685_100456273 70
250 3300025906 Ga0207699_10079667 Ga0207699_100796672 70
251 3300025907 Ga0207645_10023364 Ga0207645_100233644 70
252 3300025907 Ga0207645_10075446 Ga0207645_100754463 70
253 3300025908 Ga0207643_10979186 Ga0207643_109791862 70
254 3300025911 Ga0207654_10016336 Ga0207654_100163366 70
255 3300025911 Ga0207654_10938003 Ga0207654_109380032 70
256 3300025913 Ga0207695_11494871 Ga0207695_114948711 70
257 3300025914 Ga0207671_10063989 Ga0207671_100639892 70
258 3300025915 Ga0207693_10000705 Ga0207693_1000070521 70
259 3300025915 Ga0207693_10014488 Ga0207693_100144882 70
260 3300025916 Ga0207663_10012077 Ga0207663_100120775 70
261 3300025916 Ga0207663_10036477 Ga0207663_100364772 70
262 3300025916 Ga0207663_10223299 Ga0207663_102232992 70
263 3300025917 Ga0207660_10212161 Ga0207660_102121612 70
264 3300025918 Ga0207662_10042550 Ga0207662_100425503 70
265 3300025919 Ga0207657_10264694 Ga0207657_102646942 70
266 3300025923 Ga0207681_10019220 Ga0207681_100192202 70
267 3300025924 Ga0207694_10407905 Ga0207694_104079052 70
268 3300025924 Ga0207694_10752049 Ga0207694_107520492 70
269 3300025926 Ga0207659_10645944 Ga0207659_106459442 70
270 3300025926 Ga0207659_11221445 Ga0207659_112214452 70
271 3300025927 Ga0207687_10002750 Ga0207687_100027509 70
272 3300025927 Ga0207687_10245396 Ga0207687_102453962 70
273 3300025928 Ga0207700_10761709 Ga0207700_107617092 70
274 3300025929 Ga0207664_10116929 Ga0207664_101169293 70
275 3300025929 Ga0207664_10881835 Ga0207664_108818351 70
276 3300025929 Ga0207664_11108804 Ga0207664_111088042 70
277 3300025931 Ga0207644_10484073 Ga0207644_104840732 70
278 3300025932 Ga0207690_10157873 Ga0207690_101578732 70
279 3300025933 Ga0207706_10122796 Ga0207706_101227963 70
280 3300025933 Ga0207706_10142306 Ga0207706_101423063 70
281 3300025934 Ga0207686_10040315 Ga0207686_100403152 70
282 3300025934 Ga0207686_11613863 Ga0207686_116138632 70
283 3300025935 Ga0207709_10008492 Ga0207709_100084922 70
284 3300025935 Ga0207709_10383785 Ga0207709_103837852 70
285 3300025936 Ga0207670_11524807 Ga0207670_115248072 70
286 3300025937 Ga0207669_10000318 Ga0207669_1000031824 70
287 3300025937 Ga0207669_10013923 Ga0207669_100139232 70
288 3300025937 Ga0207669_10596041 Ga0207669_105960411 70
289 3300025938 Ga0207704_10001564 Ga0207704_100015648 70
290 3300025939 Ga0207665_10136793 Ga0207665_101367932 70
291 3300025939 Ga0207665_10501737 Ga0207665_105017372 70
292 3300025940 Ga0207691_10497271 Ga0207691_104972711 70
293 3300025941 Ga0207711_10072577 Ga0207711_100725772 70
294 3300025941 Ga0207711_10336827 Ga0207711_103368272 70
295 3300025941 Ga0207711_10556838 Ga0207711_105568382 70
296 3300025942 Ga0207689_10008722 Ga0207689_100087222 70
297 3300025942 Ga0207689_10052197 Ga0207689_100521972 70
298 3300025945 Ga0207679_12120200 Ga0207679_121202002 70
299 3300025949 Ga0207667_10084343 Ga0207667_100843434 70
300 3300025960 Ga0207651_10192997 Ga0207651_101929972 70
301 3300025961 Ga0207712_10097042 Ga0207712_100970422 70
302 3300025961 Ga0207712_10147110 Ga0207712_101471102 70
303 3300025972 Ga0207668_10063791 Ga0207668_100637915 70
304 3300025972 Ga0207668_10751311 Ga0207668_107513112 70
305 3300025981 Ga0207640_10000920 Ga0207640_1000092018 70
306 3300025986 Ga0207658_10007579 Ga0207658_100075792 70
307 3300025986 Ga0207658_10307397 Ga0207658_103073972 70
308 3300026023 Ga0207677_10001170 Ga0207677_100011703 70
309 3300026023 Ga0207677_10067731 Ga0207677_100677312 70
310 3300026035 Ga0207703_10018029 Ga0207703_100180298 70
311 3300026035 Ga0207703_10484620 Ga0207703_104846202 70
312 3300026035 Ga0207703_10889197 Ga0207703_108891972 70
313 3300026041 Ga0207639_10072000 Ga0207639_100720002 70
314 3300026041 Ga0207639_10117959 Ga0207639_101179594 70
315 3300026067 Ga0207678_10003485 Ga0207678_1000348511 70
316 3300026075 Ga0207708_10003132 Ga0207708_100031328 70
317 3300026075 Ga0207708_10078454 Ga0207708_100784543 70
318 3300026089 Ga0207648_10010874 Ga0207648_1001087410 70
319 3300026089 Ga0207648_12208047 Ga0207648_122080472 70
320 3300026118 Ga0207675_100000941 Ga0207675_10000094121 70
321 3300026118 Ga0207675_100020330 Ga0207675_1000203303 70
322 3300026121 Ga0207683_10027074 Ga0207683_100270743 70
323 3300026142 Ga0207698_10132787 Ga0207698_101327872 70
324 3300026142 Ga0207698_12700485 Ga0207698_127004852 70
325 3300028379 Ga0268266_10033590 Ga0268266_100335902 70
326 3300028379 Ga0268266_10049602 Ga0268266_100496024 70
327 3300028379 Ga0268266_11983100 Ga0268266_119831002 70
328 3300028380 Ga0268265_10005537 Ga0268265_100055378 70
329 3300028381 Ga0268264_10004799 Ga0268264_100047996 70
330 3300028381 Ga0268264_10168335 Ga0268264_101683353 70
331 3300031251 Ga0265327_10000081 Ga0265327_1000008186 70
332 3300031251 Ga0265327_10009711 Ga0265327_100097117 70
333 3300031548 Ga0307408_102457974 Ga0307408_1024579742 70
334 3300031691 Ga0316579_10506410 Ga0316579_105064102 70
335 3300031728 Ga0316578_10329255 Ga0316578_103292552 70
336 3300031901 Ga0307406_10099386 Ga0307406_100993863 70
337 3300031901 Ga0307406_10412082 Ga0307406_104120822 70
338 3300031901 Ga0307406_11427850 Ga0307406_114278501 70
339 3300032002 Ga0307416_103678548 Ga0307416_1036785482 70
340 3300032004 Ga0307414_12051271 Ga0307414_120512712 70
341 3300032126 Ga0307415_100239738 Ga0307415_1002397383 70
342 3300035084 Ga0373928_0064638 Ga0373928_0064638_249_464 70
343 3300035085 Ga0373929_0220861 Ga0373929_0220861_236_448 70
344 3300035088 Ga0373940_0145333 Ga0373940_0145333_211_426 70
345 3300035092 Ga0373952_0250296 Ga0373952_0250296_60_272 70
346 3300035115 Ga0373941_0139590 Ga0373941_0139590_604_816 70
347 3300035121 Ga0373960_0249558 Ga0373960_0249558_26_253 70
348 3300035207 Ga0373942_0073698 Ga0373942_0073698_586_801 70
349 3300035241 Ga0373961_0221235 Ga0373961_0221235_188_415 70
350 3300035398 Ga0316574_0383710 Ga0316574_0383710_50_277 70
351 3300035691 Ga0373931_0020790 Ga0373931_0020790_1873_2088 70
352 3300035691 Ga0373931_0662850 Ga0373931_0662850_188_400 70
353 3300036712 Ga0316584_0120309 Ga0316584_0120309_1457_1684 70
354 3300037853 Ga0436364_0273491 Ga0436364_0273491_157_399 70
355 3300037853 Ga0436364_1115493 Ga0436364_1115493_503_730 70
356 3300039437 Ga0436365_0280180 Ga0436365_0280180_293_535 70
357 3300039437 Ga0436365_1896310 Ga0436365_1896310_585_812 70
358 3300039438 Ga0436360_0729409 Ga0436360_0729409_232_471 70
359 3300039450 Ga0436363_0130242 Ga0436363_0130242_1868_2095 70
360 3300041410 Ga0439461_0000435 Ga0439461_0000435_2386_2634 70
361 3300041411 Ga0439466_0017914 Ga0439466_0017914_1572_1820 70
362 3300041413 Ga0439465_0009389 Ga0439465_0009389_1388_1636 70
363 3300041997 Ga0439431_0002555 Ga0439431_0002555_3440_3688 70
364 3300042004 Ga0439445_0001715 Ga0439445_0001715_1917_2165 70
365 3300042005 Ga0439448_0297977 Ga0439448_0297977_221_448 70
366 3300042435 Ga0439434_0020654 Ga0439434_0020654_1701_1949 70
367 3300044656 Ga0466969_0141606 Ga0466969_0141606_566_796 70
368 3300044656 Ga0466969_0394524 Ga0466969_0394524_286_522 70
369 3300044656 Ga0466969_0516392 Ga0466969_0516392_79_306 70
370 3300044658 Ga0466972_0022960 Ga0466972_0022960_1401_1637 70
371 3300044658 Ga0466972_0260320 Ga0466972_0260320_268_504 70
372 3300044658 Ga0466972_0311424 Ga0466972_0311424_64_312 70
373 3300044683 Ga0466965_0000977 Ga0466965_0000977_9173_9409 70
374 3300044683 Ga0466965_0008391 Ga0466965_0008391_644_886 70
375 3300044683 Ga0466965_0384490 Ga0466965_0384490_53_283 70
376 3300044684 Ga0466966_0030434 Ga0466966_0030434_2220_2450 70
377 3300044684 Ga0466966_0033245 Ga0466966_0033245_2237_2467 70
378 3300044693 Ga0466961_0049072 Ga0466961_0049072_2182_2412 70
379 3300044693 Ga0466961_0202714 Ga0466961_0202714_107_337 70
380 3300044694 Ga0466963_0053388 Ga0466963_0053388_403_630 70
381 3300044694 Ga0466963_1307540 Ga0466963_1307540_30_257 70
382 3300044706 Ga0466964_0126579 Ga0466964_0126579_528_764 70
383 3300044706 Ga0466964_0262692 Ga0466964_0262692_112_342 70
384 3300044706 Ga0466964_0444635 Ga0466964_0444635_91_336 70
385 3300044706 Ga0466964_0767852 Ga0466964_0767852_202_429 70
386 3300044719 Ga0466971_0087548 Ga0466971_0087548_59_304 70
387 3300044719 Ga0466971_0229653 Ga0466971_0229653_185_421 70
388 3300044735 Ga0466968_0001250 Ga0466968_0001250_6036_6272 70
389 3300044735 Ga0466968_0005889 Ga0466968_0005889_3387_3617 70
390 3300044735 Ga0466968_0141465 Ga0466968_0141465_821_1048 70
391 3300044735 Ga0466968_0299122 Ga0466968_0299122_416_646 70
392 3300044765 Ga0466970_0020643 Ga0466970_0020643_2288_2524 70
393 3300044765 Ga0466970_0136300 Ga0466970_0136300_252_482 70
394 3300044765 Ga0466970_0172418 Ga0466970_0172418_564_824 70
395 3300044842 Ga0466957_0004000 Ga0466957_0004000_5644_5880 70
396 3300044842 Ga0466957_0019061 Ga0466957_0019061_2840_3070 70
397 3300044842 Ga0466957_0145888 Ga0466957_0145888_594_839 70
398 3300044842 Ga0466957_0561008 Ga0466957_0561008_520_744 70
399 3300044842 Ga0466957_0669524 Ga0466957_0669524_376_606 70
400 3300044901 Ga0466960_0000150 Ga0466960_0000150_15689_15931 70
401 3300044901 Ga0466960_0015817 Ga0466960_0015817_1469_1705 70
402 3300045049 Ga0466959_0008385 Ga0466959_0008385_5332_5562 70
403 3300045049 Ga0466959_0008423 Ga0466959_0008423_1469_1705 70
404 3300045049 Ga0466959_0023497 Ga0466959_0023497_798_1028 70
405 3300045836 Ga0466958_0036476 Ga0466958_0036476_2330_2560 70
406 3300045836 Ga0466958_0212903 Ga0466958_0212903_720_965 70
407 3300045836 Ga0466958_0429535 Ga0466958_0429535_281_517 70
408 3300045836 Ga0466958_0437539 Ga0466958_0437539_183_413 70
409 3300045836 Ga0466958_0643682 Ga0466958_0643682_130_363 70
410 3300045836 Ga0466958_1087591 Ga0466958_1087591_10_237 70
411 3300045836 Ga0466958_1098780 Ga0466958_1098780_113_340 70
412 3300045976 Ga0466967_0002298 Ga0466967_0002298_11184_11429 70
413 3300045976 Ga0466967_0008237 Ga0466967_0008237_4362_4589 70
414 3300045976 Ga0466967_0011056 Ga0466967_0011056_5954_6190 70
415 3300045976 Ga0466967_0107084 Ga0466967_0107084_513_740 70
416 3300045976 Ga0466967_0257249 Ga0466967_0257249_360_584 70
417 3300045976 Ga0466967_1140213 Ga0466967_1140213_382_624 70
418 3300045976 Ga0466967_1772513 Ga0466967_1772513_36_269 70
419 3300046460 Ga0495638_0030522 Ga0495638_0030522_259_486 70
420 3300046514 Ga0495618_0588312 Ga0495618_0588312_195_437 70
421 3300046539 Ga0495621_0519457 Ga0495621_0519457_193_420 70
422 3300046694 Ga0495649_0378951 Ga0495649_0378951_425_652 70
423 3300047319 Ga0495674_0758019 Ga0495674_0758019_168_410 70
424 3300047320 Ga0495672_0077710 Ga0495672_0077710_28_255 70
425 3300048088 Ga0495602_0360943 Ga0495602_0360943_159_401 70
426 3300048091 Ga0495626_0179203 Ga0495626_0179203_198_425 70
427 3300048903 Ga0496100_0027855 Ga0496100_0027855_2192_2404 70
428 3300048903 Ga0496100_0522999 Ga0496100_0522999_76_312 70
429 3300048903 Ga0496100_0646190 Ga0496100_0646190_544_759 70
430 3300048904 Ga0496101_0012357 Ga0496101_0012357_3475_3714 70
431 3300048904 Ga0496101_0030556 Ga0496101_0030556_2861_3097 70
432 3300048904 Ga0496101_0119027 Ga0496101_0119027_947_1168 70
433 3300048904 Ga0496101_0143376 Ga0496101_0143376_864_1076 70
434 3300048904 Ga0496101_0764148 Ga0496101_0764148_415_630 70
435 3300048905 Ga0496102_0005951 Ga0496102_0005951_7866_8078 70
436 3300048905 Ga0496102_0173271 Ga0496102_0173271_1247_1462 70
437 3300048905 Ga0496102_0430388 Ga0496102_0430388_554_781 70
438 3300048906 Ga0496103_0000932 Ga0496103_0000932_6491_6703 70
439 3300048907 Ga0496104_0100919 Ga0496104_0100919_482_697 70
440 3300048907 Ga0496104_0221836 Ga0496104_0221836_347_586 70
441 3300048907 Ga0496104_0544049 Ga0496104_0544049_19_264 70
442 3300048907 Ga0496104_0580203 Ga0496104_0580203_418_645 70
443 3300048908 Ga0496105_0072825 Ga0496105_0072825_284_499 70
444 3300048909 Ga0496106_0009592 Ga0496106_0009592_5764_5976 70
445 3300048909 Ga0496106_0038341 Ga0496106_0038341_280_495 70
446 3300048909 Ga0496106_0081969 Ga0496106_0081969_2006_2245 70
447 3300048909 Ga0496106_0252927 Ga0496106_0252927_795_1040 70
448 3300048909 Ga0496106_0325178 Ga0496106_0325178_879_1100 70
449 3300048909 Ga0496106_1038721 Ga0496106_1038721_297_524 70
450 3300048910 Ga0496107_0001310 Ga0496107_0001310_1158_1370 70
451 3300048910 Ga0496107_0208427 Ga0496107_0208427_443_658 70
452 3300048911 Ga0496108_0000404 Ga0496108_0000404_5066_5281 70
453 3300048911 Ga0496108_0129414 Ga0496108_0129414_1672_1911 70
454 3300048911 Ga0496108_0268994 Ga0496108_0268994_1195_1440 70
455 3300048912 Ga0496109_0000670 Ga0496109_0000670_6361_6576 70
456 3300048912 Ga0496109_0049676 Ga0496109_0049676_694_939 70
457 3300048912 Ga0496109_0610993 Ga0496109_0610993_170_409 70
458 3300048913 Ga0496110_0097586 Ga0496110_0097586_1735_1950 70
459 3300048913 Ga0496110_1013782 Ga0496110_1013782_376_606 70
460 3300048914 Ga0496111_0490113 Ga0496111_0490113_164_379 70
461 3300048914 Ga0496111_1298238 Ga0496111_1298238_106_345 70
462 3300048915 Ga0496112_0068714 Ga0496112_0068714_863_1078 70
463 3300048915 Ga0496112_0516874 Ga0496112_0516874_504_743 70
464 3300048915 Ga0496112_0795893 Ga0496112_0795893_540_776 70
465 3300048916 Ga0496113_0043659 Ga0496113_0043659_3048_3284 70
466 3300048917 Ga0496114_0002700 Ga0496114_0002700_5785_5997 70
467 3300048917 Ga0496114_0169767 Ga0496114_0169767_1509_1748 70
468 3300048917 Ga0496114_0285102 Ga0496114_0285102_1175_1420 70
469 3300048917 Ga0496114_0694585 Ga0496114_0694585_510_752 70
470 3300048918 Ga0496115_0020339 Ga0496115_0020339_2309_2521 70
471 3300048918 Ga0496115_0531507 Ga0496115_0531507_251_466 70
472 3300048918 Ga0496115_0537960 Ga0496115_0537960_286_525 70
473 3300048922 Ga0496119_0090437 Ga0496119_0090437_1450_1686 70
474 3300048925 Ga0496122_0024627 Ga0496122_0024627_2752_2988 70
475 3300048926 Ga0496123_0006092 Ga0496123_0006092_1073_1309 70
476 3300048928 Ga0496125_0395886 Ga0496125_0395886_277_507 70
477 3300048929 Ga0496126_0006189 Ga0496126_0006189_4362_4598 70
478 3300048929 Ga0496126_0158087 Ga0496126_0158087_314_544 70
479 3300049568 Ga0501031_0261930 Ga0501031_0261930_151_390 70
480 3300049569 Ga0501032_0008663 Ga0501032_0008663_4996_5223 70
481 3300049569 Ga0501032_0016051 Ga0501032_0016051_2046_2285 70
482 3300049569 Ga0501032_0026234 Ga0501032_0026234_1520_1768 70
483 3300049570 Ga0501033_0088689 Ga0501033_0088689_157_384 70
484 3300049570 Ga0501033_0139368 Ga0501033_0139368_171_398 70
485 3300049570 Ga0501033_0170475 Ga0501033_0170475_833_1072 70
486 3300049571 Ga0501034_0002996 Ga0501034_0002996_10363_10611 70
487 3300049571 Ga0501034_0013493 Ga0501034_0013493_5833_6060 70
488 3300049571 Ga0501034_0048428 Ga0501034_0048428_2628_2867 70
489 3300049572 Ga0501036_0009512 Ga0501036_0009512_2028_2276 70
490 3300049572 Ga0501036_0111723 Ga0501036_0111723_182_409 70
491 3300049572 Ga0501036_0555674 Ga0501036_0555674_395_634 70
492 3300049573 Ga0501037_0005727 Ga0501037_0005727_7498_7746 70
493 3300049573 Ga0501037_0017959 Ga0501037_0017959_1054_1281 70
494 3300049573 Ga0501037_0079814 Ga0501037_0079814_804_1043 70
495 3300049574 Ga0501038_0046860 Ga0501038_0046860_1708_1956 70
496 3300049574 Ga0501038_0334922 Ga0501038_0334922_467_694 70
497 3300049574 Ga0501038_0728780 Ga0501038_0728780_168_407 70
498 3300049575 Ga0501039_0001425 Ga0501039_0001425_2243_2491 70
499 3300049575 Ga0501039_0772481 Ga0501039_0772481_456_683 70
500 3300049579 Ga0501043_0000337 Ga0501043_0000337_14507_14755 70
501 3300049579 Ga0501043_0271960 Ga0501043_0271960_907_1146 70
502 3300049579 Ga0501043_0532674 Ga0501043_0532674_262_489 70
503 3300049580 Ga0501046_0008004 Ga0501046_0008004_5582_5809 70
504 3300049581 Ga0501047_0002406 Ga0501047_0002406_12474_12713 70
505 3300049581 Ga0501047_0012600 Ga0501047_0012600_1249_1476 70
506 3300049581 Ga0501047_0276401 Ga0501047_0276401_200_436 70
507 3300049582 Ga0501048_0568694 Ga0501048_0568694_259_486 70
508 3300049582 Ga0501048_1113764 Ga0501048_1113764_289_525 70
509 3300049583 Ga0501067_0098142 Ga0501067_0098142_570_818 70
510 3300049584 Ga0501068_0057078 Ga0501068_0057078_1301_1549 70
511 3300049585 Ga0501069_0035338 Ga0501069_0035338_1716_1943 70
512 3300049586 Ga0501070_0000642 Ga0501070_0000642_4412_4660 70
513 3300049586 Ga0501070_0005878 Ga0501070_0005878_4527_4754 70
514 3300049587 Ga0501071_0253507 Ga0501071_0253507_658_906 70
515 3300049589 Ga0501073_0016559 Ga0501073_0016559_3096_3344 70
516 3300049593 Ga0501077_0714166 Ga0501077_0714166_290_538 70
517 3300049742 Ga0501080_0095347 Ga0501080_0095347_120_347 70
518 3300049822 Ga0501035_0000279 Ga0501035_0000279_47099_47338 70
519 3300049822 Ga0501035_0004831 Ga0501035_0004831_3430_3657 70
520 3300049823 Ga0501044_0000637 Ga0501044_0000637_36408_36647 70
521 3300049823 Ga0501044_0003653 Ga0501044_0003653_11376_11603 70
522 3300049823 Ga0501044_0014514 Ga0501044_0014514_6188_6415 70
523 3300049823 Ga0501044_0033874 Ga0501044_0033874_4245_4493 70
524 3300049823 Ga0501044_0071845 Ga0501044_0071845_2509_2745 70
525 3300050490 nmdc:mga03n38_778012_c1 nmdc:mga03n38_778012_c1_196_423 70
526 3300050490 nmdc:mga03n38_83293_c1 nmdc:mga03n38_83293_c1_477_704 70
527 3300050491 nmdc:mga00v17_178913_c1 nmdc:mga00v17_178913_c1_695_943 70
528 3300050491 nmdc:mga00v17_33218_c1 nmdc:mga00v17_33218_c1_1415_1663 70
529 3300050491 nmdc:mga00v17_3681_c1 nmdc:mga00v17_3681_c1_4941_5201 70
530 3300050492 nmdc:mga0yw44_104045_c1 nmdc:mga0yw44_104045_c1_246_473 70
531 3300050492 nmdc:mga0yw44_155474_c1 nmdc:mga0yw44_155474_c1_576_824 70
532 3300050492 nmdc:mga0yw44_181596_c1 nmdc:mga0yw44_181596_c1_753_980 70
533 3300050492 nmdc:mga0yw44_28241_c1 nmdc:mga0yw44_28241_c1_1311_1559 70
534 3300050492 nmdc:mga0yw44_516685_c1 nmdc:mga0yw44_516685_c1_548_775 70
535 3300050496 nmdc:mga07m45_25292_c1 nmdc:mga07m45_25292_c1_85_312 70
536 3300050496 nmdc:mga07m45_499923_c1 nmdc:mga07m45_499923_c1_212_439 70
537 3300050516 nmdc:mga0sz30_26439_c2 nmdc:mga0sz30_26439_c2_1161_1391 70
538 3300050516 nmdc:mga0sz30_505175_c1 nmdc:mga0sz30_505175_c1_29_256 70
539 3300053077 Ga0495601_0845506 Ga0495601_0845506_74_316 70
540 3300053080 Ga0500635_0005811 Ga0500635_0005811_626_865 70
541 3300053080 Ga0500635_0448813 Ga0500635_0448813_119_346 70
542 3300053083 Ga0495655_0035940 Ga0495655_0035940_101_316 70
543 3300053087 Ga0500643_043243 Ga0500643_043243_474_701 70
544 3300053092 Ga0500583_0450319 Ga0500583_0450319_319_546 70
545 3300053096 Ga0500641_0042822 Ga0500641_0042822_281_508 70
546 3300053096 Ga0500641_0220558 Ga0500641_0220558_556_792 70
547 3300053118 Ga0500594_0199295 Ga0500594_0199295_42_269 70
548 3300053131 Ga0500652_000985 Ga0500652_000985_3250_3489 70
549 3300053131 Ga0500652_022549 Ga0500652_022549_2052_2279 70
550 3300053136 Ga0500559_0164184 Ga0500559_0164184_147_374 70
551 3300053136 Ga0500559_0438984 Ga0500559_0438984_46_273 70
552 3300053139 Ga0500568_0304617 Ga0500568_0304617_67_297 70
553 3300053156 Ga0500622_0427570 Ga0500622_0427570_111_362 70
554 3300053158 Ga0500627_0050332 Ga0500627_0050332_506_733 70
555 3300053730 Ga0500645_000030 Ga0500645_000030_26350_26580 70
556 3300053730 Ga0500645_040989 Ga0500645_040989_992_1219 70
557 3300061719 Ga0466962_0011963 Ga0466962_0011963_183_428 70
558 3300061719 Ga0466962_0013769 Ga0466962_0013769_59_295 70
559 3300061719 Ga0466962_0236493 Ga0466962_0236493_368_598 70
560 iso_pu_bacteria 2643221715 2644633764 70
561 iso_pu_bacteria 2738541264 2738665130 70
562 iso_pu_bacteria 2738541274 2738707618 70
563 iso_pu_bacteria 2738541356 2739144264 70
564 iso_pu_bacteria 2738543028 2739332630 70
565 iso_pu_bacteria 2902799365 2902801032 70
566 iso_pu_bacteria 2902810491 2902814942 70
567 iso_pu_bacteria 2929212328 2929215511 70

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y13-assembly1.cif.gz_A structural analysis of plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (ptps) 0.6823 43 63
6bzi-assembly4.cif.gz_D crystal structure of halogenase pltm in complex with ethyl mercury and mercury 0.6806 42 63
3m0n-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant 0.6788 43 63
3lze-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant 0.6761 43 63
2a0s-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydropterin synthase (ptps) from plasmodium vivax at 2.2 a resolution 0.675 43 63
ID Description Score Start End Superfamily
af_P37339_4_262_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.733 45 63 3.50.50.60
af_P56329_165_306_3.30.30.170 Alpha Beta;2-Layer Sandwich;Defensin A-like; 0.6691 34 63 3.30.30.170
1y13C00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.6613 43 63 3.30.479.10
af_Q4DY34_22_339_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6521 42 63 2.130.10.10
af_Q0WVA1_111_488_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6487 40 65 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A554UZK3-F1-model_v4 Aminotransferase 0.9628 7 70
AF-A0A838A0K4-F1-model_v4 Aminotransferase 0.9606 9 70
AF-A0A0U0W6Y6-F1-model_v4 Aminotransferase 0.9593 8 68
AF-G7CAV0-F1-model_v4 Aminotransferase 0.9499 10 67
AF-A0A2N0X568-F1-model_v4 Aminotransferase 0.9429 10 68

Feature Viewer

pLDDT pTM Quality
78.4 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map