F464498
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 296 | 557 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10015848|Ga0075364_100158486 |
| Length | 86 |
| Sequence | MMTNDDLALPALPAPVGAGVFNVYTGAEMGAAAGTVIPTAAQLGLEPPRFCAECGRRMIVQVRPTGWWAKCSRHGQVDSTDLDTQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 2 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 3 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 4 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 5 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 6 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 7 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 8 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 9 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 10 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 182 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 189 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 204 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 205 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 206 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 207 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 285 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 287 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 288 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 290 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 291 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 292 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 294 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 296 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.24 |
| Metatranscriptomes | 0 |
| Isolates | 1.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.17 |
| Nodule | 0 |
| Rhizoplane | 8.11 |
| Rhizosphere | 78.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10149906 | 3300001989 | Bacteria | 690 |
| 2 | JGI24743J22301_10013785 | 3300001991 | Bacteria | 1484 |
| 3 | JGI24743J22301_10026481 | 3300001991 | Bacteria | 1129 |
| 4 | JGI24750J21931_1064298 | 3300002070 | Bacteria | 591 |
| 5 | JGI24745J21846_1005539 | 3300002073 | Bacteria | 1380 |
| 6 | JGI24745J21846_1023849 | 3300002073 | Bacteria | 725 |
| 7 | JGI24748J21848_1003107 | 3300002074 | Bacteria | 1894 |
| 8 | JGI24738J21930_10031244 | 3300002075 | Bacteria | 1086 |
| 9 | JGI24749J21850_1036210 | 3300002076 | Bacteria | 716 |
| 10 | JGI24744J21845_10000326 | 3300002077 | Bacteria | 7991 |
| 11 | JGI24744J21845_10007820 | 3300002077 | Bacteria | 2208 |
| 12 | JGI24034J26672_10002872 | 3300002239 | Bacteria | 2381 |
| 13 | JGI24034J26672_10065718 | 3300002239 | Bacteria | 643 |
| 14 | JGI24034J26672_10109193 | 3300002239 | Bacteria | 527 |
| 15 | JGI24742J22300_10034482 | 3300002244 | Bacteria | 891 |
| 16 | JGI24742J22300_10035213 | 3300002244 | Bacteria | 883 |
| 17 | Ga0070676_10005389 | 3300005328 | Bacteria | 6815 |
| 18 | Ga0070690_100093070 | 3300005330 | Bacteria | 1988 |
| 19 | Ga0070677_10277549 | 3300005333 | Bacteria | 843 |
| 20 | Ga0068869_100022937 | 3300005334 | Bacteria | 4305 |
| 21 | Ga0068869_100304569 | 3300005334 | Bacteria | 1288 |
| 22 | Ga0068869_101962096 | 3300005334 | Bacteria | 525 |
| 23 | Ga0070666_10070086 | 3300005335 | Bacteria | 2385 |
| 24 | Ga0070666_10571337 | 3300005335 | Bacteria | 824 |
| 25 | Ga0070680_100346574 | 3300005336 | Bacteria | 1263 |
| 26 | Ga0070682_100073685 | 3300005337 | Bacteria | 2191 |
| 27 | Ga0070682_100908613 | 3300005337 | Bacteria | 724 |
| 28 | Ga0068868_100005485 | 3300005338 | Bacteria | 8923 |
| 29 | Ga0070660_100340161 | 3300005339 | Bacteria | 1235 |
| 30 | Ga0070660_100440923 | 3300005339 | Bacteria | 1080 |
| 31 | Ga0070660_100487332 | 3300005339 | Bacteria | 1025 |
| 32 | Ga0070689_100093245 | 3300005340 | Bacteria | 2376 |
| 33 | Ga0070689_102154154 | 3300005340 | Bacteria | 511 |
| 34 | Ga0070691_10001448 | 3300005341 | Bacteria | 10161 |
| 35 | Ga0070691_10036792 | 3300005341 | Bacteria | 2308 |
| 36 | Ga0070661_101358241 | 3300005344 | Bacteria | 597 |
| 37 | Ga0070692_10203194 | 3300005345 | Bacteria | 1162 |
| 38 | Ga0070668_100000568 | 3300005347 | Bacteria | 24706 |
| 39 | Ga0070668_100158634 | 3300005347 | Bacteria | 1834 |
| 40 | Ga0070668_100964326 | 3300005347 | Bacteria | 765 |
| 41 | Ga0070668_101999122 | 3300005347 | Bacteria | 535 |
| 42 | Ga0070668_102214655 | 3300005347 | Bacteria | 508 |
| 43 | Ga0070669_100009018 | 3300005353 | Bacteria | 7114 |
| 44 | Ga0070671_100447989 | 3300005355 | Bacteria | 1107 |
| 45 | Ga0070674_100208716 | 3300005356 | Bacteria | 1512 |
| 46 | Ga0070674_100228360 | 3300005356 | Bacteria | 1451 |
| 47 | Ga0070673_100136666 | 3300005364 | Bacteria | 2064 |
| 48 | Ga0070688_100015882 | 3300005365 | Bacteria | 4293 |
| 49 | Ga0070688_101481042 | 3300005365 | Bacteria | 552 |
| 50 | Ga0070659_100099965 | 3300005366 | Bacteria | 2334 |
| 51 | Ga0070659_100509377 | 3300005366 | Bacteria | 1026 |
| 52 | Ga0070667_100018217 | 3300005367 | Bacteria | 5822 |
| 53 | Ga0070667_100066477 | 3300005367 | Bacteria | 3063 |
| 54 | Ga0070667_100218834 | 3300005367 | Bacteria | 1695 |
| 55 | Ga0070709_11009046 | 3300005434 | Bacteria | 662 |
| 56 | Ga0070714_100043677 | 3300005435 | Bacteria | 3792 |
| 57 | Ga0070714_100234486 | 3300005435 | Bacteria | 1692 |
| 58 | Ga0070714_100399721 | 3300005435 | Bacteria | 1298 |
| 59 | Ga0070714_100582117 | 3300005435 | Bacteria | 1074 |
| 60 | Ga0070714_101695198 | 3300005435 | Bacteria | 617 |
| 61 | Ga0070713_100114593 | 3300005436 | Bacteria | 2355 |
| 62 | Ga0070713_100691974 | 3300005436 | Bacteria | 973 |
| 63 | Ga0070710_10000932 | 3300005437 | Bacteria | 13915 |
| 64 | Ga0070710_10034170 | 3300005437 | Bacteria | 2765 |
| 65 | Ga0070710_10073090 | 3300005437 | Bacteria | 1982 |
| 66 | Ga0070701_10003743 | 3300005438 | Bacteria | 6073 |
| 67 | Ga0070711_100001643 | 3300005439 | Bacteria | 12357 |
| 68 | Ga0070711_100876414 | 3300005439 | Bacteria | 765 |
| 69 | Ga0070705_100073895 | 3300005440 | Bacteria | 2070 |
| 70 | Ga0070705_101444344 | 3300005440 | Bacteria | 574 |
| 71 | Ga0070700_100002582 | 3300005441 | Bacteria | 9259 |
| 72 | Ga0070700_100736146 | 3300005441 | Bacteria | 788 |
| 73 | Ga0070694_100583328 | 3300005444 | Bacteria | 899 |
| 74 | Ga0070663_100094540 | 3300005455 | Bacteria | 2220 |
| 75 | Ga0070663_100383312 | 3300005455 | Bacteria | 1145 |
| 76 | Ga0070678_100070238 | 3300005456 | Bacteria | 2617 |
| 77 | Ga0070678_100103789 | 3300005456 | Bacteria | 2209 |
| 78 | Ga0070678_100255189 | 3300005456 | Bacteria | 1472 |
| 79 | Ga0070678_100378025 | 3300005456 | Bacteria | 1225 |
| 80 | Ga0070662_100539258 | 3300005457 | Bacteria | 977 |
| 81 | Ga0070662_101321408 | 3300005457 | Bacteria | 621 |
| 82 | Ga0068867_100010113 | 3300005459 | Bacteria | 6649 |
| 83 | Ga0068867_101379143 | 3300005459 | Bacteria | 653 |
| 84 | Ga0070685_10218105 | 3300005466 | Bacteria | 1248 |
| 85 | Ga0070697_100167052 | 3300005536 | Bacteria | 1861 |
| 86 | Ga0068853_100010926 | 3300005539 | Bacteria | 7359 |
| 87 | Ga0068853_100360912 | 3300005539 | Bacteria | 1353 |
| 88 | Ga0070672_101695381 | 3300005543 | Bacteria | 568 |
| 89 | Ga0070686_100271670 | 3300005544 | Bacteria | 1247 |
| 90 | Ga0070695_100027005 | 3300005545 | Bacteria | 3554 |
| 91 | Ga0070695_100116189 | 3300005545 | Bacteria | 1824 |
| 92 | Ga0070696_100017971 | 3300005546 | Bacteria | 4776 |
| 93 | Ga0070693_100012592 | 3300005547 | Bacteria | 4283 |
| 94 | Ga0070693_101085200 | 3300005547 | Bacteria | 610 |
| 95 | Ga0070665_100027133 | 3300005548 | Bacteria | 5768 |
| 96 | Ga0070665_100034595 | 3300005548 | Bacteria | 5081 |
| 97 | Ga0070665_102091460 | 3300005548 | Bacteria | 571 |
| 98 | Ga0070704_100012664 | 3300005549 | Bacteria | 5218 |
| 99 | Ga0070704_100368931 | 3300005549 | Bacteria | 1216 |
| 100 | Ga0068855_100039696 | 3300005563 | Bacteria | 5588 |
| 101 | Ga0068855_101779329 | 3300005563 | Bacteria | 626 |
| 102 | Ga0068854_100000704 | 3300005578 | Bacteria | 19787 |
| 103 | Ga0068854_100602011 | 3300005578 | Bacteria | 938 |
| 104 | Ga0068854_101396440 | 3300005578 | Bacteria | 633 |
| 105 | Ga0068856_100269132 | 3300005614 | Bacteria | 1720 |
| 106 | Ga0068856_101855566 | 3300005614 | Bacteria | 614 |
| 107 | Ga0070702_100027914 | 3300005615 | Bacteria | 3051 |
| 108 | Ga0070702_100091423 | 3300005615 | Bacteria | 1846 |
| 109 | Ga0070702_100421505 | 3300005615 | Bacteria | 961 |
| 110 | Ga0070702_101773115 | 3300005615 | Bacteria | 515 |
| 111 | Ga0068852_100080920 | 3300005616 | Bacteria | 2882 |
| 112 | Ga0068852_100094052 | 3300005616 | Bacteria | 2688 |
| 113 | Ga0068859_100005722 | 3300005617 | Bacteria | 12646 |
| 114 | Ga0068859_100198524 | 3300005617 | Bacteria | 2090 |
| 115 | Ga0068859_102217843 | 3300005617 | Bacteria | 606 |
| 116 | Ga0068864_101001874 | 3300005618 | Bacteria | 829 |
| 117 | Ga0068866_10001957 | 3300005718 | Bacteria | 8588 |
| 118 | Ga0068866_10132306 | 3300005718 | Bacteria | 1420 |
| 119 | Ga0068861_100000622 | 3300005719 | Bacteria | 20950 |
| 120 | Ga0068861_100118366 | 3300005719 | Bacteria | 2133 |
| 121 | Ga0068851_10102500 | 3300005834 | Bacteria | 1520 |
| 122 | Ga0068858_100102636 | 3300005842 | Bacteria | 2668 |
| 123 | Ga0068858_100535183 | 3300005842 | Bacteria | 1134 |
| 124 | Ga0068858_100902568 | 3300005842 | Bacteria | 864 |
| 125 | Ga0068860_100013606 | 3300005843 | Bacteria | 7976 |
| 126 | Ga0068860_100344139 | 3300005843 | Bacteria | 1466 |
| 127 | Ga0068860_100417454 | 3300005843 | Bacteria | 1329 |
| 128 | Ga0068860_102788905 | 3300005843 | Bacteria | 507 |
| 129 | Ga0068862_100030020 | 3300005844 | Bacteria | 4580 |
| 130 | Ga0070717_11821895 | 3300006028 | Bacteria | 550 |
| 131 | Ga0075365_10011492 | 3300006038 | Bacteria | 5209 |
| 132 | Ga0075365_10114963 | 3300006038 | Bacteria | 1852 |
| 133 | Ga0075365_10560495 | 3300006038 | Bacteria | 808 |
| 134 | Ga0075365_10673062 | 3300006038 | Bacteria | 731 |
| 135 | Ga0075363_100094957 | 3300006048 | Bacteria | 1644 |
| 136 | Ga0075363_100165959 | 3300006048 | Bacteria | 1252 |
| 137 | Ga0075363_100296835 | 3300006048 | Bacteria | 937 |
| 138 | Ga0075364_10015848 | 3300006051 | Bacteria | 4678 |
| 139 | Ga0075364_10049989 | 3300006051 | Bacteria | 2728 |
| 140 | Ga0075364_10213810 | 3300006051 | Bacteria | 1308 |
| 141 | Ga0075364_10288613 | 3300006051 | Bacteria | 1116 |
| 142 | Ga0075364_10655135 | 3300006051 | Bacteria | 717 |
| 143 | Ga0070715_10066647 | 3300006163 | Bacteria | 1597 |
| 144 | Ga0070716_100008355 | 3300006173 | Bacteria | 5135 |
| 145 | Ga0070716_100352951 | 3300006173 | Bacteria | 1042 |
| 146 | Ga0070716_100543756 | 3300006173 | Bacteria | 865 |
| 147 | Ga0070716_100686072 | 3300006173 | Bacteria | 781 |
| 148 | Ga0070712_100017986 | 3300006175 | Bacteria | 4583 |
| 149 | Ga0070712_100098504 | 3300006175 | Bacteria | 2156 |
| 150 | Ga0075362_10007434 | 3300006177 | Bacteria | 4150 |
| 151 | Ga0075369_10058053 | 3300006186 | Bacteria | 1685 |
| 152 | Ga0075369_10064045 | 3300006186 | Bacteria | 1609 |
| 153 | Ga0075369_10570179 | 3300006186 | Bacteria | 541 |
| 154 | Ga0097621_100896590 | 3300006237 | Bacteria | 826 |
| 155 | Ga0075370_10045795 | 3300006353 | Bacteria | 2474 |
| 156 | Ga0068871_100276916 | 3300006358 | Bacteria | 1467 |
| 157 | Ga0068865_100004019 | 3300006881 | Bacteria | 8836 |
| 158 | Ga0068865_100035559 | 3300006881 | Bacteria | 3351 |
| 159 | Ga0097620_100005722 | 3300006931 | Bacteria | 12646 |
| 160 | Ga0097620_100198530 | 3300006931 | Bacteria | 2090 |
| 161 | Ga0097620_102217525 | 3300006931 | Bacteria | 606 |
| 162 | Ga0105250_10139696 | 3300009092 | Bacteria | 1003 |
| 163 | Ga0105240_10104635 | 3300009093 | Bacteria | 3437 |
| 164 | Ga0105240_11005306 | 3300009093 | Bacteria | 892 |
| 165 | Ga0111539_12317784 | 3300009094 | Bacteria | 623 |
| 166 | Ga0105245_10007406 | 3300009098 | Bacteria | 9613 |
| 167 | Ga0105245_10187766 | 3300009098 | Bacteria | 1978 |
| 168 | Ga0105245_10942767 | 3300009098 | Bacteria | 906 |
| 169 | Ga0105247_10003220 | 3300009101 | Bacteria | 10742 |
| 170 | Ga0105247_10164368 | 3300009101 | Bacteria | 1472 |
| 171 | Ga0105247_10940859 | 3300009101 | Bacteria | 670 |
| 172 | Ga0105243_10007329 | 3300009148 | Bacteria | 8481 |
| 173 | Ga0105243_10082248 | 3300009148 | Bacteria | 2631 |
| 174 | Ga0105243_11495025 | 3300009148 | Bacteria | 699 |
| 175 | Ga0105243_12843284 | 3300009148 | Bacteria | 525 |
| 176 | Ga0105241_10025326 | 3300009174 | Bacteria | 4409 |
| 177 | Ga0105241_10755396 | 3300009174 | Bacteria | 892 |
| 178 | Ga0105242_10001104 | 3300009176 | Bacteria | 21251 |
| 179 | Ga0105242_12618241 | 3300009176 | Bacteria | 553 |
| 180 | Ga0105248_10010806 | 3300009177 | Bacteria | 10081 |
| 181 | Ga0105237_10030464 | 3300009545 | Bacteria | 5480 |
| 182 | Ga0105237_11395220 | 3300009545 | Bacteria | 707 |
| 183 | Ga0105237_12568820 | 3300009545 | Bacteria | 520 |
| 184 | Ga0105238_10210781 | 3300009551 | Bacteria | 1919 |
| 185 | Ga0105249_10000571 | 3300009553 | Bacteria | 33782 |
| 186 | Ga0105249_10032430 | 3300009553 | Bacteria | 4726 |
| 187 | Ga0105239_10394117 | 3300010375 | Bacteria | 1566 |
| 188 | Ga0105239_10873966 | 3300010375 | Bacteria | 1031 |
| 189 | Ga0105246_10023371 | 3300011119 | Bacteria | 3999 |
| 190 | Ga0105246_11304378 | 3300011119 | Bacteria | 673 |
| 191 | Ga0157373_11292926 | 3300013100 | Bacteria | 552 |
| 192 | Ga0157371_10455848 | 3300013102 | Bacteria | 941 |
| 193 | Ga0157369_10122651 | 3300013105 | Bacteria | 2756 |
| 194 | Ga0157369_10336002 | 3300013105 | Bacteria | 1569 |
| 195 | Ga0157369_11006439 | 3300013105 | Bacteria | 853 |
| 196 | Ga0157378_10043733 | 3300013297 | Bacteria | 3977 |
| 197 | Ga0157378_10232121 | 3300013297 | Bacteria | 1759 |
| 198 | Ga0163162_10137615 | 3300013306 | Bacteria | 2554 |
| 199 | Ga0163162_12682781 | 3300013306 | Bacteria | 573 |
| 200 | Ga0157372_11368680 | 3300013307 | Bacteria | 816 |
| 201 | Ga0157375_10042543 | 3300013308 | Bacteria | 4397 |
| 202 | Ga0157375_10899181 | 3300013308 | Bacteria | 1029 |
| 203 | Ga0157375_12752539 | 3300013308 | Bacteria | 588 |
| 204 | Ga0163163_10465955 | 3300014325 | Bacteria | 1324 |
| 205 | Ga0163163_10777345 | 3300014325 | Bacteria | 1021 |
| 206 | Ga0163163_11198006 | 3300014325 | Bacteria | 822 |
| 207 | Ga0157380_10000597 | 3300014326 | Bacteria | 22234 |
| 208 | Ga0182008_10514743 | 3300014497 | Bacteria | 660 |
| 209 | Ga0157377_10047699 | 3300014745 | Bacteria | 2400 |
| 210 | Ga0157377_10266754 | 3300014745 | Bacteria | 1116 |
| 211 | Ga0157379_10018092 | 3300014968 | Bacteria | 6210 |
| 212 | Ga0157379_10252695 | 3300014968 | Bacteria | 1601 |
| 213 | Ga0157379_10556392 | 3300014968 | Bacteria | 1068 |
| 214 | Ga0157376_10907174 | 3300014969 | Bacteria | 899 |
| 215 | Ga0163161_10006021 | 3300017792 | Bacteria | 8404 |
| 216 | Ga0163161_10578724 | 3300017792 | Bacteria | 923 |
| 217 | Ga0209051_1096263 | 3300025303 | Bacteria | 808 |
| 218 | Ga0207697_10390295 | 3300025315 | Bacteria | 618 |
| 219 | Ga0207656_10154169 | 3300025321 | Bacteria | 1090 |
| 220 | Ga0207653_10033595 | 3300025885 | Bacteria | 1664 |
| 221 | Ga0207692_10007629 | 3300025898 | Bacteria | 4439 |
| 222 | Ga0207692_10066799 | 3300025898 | Bacteria | 1881 |
| 223 | Ga0207692_10189941 | 3300025898 | Bacteria | 1202 |
| 224 | Ga0207642_10000205 | 3300025899 | Bacteria | 17391 |
| 225 | Ga0207710_10004260 | 3300025900 | Bacteria | 6263 |
| 226 | Ga0207710_10107289 | 3300025900 | Bacteria | 1323 |
| 227 | Ga0207710_10333284 | 3300025900 | Bacteria | 771 |
| 228 | Ga0207688_10003825 | 3300025901 | Bacteria | 8212 |
| 229 | Ga0207688_10004459 | 3300025901 | Bacteria | 7623 |
| 230 | Ga0207680_10241784 | 3300025903 | Bacteria | 1244 |
| 231 | Ga0207647_10013855 | 3300025904 | Bacteria | 5583 |
| 232 | Ga0207647_10032885 | 3300025904 | Bacteria | 3327 |
| 233 | Ga0207647_10236297 | 3300025904 | Bacteria | 1050 |
| 234 | Ga0207685_10045627 | 3300025905 | Bacteria | 1663 |
| 235 | Ga0207699_10079667 | 3300025906 | Bacteria | 2027 |
| 236 | Ga0207645_10023364 | 3300025907 | Bacteria | 4019 |
| 237 | Ga0207645_10075446 | 3300025907 | Bacteria | 2158 |
| 238 | Ga0207643_10979186 | 3300025908 | Bacteria | 547 |
| 239 | Ga0207654_10016336 | 3300025911 | Bacteria | 3864 |
| 240 | Ga0207654_10938003 | 3300025911 | Bacteria | 628 |
| 241 | Ga0207695_11494871 | 3300025913 | Bacteria | 556 |
| 242 | Ga0207671_10063989 | 3300025914 | Bacteria | 2734 |
| 243 | Ga0207693_10000705 | 3300025915 | Bacteria | 30041 |
| 244 | Ga0207693_10014488 | 3300025915 | Bacteria | 6337 |
| 245 | Ga0207663_10012077 | 3300025916 | Bacteria | 4657 |
| 246 | Ga0207663_10036477 | 3300025916 | Bacteria | 2958 |
| 247 | Ga0207663_10223299 | 3300025916 | Bacteria | 1372 |
| 248 | Ga0207660_10212161 | 3300025917 | Bacteria | 1517 |
| 249 | Ga0207662_10042550 | 3300025918 | Bacteria | 2678 |
| 250 | Ga0207657_10264694 | 3300025919 | Bacteria | 1368 |
| 251 | Ga0207681_10019220 | 3300025923 | Bacteria | 4315 |
| 252 | Ga0207694_10407905 | 3300025924 | Bacteria | 1130 |
| 253 | Ga0207694_10752049 | 3300025924 | Bacteria | 823 |
| 254 | Ga0207659_10645944 | 3300025926 | Bacteria | 904 |
| 255 | Ga0207659_11221445 | 3300025926 | Bacteria | 646 |
| 256 | Ga0207687_10002750 | 3300025927 | Bacteria | 11926 |
| 257 | Ga0207687_10245396 | 3300025927 | Bacteria | 1421 |
| 258 | Ga0207700_10761709 | 3300025928 | Bacteria | 865 |
| 259 | Ga0207664_10116929 | 3300025929 | Bacteria | 2225 |
| 260 | Ga0207664_10881835 | 3300025929 | Bacteria | 804 |
| 261 | Ga0207664_11108804 | 3300025929 | Bacteria | 707 |
| 262 | Ga0207644_10484073 | 3300025931 | Bacteria | 1019 |
| 263 | Ga0207690_10157873 | 3300025932 | Bacteria | 1688 |
| 264 | Ga0207706_10122796 | 3300025933 | Bacteria | 2284 |
| 265 | Ga0207706_10142306 | 3300025933 | Bacteria | 2110 |
| 266 | Ga0207686_10040315 | 3300025934 | Bacteria | 2838 |
| 267 | Ga0207686_11613863 | 3300025934 | Bacteria | 536 |
| 268 | Ga0207709_10008492 | 3300025935 | Bacteria | 5681 |
| 269 | Ga0207709_10383785 | 3300025935 | Bacteria | 1070 |
| 270 | Ga0207670_11524807 | 3300025936 | Bacteria | 568 |
| 271 | Ga0207669_10000318 | 3300025937 | Bacteria | 22011 |
| 272 | Ga0207669_10013923 | 3300025937 | Bacteria | 4015 |
| 273 | Ga0207669_10596041 | 3300025937 | Bacteria | 897 |
| 274 | Ga0207704_10001564 | 3300025938 | Bacteria | 10254 |
| 275 | Ga0207665_10136793 | 3300025939 | Bacteria | 1744 |
| 276 | Ga0207665_10501737 | 3300025939 | Bacteria | 937 |
| 277 | Ga0207691_10497271 | 3300025940 | Bacteria | 1036 |
| 278 | Ga0207711_10072577 | 3300025941 | Bacteria | 2990 |
| 279 | Ga0207711_10336827 | 3300025941 | Bacteria | 1396 |
| 280 | Ga0207711_10556838 | 3300025941 | Bacteria | 1069 |
| 281 | Ga0207689_10008722 | 3300025942 | Bacteria | 8823 |
| 282 | Ga0207689_10052197 | 3300025942 | Bacteria | 3370 |
| 283 | Ga0207679_12120200 | 3300025945 | Bacteria | 511 |
| 284 | Ga0207667_10084343 | 3300025949 | Bacteria | 3289 |
| 285 | Ga0207651_10192997 | 3300025960 | Bacteria | 1626 |
| 286 | Ga0207712_10097042 | 3300025961 | Bacteria | 2183 |
| 287 | Ga0207712_10147110 | 3300025961 | Bacteria | 1815 |
| 288 | Ga0207668_10063791 | 3300025972 | Bacteria | 2600 |
| 289 | Ga0207668_10751311 | 3300025972 | Bacteria | 860 |
| 290 | Ga0207640_10000920 | 3300025981 | Bacteria | 16509 |
| 291 | Ga0207658_10007579 | 3300025986 | Bacteria | 7394 |
| 292 | Ga0207658_10307397 | 3300025986 | Bacteria | 1368 |
| 293 | Ga0207677_10001170 | 3300026023 | Bacteria | 14261 |
| 294 | Ga0207677_10067731 | 3300026023 | Bacteria | 2502 |
| 295 | Ga0207703_10018029 | 3300026035 | Bacteria | 5513 |
| 296 | Ga0207703_10484620 | 3300026035 | Bacteria | 1159 |
| 297 | Ga0207703_10889197 | 3300026035 | Bacteria | 853 |
| 298 | Ga0207639_10072000 | 3300026041 | Bacteria | 2706 |
| 299 | Ga0207639_10117959 | 3300026041 | Bacteria | 2175 |
| 300 | Ga0207678_10003485 | 3300026067 | Bacteria | 14158 |
| 301 | Ga0207708_10003132 | 3300026075 | Bacteria | 12174 |
| 302 | Ga0207708_10078454 | 3300026075 | Bacteria | 2536 |
| 303 | Ga0207648_10010874 | 3300026089 | Bacteria | 8603 |
| 304 | Ga0207648_12208047 | 3300026089 | Bacteria | 511 |
| 305 | Ga0207675_100000941 | 3300026118 | Bacteria | 29074 |
| 306 | Ga0207675_100020330 | 3300026118 | Bacteria | 6189 |
| 307 | Ga0207683_10027074 | 3300026121 | Bacteria | 4955 |
| 308 | Ga0207698_10132787 | 3300026142 | Bacteria | 2131 |
| 309 | Ga0207698_12700485 | 3300026142 | Bacteria | 505 |
| 310 | Ga0268266_10033590 | 3300028379 | Bacteria | 4361 |
| 311 | Ga0268266_10049602 | 3300028379 | Bacteria | 3600 |
| 312 | Ga0268266_11983100 | 3300028379 | Bacteria | 556 |
| 313 | Ga0268265_10005537 | 3300028380 | Bacteria | 8621 |
| 314 | Ga0268264_10004799 | 3300028381 | Bacteria | 11468 |
| 315 | Ga0268264_10168335 | 3300028381 | Bacteria | 1980 |
| 316 | Ga0265327_10000081 | 3300031251 | Bacteria | 205988 |
| 317 | Ga0265327_10009711 | 3300031251 | Bacteria | 6892 |
| 318 | Ga0307408_102457974 | 3300031548 | Bacteria | 506 |
| 319 | Ga0316579_10506410 | 3300031691 | Bacteria | 584 |
| 320 | Ga0316578_10329255 | 3300031728 | Bacteria | 911 |
| 321 | Ga0307406_10099386 | 3300031901 | Bacteria | 1978 |
| 322 | Ga0307406_10412082 | 3300031901 | Bacteria | 1074 |
| 323 | Ga0307406_11427850 | 3300031901 | Bacteria | 607 |
| 324 | Ga0307416_103678548 | 3300032002 | Bacteria | 513 |
| 325 | Ga0307414_12051271 | 3300032004 | Bacteria | 534 |
| 326 | Ga0307415_100239738 | 3300032126 | Bacteria | 1466 |
| 327 | Ga0373928_0064638 | 3300035084 | Bacteria | 892 |
| 328 | Ga0373929_0220861 | 3300035085 | Bacteria | 539 |
| 329 | Ga0373940_0145333 | 3300035088 | Bacteria | 752 |
| 330 | Ga0373952_0250296 | 3300035092 | Bacteria | 536 |
| 331 | Ga0373941_0139590 | 3300035115 | Bacteria | 880 |
| 332 | Ga0373960_0249558 | 3300035121 | Bacteria | 644 |
| 333 | Ga0373942_0073698 | 3300035207 | Bacteria | 1002 |
| 334 | Ga0373961_0221235 | 3300035241 | Bacteria | 675 |
| 335 | Ga0316574_0383710 | 3300035398 | Bacteria | 886 |
| 336 | Ga0373931_0020790 | 3300035691 | Bacteria | 3286 |
| 337 | Ga0373931_0662850 | 3300035691 | Bacteria | 686 |
| 338 | Ga0316584_0120309 | 3300036712 | Bacteria | 1962 |
| 339 | Ga0436364_0273491 | 3300037853 | Bacteria | 1628 |
| 340 | Ga0436364_0610518 | 3300037853 | Bacteria | 13173 |
| 341 | Ga0436364_1115493 | 3300037853 | Bacteria | 769 |
| 342 | Ga0436365_0280180 | 3300039437 | Bacteria | 835 |
| 343 | Ga0436365_1696994 | 3300039437 | Bacteria | 4160 |
| 344 | Ga0436365_1896310 | 3300039437 | Bacteria | 4303 |
| 345 | Ga0436360_0497156 | 3300039438 | Bacteria | 1076 |
| 346 | Ga0436360_0729409 | 3300039438 | Bacteria | 501 |
| 347 | Ga0436361_0638357 | 3300039447 | Bacteria | 553 |
| 348 | Ga0436361_0897672 | 3300039447 | Bacteria | 832 |
| 349 | Ga0436363_0130242 | 3300039450 | Bacteria | 2167 |
| 350 | Ga0439461_0000435 | 3300041410 | Bacteria | 6003 |
| 351 | Ga0439466_0017914 | 3300041411 | Bacteria | 2546 |
| 352 | Ga0439465_0009389 | 3300041413 | Bacteria | 3080 |
| 353 | Ga0439431_0002555 | 3300041997 | Bacteria | 4017 |
| 354 | Ga0439445_0001715 | 3300042004 | Bacteria | 4820 |
| 355 | Ga0439448_0297977 | 3300042005 | Bacteria | 572 |
| 356 | Ga0439434_0020654 | 3300042435 | Bacteria | 1978 |
| 357 | Ga0466969_0141606 | 3300044656 | Bacteria | 1111 |
| 358 | Ga0466969_0394524 | 3300044656 | Bacteria | 628 |
| 359 | Ga0466969_0516392 | 3300044656 | Bacteria | 546 |
| 360 | Ga0466972_0022960 | 3300044658 | Bacteria | 3104 |
| 361 | Ga0466972_0260320 | 3300044658 | Bacteria | 811 |
| 362 | Ga0466972_0311424 | 3300044658 | Bacteria | 736 |
| 363 | Ga0466965_0000977 | 3300044683 | Bacteria | 11071 |
| 364 | Ga0466965_0008391 | 3300044683 | Bacteria | 4779 |
| 365 | Ga0466965_0384490 | 3300044683 | Bacteria | 773 |
| 366 | Ga0466966_0030434 | 3300044684 | Bacteria | 3506 |
| 367 | Ga0466966_0033245 | 3300044684 | Bacteria | 3339 |
| 368 | Ga0466961_0049072 | 3300044693 | Bacteria | 2698 |
| 369 | Ga0466961_0202714 | 3300044693 | Bacteria | 1226 |
| 370 | Ga0466963_0053388 | 3300044694 | Bacteria | 2683 |
| 371 | Ga0466963_1307540 | 3300044694 | Bacteria | 509 |
| 372 | Ga0466964_0126579 | 3300044706 | Bacteria | 1158 |
| 373 | Ga0466964_0262692 | 3300044706 | Bacteria | 856 |
| 374 | Ga0466964_0444635 | 3300044706 | Bacteria | 686 |
| 375 | Ga0466964_0767852 | 3300044706 | Bacteria | 542 |
| 376 | Ga0466971_0087548 | 3300044719 | Bacteria | 1424 |
| 377 | Ga0466971_0229653 | 3300044719 | Bacteria | 881 |
| 378 | Ga0466968_0001250 | 3300044735 | Bacteria | 9032 |
| 379 | Ga0466968_0005889 | 3300044735 | Bacteria | 4602 |
| 380 | Ga0466968_0141465 | 3300044735 | Bacteria | 1101 |
| 381 | Ga0466968_0299122 | 3300044735 | Bacteria | 773 |
| 382 | Ga0466970_0020643 | 3300044765 | Bacteria | 3424 |
| 383 | Ga0466970_0136300 | 3300044765 | Bacteria | 1350 |
| 384 | Ga0466970_0172418 | 3300044765 | Bacteria | 1199 |
| 385 | Ga0466957_0004000 | 3300044842 | Bacteria | 8149 |
| 386 | Ga0466957_0019061 | 3300044842 | Bacteria | 4034 |
| 387 | Ga0466957_0145888 | 3300044842 | Bacteria | 1528 |
| 388 | Ga0466957_0561008 | 3300044842 | Bacteria | 796 |
| 389 | Ga0466957_0669524 | 3300044842 | Bacteria | 731 |
| 390 | Ga0466960_0000150 | 3300044901 | Bacteria | 23737 |
| 391 | Ga0466960_0015817 | 3300044901 | Bacteria | 3260 |
| 392 | Ga0466959_0008385 | 3300045049 | Bacteria | 7304 |
| 393 | Ga0466959_0008423 | 3300045049 | Bacteria | 7291 |
| 394 | Ga0466959_0023497 | 3300045049 | Bacteria | 4561 |
| 395 | Ga0466958_0036476 | 3300045836 | Bacteria | 2943 |
| 396 | Ga0466958_0212903 | 3300045836 | Bacteria | 1232 |
| 397 | Ga0466958_0429535 | 3300045836 | Bacteria | 854 |
| 398 | Ga0466958_0437539 | 3300045836 | Bacteria | 846 |
| 399 | Ga0466958_0643682 | 3300045836 | Bacteria | 690 |
| 400 | Ga0466958_1087591 | 3300045836 | Bacteria | 522 |
| 401 | Ga0466958_1098780 | 3300045836 | Bacteria | 519 |
| 402 | Ga0466967_0002298 | 3300045976 | Bacteria | 11805 |
| 403 | Ga0466967_0008237 | 3300045976 | Bacteria | 7615 |
| 404 | Ga0466967_0011056 | 3300045976 | Bacteria | 6813 |
| 405 | Ga0466967_0107084 | 3300045976 | Bacteria | 2564 |
| 406 | Ga0466967_0257249 | 3300045976 | Bacteria | 1669 |
| 407 | Ga0466967_1140213 | 3300045976 | Bacteria | 777 |
| 408 | Ga0466967_1772513 | 3300045976 | Bacteria | 615 |
| 409 | Ga0495638_0030522 | 3300046460 | Bacteria | 3469 |
| 410 | Ga0495618_0588312 | 3300046514 | Bacteria | 663 |
| 411 | Ga0495621_0519457 | 3300046539 | Bacteria | 515 |
| 412 | Ga0495649_0378951 | 3300046694 | Bacteria | 712 |
| 413 | Ga0495674_0758019 | 3300047319 | Bacteria | 758 |
| 414 | Ga0495672_0077710 | 3300047320 | Bacteria | 1859 |
| 415 | Ga0495602_0360943 | 3300048088 | Bacteria | 1046 |
| 416 | Ga0495626_0179203 | 3300048091 | Bacteria | 879 |
| 417 | Ga0496100_0027855 | 3300048903 | Bacteria | 3478 |
| 418 | Ga0496100_0522999 | 3300048903 | Bacteria | 916 |
| 419 | Ga0496100_0646190 | 3300048903 | Bacteria | 823 |
| 420 | Ga0496101_0012357 | 3300048904 | Bacteria | 5697 |
| 421 | Ga0496101_0030556 | 3300048904 | Bacteria | 3779 |
| 422 | Ga0496101_0119027 | 3300048904 | Bacteria | 1995 |
| 423 | Ga0496101_0143376 | 3300048904 | Bacteria | 1822 |
| 424 | Ga0496101_0764148 | 3300048904 | Bacteria | 762 |
| 425 | Ga0496102_0005951 | 3300048905 | Bacteria | 10387 |
| 426 | Ga0496102_0173271 | 3300048905 | Bacteria | 2031 |
| 427 | Ga0496102_0430388 | 3300048905 | Bacteria | 1239 |
| 428 | Ga0496103_0000932 | 3300048906 | Bacteria | 20970 |
| 429 | Ga0496104_0100919 | 3300048907 | Bacteria | 2763 |
| 430 | Ga0496104_0221836 | 3300048907 | Bacteria | 1803 |
| 431 | Ga0496104_0544049 | 3300048907 | Bacteria | 1072 |
| 432 | Ga0496104_0580203 | 3300048907 | Bacteria | 1032 |
| 433 | Ga0496105_0072825 | 3300048908 | Bacteria | 2839 |
| 434 | Ga0496106_0009592 | 3300048909 | Bacteria | 7146 |
| 435 | Ga0496106_0038341 | 3300048909 | Bacteria | 3585 |
| 436 | Ga0496106_0081969 | 3300048909 | Bacteria | 2479 |
| 437 | Ga0496106_0252927 | 3300048909 | Bacteria | 1409 |
| 438 | Ga0496106_0325178 | 3300048909 | Bacteria | 1234 |
| 439 | Ga0496106_1038721 | 3300048909 | Bacteria | 644 |
| 440 | Ga0496107_0001310 | 3300048910 | Bacteria | 15256 |
| 441 | Ga0496107_0208427 | 3300048910 | Bacteria | 1453 |
| 442 | Ga0496108_0000404 | 3300048911 | Bacteria | 35603 |
| 443 | Ga0496108_0129414 | 3300048911 | Bacteria | 2170 |
| 444 | Ga0496108_0268994 | 3300048911 | Bacteria | 1483 |
| 445 | Ga0496109_0000670 | 3300048912 | Bacteria | 28362 |
| 446 | Ga0496109_0049676 | 3300048912 | Bacteria | 3820 |
| 447 | Ga0496109_0610993 | 3300048912 | Bacteria | 1027 |
| 448 | Ga0496110_0097586 | 3300048913 | Bacteria | 2633 |
| 449 | Ga0496110_1013782 | 3300048913 | Bacteria | 738 |
| 450 | Ga0496111_0490113 | 3300048914 | Bacteria | 905 |
| 451 | Ga0496111_1298238 | 3300048914 | Bacteria | 513 |
| 452 | Ga0496112_0068714 | 3300048915 | Bacteria | 3499 |
| 453 | Ga0496112_0516874 | 3300048915 | Bacteria | 1129 |
| 454 | Ga0496112_0795893 | 3300048915 | Bacteria | 870 |
| 455 | Ga0496113_0043659 | 3300048916 | Bacteria | 3318 |
| 456 | Ga0496114_0002700 | 3300048917 | Bacteria | 13558 |
| 457 | Ga0496114_0169767 | 3300048917 | Bacteria | 1901 |
| 458 | Ga0496114_0285102 | 3300048917 | Bacteria | 1457 |
| 459 | Ga0496114_0694585 | 3300048917 | Bacteria | 893 |
| 460 | Ga0496115_0020339 | 3300048918 | Bacteria | 5119 |
| 461 | Ga0496115_0531507 | 3300048918 | Bacteria | 942 |
| 462 | Ga0496115_0537960 | 3300048918 | Bacteria | 935 |
| 463 | Ga0496117_0564341 | 3300048920 | Bacteria | 539 |
| 464 | Ga0496119_0090437 | 3300048922 | Bacteria | 1741 |
| 465 | Ga0496122_0024627 | 3300048925 | Bacteria | 5261 |
| 466 | Ga0496123_0006092 | 3300048926 | Bacteria | 11831 |
| 467 | Ga0496125_0395886 | 3300048928 | Bacteria | 809 |
| 468 | Ga0496126_0006189 | 3300048929 | Bacteria | 13394 |
| 469 | Ga0496126_0158087 | 3300048929 | Bacteria | 1938 |
| 470 | Ga0501031_0261930 | 3300049568 | Bacteria | 1123 |
| 471 | Ga0501032_0008663 | 3300049569 | Bacteria | 7413 |
| 472 | Ga0501032_0016051 | 3300049569 | Bacteria | 5273 |
| 473 | Ga0501032_0026234 | 3300049569 | Bacteria | 4010 |
| 474 | Ga0501033_0088689 | 3300049570 | Bacteria | 2263 |
| 475 | Ga0501033_0139368 | 3300049570 | Bacteria | 1754 |
| 476 | Ga0501033_0170475 | 3300049570 | Bacteria | 1563 |
| 477 | Ga0501034_0002996 | 3300049571 | Bacteria | 19542 |
| 478 | Ga0501034_0013493 | 3300049571 | Bacteria | 8411 |
| 479 | Ga0501034_0048428 | 3300049571 | Bacteria | 4289 |
| 480 | Ga0501036_0009512 | 3300049572 | Bacteria | 7996 |
| 481 | Ga0501036_0111723 | 3300049572 | Bacteria | 2309 |
| 482 | Ga0501036_0555674 | 3300049572 | Bacteria | 954 |
| 483 | Ga0501037_0005727 | 3300049573 | Bacteria | 9068 |
| 484 | Ga0501037_0017959 | 3300049573 | Bacteria | 5206 |
| 485 | Ga0501037_0079814 | 3300049573 | Bacteria | 2375 |
| 486 | Ga0501038_0046860 | 3300049574 | Bacteria | 3746 |
| 487 | Ga0501038_0334922 | 3300049574 | Bacteria | 1181 |
| 488 | Ga0501038_0728780 | 3300049574 | Bacteria | 741 |
| 489 | Ga0501039_0001425 | 3300049575 | Bacteria | 17614 |
| 490 | Ga0501039_0772481 | 3300049575 | Bacteria | 750 |
| 491 | Ga0501043_0000337 | 3300049579 | Bacteria | 42520 |
| 492 | Ga0501043_0271960 | 3300049579 | Bacteria | 1300 |
| 493 | Ga0501043_0532674 | 3300049579 | Bacteria | 874 |
| 494 | Ga0501046_0008004 | 3300049580 | Bacteria | 9238 |
| 495 | Ga0501047_0002406 | 3300049581 | Bacteria | 17883 |
| 496 | Ga0501047_0012600 | 3300049581 | Bacteria | 8011 |
| 497 | Ga0501047_0126125 | 3300049581 | Bacteria | 2440 |
| 498 | Ga0501047_0276401 | 3300049581 | Bacteria | 1525 |
| 499 | Ga0501048_0568694 | 3300049582 | Bacteria | 813 |
| 500 | Ga0501048_1113764 | 3300049582 | Bacteria | 568 |
| 501 | Ga0501067_0098142 | 3300049583 | Bacteria | 1627 |
| 502 | Ga0501068_0057078 | 3300049584 | Bacteria | 2367 |
| 503 | Ga0501069_0022738 | 3300049585 | Bacteria | 3414 |
| 504 | Ga0501069_0035338 | 3300049585 | Bacteria | 2753 |
| 505 | Ga0501070_0000642 | 3300049586 | Bacteria | 32168 |
| 506 | Ga0501070_0005878 | 3300049586 | Bacteria | 10463 |
| 507 | Ga0501070_0809585 | 3300049586 | Bacteria | 735 |
| 508 | Ga0501071_0253507 | 3300049587 | Bacteria | 1329 |
| 509 | Ga0501073_0016559 | 3300049589 | Bacteria | 5343 |
| 510 | Ga0501077_0714166 | 3300049593 | Bacteria | 644 |
| 511 | Ga0501080_0095347 | 3300049742 | Bacteria | 2763 |
| 512 | Ga0501035_0000279 | 3300049822 | Bacteria | 60584 |
| 513 | Ga0501035_0004831 | 3300049822 | Bacteria | 12782 |
| 514 | Ga0501044_0000637 | 3300049823 | Bacteria | 42365 |
| 515 | Ga0501044_0003653 | 3300049823 | Bacteria | 17312 |
| 516 | Ga0501044_0014514 | 3300049823 | Bacteria | 8498 |
| 517 | Ga0501044_0033874 | 3300049823 | Bacteria | 5363 |
| 518 | Ga0501044_0071845 | 3300049823 | Bacteria | 3519 |
| 519 | nmdc:mga03683_233901_c1 | 3300050489 | Bacteria | 850 |
| 520 | nmdc:mga03683_258155_c1 | 3300050489 | Bacteria | 810 |
| 521 | nmdc:mga03n38_778012_c1 | 3300050490 | Bacteria | 556 |
| 522 | nmdc:mga03n38_83293_c1 | 3300050490 | Bacteria | 1508 |
| 523 | nmdc:mga03n38_950027_c1 | 3300050490 | Bacteria | 507 |
| 524 | nmdc:mga00v17_178913_c1 | 3300050491 | Bacteria | 958 |
| 525 | nmdc:mga00v17_33218_c1 | 3300050491 | Bacteria | 2544 |
| 526 | nmdc:mga00v17_3681_c1 | 3300050491 | Bacteria | 7919 |
| 527 | nmdc:mga0yw44_104045_c1 | 3300050492 | Bacteria | 1811 |
| 528 | nmdc:mga0yw44_155474_c1 | 3300050492 | Bacteria | 1494 |
| 529 | nmdc:mga0yw44_181596_c1 | 3300050492 | Bacteria | 1385 |
| 530 | nmdc:mga0yw44_28241_c1 | 3300050492 | Bacteria | 3225 |
| 531 | nmdc:mga0yw44_516685_c1 | 3300050492 | Bacteria | 810 |
| 532 | nmdc:mga07m45_25292_c1 | 3300050496 | Bacteria | 3255 |
| 533 | nmdc:mga07m45_499923_c1 | 3300050496 | Bacteria | 704 |
| 534 | nmdc:mga0sz30_26439_c2 | 3300050516 | Bacteria | 1991 |
| 535 | nmdc:mga0sz30_505175_c1 | 3300050516 | Bacteria | 544 |
| 536 | nmdc:mga0sz30_507492_c1 | 3300050516 | Bacteria | 543 |
| 537 | Ga0495601_0845506 | 3300053077 | Bacteria | 580 |
| 538 | Ga0500635_0005811 | 3300053080 | Bacteria | 3263 |
| 539 | Ga0500635_0448813 | 3300053080 | Bacteria | 511 |
| 540 | Ga0495655_0035940 | 3300053083 | Bacteria | 1236 |
| 541 | Ga0500643_043243 | 3300053087 | Bacteria | 1314 |
| 542 | Ga0500583_0450319 | 3300053092 | Bacteria | 611 |
| 543 | Ga0500641_0042822 | 3300053096 | Bacteria | 1836 |
| 544 | Ga0500641_0220558 | 3300053096 | Bacteria | 804 |
| 545 | Ga0500594_0199295 | 3300053118 | Bacteria | 657 |
| 546 | Ga0500652_000985 | 3300053131 | Bacteria | 9378 |
| 547 | Ga0500652_022549 | 3300053131 | Bacteria | 2384 |
| 548 | Ga0500559_0164184 | 3300053136 | Bacteria | 1044 |
| 549 | Ga0500559_0438984 | 3300053136 | Bacteria | 604 |
| 550 | Ga0500568_0304617 | 3300053139 | Bacteria | 578 |
| 551 | Ga0500622_0427570 | 3300053156 | Bacteria | 532 |
| 552 | Ga0500627_0050332 | 3300053158 | Bacteria | 1814 |
| 553 | Ga0500645_000030 | 3300053730 | Bacteria | 121213 |
| 554 | Ga0500645_040989 | 3300053730 | Bacteria | 1368 |
| 555 | Ga0466962_0011963 | 3300061719 | Bacteria | 4174 |
| 556 | Ga0466962_0013769 | 3300061719 | Bacteria | 3894 |
| 557 | Ga0466962_0236493 | 3300061719 | Bacteria | 896 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0610518 | Ga0436364_0610518_6678_6881 | 62 |
| 2 | 3300039437 | Ga0436365_1696994 | Ga0436365_1696994_1422_1625 | 62 |
| 3 | 3300039447 | Ga0436361_0897672 | Ga0436361_0897672_586_792 | 62 |
| 4 | iso_pu_bacteria | 2751185725 | 2753038653 | 64 |
| 5 | iso_pu_bacteria | 2751185792 | 2753327165 | 64 |
| 6 | 3300006177 | Ga0075362_10007434 | Ga0075362_100074345 | 66 |
| 7 | 3300050489 | nmdc:mga03683_233901_c1 | nmdc:mga03683_233901_c1_303_533 | 66 |
| 8 | 3300050489 | nmdc:mga03683_258155_c1 | nmdc:mga03683_258155_c1_122_337 | 66 |
| 9 | 3300050516 | nmdc:mga0sz30_507492_c1 | nmdc:mga0sz30_507492_c1_258_473 | 66 |
| 10 | 3300005367 | Ga0070667_100066477 | Ga0070667_1000664774 | 68 |
| 11 | 3300005544 | Ga0070686_100271670 | Ga0070686_1002716702 | 68 |
| 12 | 3300005843 | Ga0068860_102788905 | Ga0068860_1027889052 | 68 |
| 13 | 3300009553 | Ga0105249_10032430 | Ga0105249_100324302 | 68 |
| 14 | 3300014325 | Ga0163163_10465955 | Ga0163163_104659551 | 68 |
| 15 | 3300014497 | Ga0182008_10514743 | Ga0182008_105147432 | 68 |
| 16 | 3300014968 | Ga0157379_10252695 | Ga0157379_102526951 | 68 |
| 17 | 3300039438 | Ga0436360_0497156 | Ga0436360_0497156_323_562 | 68 |
| 18 | 3300039447 | Ga0436361_0638357 | Ga0436361_0638357_97_336 | 68 |
| 19 | 3300048920 | Ga0496117_0564341 | Ga0496117_0564341_95_328 | 68 |
| 20 | 3300006038 | Ga0075365_10011492 | Ga0075365_100114922 | 69 |
| 21 | 3300006048 | Ga0075363_100296835 | Ga0075363_1002968352 | 69 |
| 22 | 3300009545 | Ga0105237_11395220 | Ga0105237_113952201 | 69 |
| 23 | 3300049581 | Ga0501047_0126125 | Ga0501047_0126125_1970_2206 | 69 |
| 24 | 3300049585 | Ga0501069_0022738 | Ga0501069_0022738_11_247 | 69 |
| 25 | 3300049586 | Ga0501070_0809585 | Ga0501070_0809585_42_278 | 69 |
| 26 | 3300050490 | nmdc:mga03n38_950027_c1 | nmdc:mga03n38_950027_c1_199_435 | 69 |
| 27 | 3300001989 | JGI24739J22299_10149906 | JGI24739J22299_101499062 | 70 |
| 28 | 3300001991 | JGI24743J22301_10013785 | JGI24743J22301_100137851 | 70 |
| 29 | 3300001991 | JGI24743J22301_10026481 | JGI24743J22301_100264812 | 70 |
| 30 | 3300002070 | JGI24750J21931_1064298 | JGI24750J21931_10642981 | 70 |
| 31 | 3300002073 | JGI24745J21846_1005539 | JGI24745J21846_10055392 | 70 |
| 32 | 3300002073 | JGI24745J21846_1023849 | JGI24745J21846_10238492 | 70 |
| 33 | 3300002074 | JGI24748J21848_1003107 | JGI24748J21848_10031073 | 70 |
| 34 | 3300002075 | JGI24738J21930_10031244 | JGI24738J21930_100312442 | 70 |
| 35 | 3300002076 | JGI24749J21850_1036210 | JGI24749J21850_10362102 | 70 |
| 36 | 3300002077 | JGI24744J21845_10000326 | JGI24744J21845_100003269 | 70 |
| 37 | 3300002077 | JGI24744J21845_10007820 | JGI24744J21845_100078203 | 70 |
| 38 | 3300002239 | JGI24034J26672_10002872 | JGI24034J26672_100028721 | 70 |
| 39 | 3300002239 | JGI24034J26672_10065718 | JGI24034J26672_100657182 | 70 |
| 40 | 3300002239 | JGI24034J26672_10109193 | JGI24034J26672_101091931 | 70 |
| 41 | 3300002244 | JGI24742J22300_10034482 | JGI24742J22300_100344822 | 70 |
| 42 | 3300002244 | JGI24742J22300_10035213 | JGI24742J22300_100352132 | 70 |
| 43 | 3300005328 | Ga0070676_10005389 | Ga0070676_100053893 | 70 |
| 44 | 3300005330 | Ga0070690_100093070 | Ga0070690_1000930703 | 70 |
| 45 | 3300005333 | Ga0070677_10277549 | Ga0070677_102775492 | 70 |
| 46 | 3300005334 | Ga0068869_100022937 | Ga0068869_1000229375 | 70 |
| 47 | 3300005334 | Ga0068869_100304569 | Ga0068869_1003045691 | 70 |
| 48 | 3300005334 | Ga0068869_101962096 | Ga0068869_1019620961 | 70 |
| 49 | 3300005335 | Ga0070666_10070086 | Ga0070666_100700863 | 70 |
| 50 | 3300005335 | Ga0070666_10571337 | Ga0070666_105713371 | 70 |
| 51 | 3300005336 | Ga0070680_100346574 | Ga0070680_1003465742 | 70 |
| 52 | 3300005337 | Ga0070682_100073685 | Ga0070682_1000736852 | 70 |
| 53 | 3300005337 | Ga0070682_100908613 | Ga0070682_1009086132 | 70 |
| 54 | 3300005338 | Ga0068868_100005485 | Ga0068868_1000054859 | 70 |
| 55 | 3300005339 | Ga0070660_100340161 | Ga0070660_1003401612 | 70 |
| 56 | 3300005339 | Ga0070660_100440923 | Ga0070660_1004409231 | 70 |
| 57 | 3300005339 | Ga0070660_100487332 | Ga0070660_1004873322 | 70 |
| 58 | 3300005340 | Ga0070689_100093245 | Ga0070689_1000932451 | 70 |
| 59 | 3300005340 | Ga0070689_102154154 | Ga0070689_1021541542 | 70 |
| 60 | 3300005341 | Ga0070691_10001448 | Ga0070691_100014485 | 70 |
| 61 | 3300005341 | Ga0070691_10036792 | Ga0070691_100367923 | 70 |
| 62 | 3300005344 | Ga0070661_101358241 | Ga0070661_1013582412 | 70 |
| 63 | 3300005345 | Ga0070692_10203194 | Ga0070692_102031941 | 70 |
| 64 | 3300005347 | Ga0070668_100000568 | Ga0070668_10000056810 | 70 |
| 65 | 3300005347 | Ga0070668_100158634 | Ga0070668_1001586342 | 70 |
| 66 | 3300005347 | Ga0070668_100964326 | Ga0070668_1009643262 | 70 |
| 67 | 3300005347 | Ga0070668_101999122 | Ga0070668_1019991222 | 70 |
| 68 | 3300005347 | Ga0070668_102214655 | Ga0070668_1022146551 | 70 |
| 69 | 3300005353 | Ga0070669_100009018 | Ga0070669_1000090187 | 70 |
| 70 | 3300005355 | Ga0070671_100447989 | Ga0070671_1004479893 | 70 |
| 71 | 3300005356 | Ga0070674_100208716 | Ga0070674_1002087162 | 70 |
| 72 | 3300005356 | Ga0070674_100228360 | Ga0070674_1002283601 | 70 |
| 73 | 3300005364 | Ga0070673_100136666 | Ga0070673_1001366662 | 70 |
| 74 | 3300005365 | Ga0070688_100015882 | Ga0070688_1000158825 | 70 |
| 75 | 3300005365 | Ga0070688_101481042 | Ga0070688_1014810421 | 70 |
| 76 | 3300005366 | Ga0070659_100099965 | Ga0070659_1000999654 | 70 |
| 77 | 3300005366 | Ga0070659_100509377 | Ga0070659_1005093771 | 70 |
| 78 | 3300005367 | Ga0070667_100018217 | Ga0070667_1000182176 | 70 |
| 79 | 3300005367 | Ga0070667_100218834 | Ga0070667_1002188343 | 70 |
| 80 | 3300005434 | Ga0070709_11009046 | Ga0070709_110090461 | 70 |
| 81 | 3300005435 | Ga0070714_100043677 | Ga0070714_1000436773 | 70 |
| 82 | 3300005435 | Ga0070714_100234486 | Ga0070714_1002344862 | 70 |
| 83 | 3300005435 | Ga0070714_100399721 | Ga0070714_1003997213 | 70 |
| 84 | 3300005435 | Ga0070714_100582117 | Ga0070714_1005821172 | 70 |
| 85 | 3300005435 | Ga0070714_101695198 | Ga0070714_1016951982 | 70 |
| 86 | 3300005436 | Ga0070713_100114593 | Ga0070713_1001145933 | 70 |
| 87 | 3300005436 | Ga0070713_100691974 | Ga0070713_1006919742 | 70 |
| 88 | 3300005437 | Ga0070710_10000932 | Ga0070710_1000093210 | 70 |
| 89 | 3300005437 | Ga0070710_10034170 | Ga0070710_100341703 | 70 |
| 90 | 3300005437 | Ga0070710_10073090 | Ga0070710_100730902 | 70 |
| 91 | 3300005438 | Ga0070701_10003743 | Ga0070701_100037436 | 70 |
| 92 | 3300005439 | Ga0070711_100001643 | Ga0070711_1000016432 | 70 |
| 93 | 3300005439 | Ga0070711_100876414 | Ga0070711_1008764142 | 70 |
| 94 | 3300005440 | Ga0070705_100073895 | Ga0070705_1000738952 | 70 |
| 95 | 3300005440 | Ga0070705_101444344 | Ga0070705_1014443442 | 70 |
| 96 | 3300005441 | Ga0070700_100002582 | Ga0070700_1000025827 | 70 |
| 97 | 3300005441 | Ga0070700_100736146 | Ga0070700_1007361462 | 70 |
| 98 | 3300005444 | Ga0070694_100583328 | Ga0070694_1005833281 | 70 |
| 99 | 3300005455 | Ga0070663_100094540 | Ga0070663_1000945402 | 70 |
| 100 | 3300005455 | Ga0070663_100383312 | Ga0070663_1003833122 | 70 |
| 101 | 3300005456 | Ga0070678_100070238 | Ga0070678_1000702382 | 70 |
| 102 | 3300005456 | Ga0070678_100103789 | Ga0070678_1001037893 | 70 |
| 103 | 3300005456 | Ga0070678_100255189 | Ga0070678_1002551892 | 70 |
| 104 | 3300005456 | Ga0070678_100378025 | Ga0070678_1003780253 | 70 |
| 105 | 3300005457 | Ga0070662_100539258 | Ga0070662_1005392582 | 70 |
| 106 | 3300005457 | Ga0070662_101321408 | Ga0070662_1013214082 | 70 |
| 107 | 3300005459 | Ga0068867_100010113 | Ga0068867_1000101137 | 70 |
| 108 | 3300005459 | Ga0068867_101379143 | Ga0068867_1013791432 | 70 |
| 109 | 3300005466 | Ga0070685_10218105 | Ga0070685_102181052 | 70 |
| 110 | 3300005536 | Ga0070697_100167052 | Ga0070697_1001670522 | 70 |
| 111 | 3300005539 | Ga0068853_100010926 | Ga0068853_1000109267 | 70 |
| 112 | 3300005539 | Ga0068853_100360912 | Ga0068853_1003609122 | 70 |
| 113 | 3300005543 | Ga0070672_101695381 | Ga0070672_1016953812 | 70 |
| 114 | 3300005545 | Ga0070695_100027005 | Ga0070695_1000270055 | 70 |
| 115 | 3300005545 | Ga0070695_100116189 | Ga0070695_1001161892 | 70 |
| 116 | 3300005546 | Ga0070696_100017971 | Ga0070696_1000179713 | 70 |
| 117 | 3300005547 | Ga0070693_100012592 | Ga0070693_1000125922 | 70 |
| 118 | 3300005547 | Ga0070693_101085200 | Ga0070693_1010852001 | 70 |
| 119 | 3300005548 | Ga0070665_100027133 | Ga0070665_1000271333 | 70 |
| 120 | 3300005548 | Ga0070665_100034595 | Ga0070665_1000345953 | 70 |
| 121 | 3300005548 | Ga0070665_102091460 | Ga0070665_1020914602 | 70 |
| 122 | 3300005549 | Ga0070704_100012664 | Ga0070704_1000126641 | 70 |
| 123 | 3300005549 | Ga0070704_100368931 | Ga0070704_1003689312 | 70 |
| 124 | 3300005563 | Ga0068855_100039696 | Ga0068855_1000396962 | 70 |
| 125 | 3300005563 | Ga0068855_101779329 | Ga0068855_1017793292 | 70 |
| 126 | 3300005578 | Ga0068854_100000704 | Ga0068854_1000007049 | 70 |
| 127 | 3300005578 | Ga0068854_100602011 | Ga0068854_1006020112 | 70 |
| 128 | 3300005578 | Ga0068854_101396440 | Ga0068854_1013964402 | 70 |
| 129 | 3300005614 | Ga0068856_100269132 | Ga0068856_1002691322 | 70 |
| 130 | 3300005614 | Ga0068856_101855566 | Ga0068856_1018555662 | 70 |
| 131 | 3300005615 | Ga0070702_100027914 | Ga0070702_1000279142 | 70 |
| 132 | 3300005615 | Ga0070702_100091423 | Ga0070702_1000914232 | 70 |
| 133 | 3300005615 | Ga0070702_100421505 | Ga0070702_1004215052 | 70 |
| 134 | 3300005615 | Ga0070702_101773115 | Ga0070702_1017731151 | 70 |
| 135 | 3300005616 | Ga0068852_100080920 | Ga0068852_1000809202 | 70 |
| 136 | 3300005616 | Ga0068852_100094052 | Ga0068852_1000940522 | 70 |
| 137 | 3300005617 | Ga0068859_100005722 | Ga0068859_1000057228 | 70 |
| 138 | 3300005617 | Ga0068859_100198524 | Ga0068859_1001985243 | 70 |
| 139 | 3300005617 | Ga0068859_102217843 | Ga0068859_1022178432 | 70 |
| 140 | 3300005618 | Ga0068864_101001874 | Ga0068864_1010018742 | 70 |
| 141 | 3300005718 | Ga0068866_10001957 | Ga0068866_100019576 | 70 |
| 142 | 3300005718 | Ga0068866_10132306 | Ga0068866_101323063 | 70 |
| 143 | 3300005719 | Ga0068861_100000622 | Ga0068861_10000062225 | 70 |
| 144 | 3300005719 | Ga0068861_100118366 | Ga0068861_1001183663 | 70 |
| 145 | 3300005834 | Ga0068851_10102500 | Ga0068851_101025002 | 70 |
| 146 | 3300005842 | Ga0068858_100102636 | Ga0068858_1001026361 | 70 |
| 147 | 3300005842 | Ga0068858_100535183 | Ga0068858_1005351832 | 70 |
| 148 | 3300005842 | Ga0068858_100902568 | Ga0068858_1009025682 | 70 |
| 149 | 3300005843 | Ga0068860_100013606 | Ga0068860_1000136065 | 70 |
| 150 | 3300005843 | Ga0068860_100344139 | Ga0068860_1003441392 | 70 |
| 151 | 3300005843 | Ga0068860_100417454 | Ga0068860_1004174542 | 70 |
| 152 | 3300005844 | Ga0068862_100030020 | Ga0068862_1000300206 | 70 |
| 153 | 3300006028 | Ga0070717_11821895 | Ga0070717_118218951 | 70 |
| 154 | 3300006038 | Ga0075365_10114963 | Ga0075365_101149632 | 70 |
| 155 | 3300006038 | Ga0075365_10560495 | Ga0075365_105604952 | 70 |
| 156 | 3300006038 | Ga0075365_10673062 | Ga0075365_106730622 | 70 |
| 157 | 3300006048 | Ga0075363_100094957 | Ga0075363_1000949572 | 70 |
| 158 | 3300006048 | Ga0075363_100165959 | Ga0075363_1001659592 | 70 |
| 159 | 3300006051 | Ga0075364_10015848 | Ga0075364_100158486 | 70 |
| 160 | 3300006051 | Ga0075364_10049989 | Ga0075364_100499893 | 70 |
| 161 | 3300006051 | Ga0075364_10213810 | Ga0075364_102138102 | 70 |
| 162 | 3300006051 | Ga0075364_10288613 | Ga0075364_102886132 | 70 |
| 163 | 3300006051 | Ga0075364_10655135 | Ga0075364_106551351 | 70 |
| 164 | 3300006163 | Ga0070715_10066647 | Ga0070715_100666471 | 70 |
| 165 | 3300006173 | Ga0070716_100008355 | Ga0070716_1000083556 | 70 |
| 166 | 3300006173 | Ga0070716_100352951 | Ga0070716_1003529512 | 70 |
| 167 | 3300006173 | Ga0070716_100543756 | Ga0070716_1005437562 | 70 |
| 168 | 3300006173 | Ga0070716_100686072 | Ga0070716_1006860722 | 70 |
| 169 | 3300006175 | Ga0070712_100017986 | Ga0070712_1000179862 | 70 |
| 170 | 3300006175 | Ga0070712_100098504 | Ga0070712_1000985042 | 70 |
| 171 | 3300006186 | Ga0075369_10058053 | Ga0075369_100580532 | 70 |
| 172 | 3300006186 | Ga0075369_10064045 | Ga0075369_100640453 | 70 |
| 173 | 3300006186 | Ga0075369_10570179 | Ga0075369_105701792 | 70 |
| 174 | 3300006237 | Ga0097621_100896590 | Ga0097621_1008965902 | 70 |
| 175 | 3300006353 | Ga0075370_10045795 | Ga0075370_100457954 | 70 |
| 176 | 3300006358 | Ga0068871_100276916 | Ga0068871_1002769162 | 70 |
| 177 | 3300006881 | Ga0068865_100004019 | Ga0068865_1000040199 | 70 |
| 178 | 3300006881 | Ga0068865_100035559 | Ga0068865_1000355592 | 70 |
| 179 | 3300006931 | Ga0097620_100005722 | Ga0097620_1000057228 | 70 |
| 180 | 3300006931 | Ga0097620_100198530 | Ga0097620_1001985303 | 70 |
| 181 | 3300006931 | Ga0097620_102217525 | Ga0097620_1022175252 | 70 |
| 182 | 3300009092 | Ga0105250_10139696 | Ga0105250_101396962 | 70 |
| 183 | 3300009093 | Ga0105240_10104635 | Ga0105240_101046352 | 70 |
| 184 | 3300009093 | Ga0105240_11005306 | Ga0105240_110053062 | 70 |
| 185 | 3300009094 | Ga0111539_12317784 | Ga0111539_123177842 | 70 |
| 186 | 3300009098 | Ga0105245_10007406 | Ga0105245_1000740610 | 70 |
| 187 | 3300009098 | Ga0105245_10187766 | Ga0105245_101877662 | 70 |
| 188 | 3300009098 | Ga0105245_10942767 | Ga0105245_109427671 | 70 |
| 189 | 3300009101 | Ga0105247_10003220 | Ga0105247_100032206 | 70 |
| 190 | 3300009101 | Ga0105247_10164368 | Ga0105247_101643683 | 70 |
| 191 | 3300009101 | Ga0105247_10940859 | Ga0105247_109408592 | 70 |
| 192 | 3300009148 | Ga0105243_10007329 | Ga0105243_100073298 | 70 |
| 193 | 3300009148 | Ga0105243_10082248 | Ga0105243_100822484 | 70 |
| 194 | 3300009148 | Ga0105243_11495025 | Ga0105243_114950252 | 70 |
| 195 | 3300009148 | Ga0105243_12843284 | Ga0105243_128432841 | 70 |
| 196 | 3300009174 | Ga0105241_10025326 | Ga0105241_100253265 | 70 |
| 197 | 3300009174 | Ga0105241_10755396 | Ga0105241_107553962 | 70 |
| 198 | 3300009176 | Ga0105242_10001104 | Ga0105242_1000110424 | 70 |
| 199 | 3300009176 | Ga0105242_12618241 | Ga0105242_126182412 | 70 |
| 200 | 3300009177 | Ga0105248_10010806 | Ga0105248_100108064 | 70 |
| 201 | 3300009545 | Ga0105237_10030464 | Ga0105237_100304646 | 70 |
| 202 | 3300009545 | Ga0105237_12568820 | Ga0105237_125688201 | 70 |
| 203 | 3300009551 | Ga0105238_10210781 | Ga0105238_102107813 | 70 |
| 204 | 3300009553 | Ga0105249_10000571 | Ga0105249_100005718 | 70 |
| 205 | 3300010375 | Ga0105239_10394117 | Ga0105239_103941172 | 70 |
| 206 | 3300010375 | Ga0105239_10873966 | Ga0105239_108739662 | 70 |
| 207 | 3300011119 | Ga0105246_10023371 | Ga0105246_100233713 | 70 |
| 208 | 3300011119 | Ga0105246_11304378 | Ga0105246_113043782 | 70 |
| 209 | 3300013100 | Ga0157373_11292926 | Ga0157373_112929262 | 70 |
| 210 | 3300013102 | Ga0157371_10455848 | Ga0157371_104558482 | 70 |
| 211 | 3300013105 | Ga0157369_10122651 | Ga0157369_101226512 | 70 |
| 212 | 3300013105 | Ga0157369_10336002 | Ga0157369_103360022 | 70 |
| 213 | 3300013105 | Ga0157369_11006439 | Ga0157369_110064392 | 70 |
| 214 | 3300013297 | Ga0157378_10043733 | Ga0157378_100437335 | 70 |
| 215 | 3300013297 | Ga0157378_10232121 | Ga0157378_102321213 | 70 |
| 216 | 3300013306 | Ga0163162_10137615 | Ga0163162_101376152 | 70 |
| 217 | 3300013306 | Ga0163162_12682781 | Ga0163162_126827812 | 70 |
| 218 | 3300013307 | Ga0157372_11368680 | Ga0157372_113686802 | 70 |
| 219 | 3300013308 | Ga0157375_10042543 | Ga0157375_100425433 | 70 |
| 220 | 3300013308 | Ga0157375_10899181 | Ga0157375_108991812 | 70 |
| 221 | 3300013308 | Ga0157375_12752539 | Ga0157375_127525392 | 70 |
| 222 | 3300014325 | Ga0163163_10777345 | Ga0163163_107773451 | 70 |
| 223 | 3300014325 | Ga0163163_11198006 | Ga0163163_111980062 | 70 |
| 224 | 3300014326 | Ga0157380_10000597 | Ga0157380_100005972 | 70 |
| 225 | 3300014745 | Ga0157377_10047699 | Ga0157377_100476992 | 70 |
| 226 | 3300014745 | Ga0157377_10266754 | Ga0157377_102667543 | 70 |
| 227 | 3300014968 | Ga0157379_10018092 | Ga0157379_100180927 | 70 |
| 228 | 3300014968 | Ga0157379_10556392 | Ga0157379_105563922 | 70 |
| 229 | 3300014969 | Ga0157376_10907174 | Ga0157376_109071742 | 70 |
| 230 | 3300017792 | Ga0163161_10006021 | Ga0163161_100060212 | 70 |
| 231 | 3300017792 | Ga0163161_10578724 | Ga0163161_105787242 | 70 |
| 232 | 3300025303 | Ga0209051_1096263 | Ga0209051_10962632 | 70 |
| 233 | 3300025315 | Ga0207697_10390295 | Ga0207697_103902952 | 70 |
| 234 | 3300025321 | Ga0207656_10154169 | Ga0207656_101541692 | 70 |
| 235 | 3300025885 | Ga0207653_10033595 | Ga0207653_100335952 | 70 |
| 236 | 3300025898 | Ga0207692_10007629 | Ga0207692_100076293 | 70 |
| 237 | 3300025898 | Ga0207692_10066799 | Ga0207692_100667993 | 70 |
| 238 | 3300025898 | Ga0207692_10189941 | Ga0207692_101899412 | 70 |
| 239 | 3300025899 | Ga0207642_10000205 | Ga0207642_1000020514 | 70 |
| 240 | 3300025900 | Ga0207710_10004260 | Ga0207710_100042606 | 70 |
| 241 | 3300025900 | Ga0207710_10107289 | Ga0207710_101072892 | 70 |
| 242 | 3300025900 | Ga0207710_10333284 | Ga0207710_103332842 | 70 |
| 243 | 3300025901 | Ga0207688_10003825 | Ga0207688_100038259 | 70 |
| 244 | 3300025901 | Ga0207688_10004459 | Ga0207688_100044599 | 70 |
| 245 | 3300025903 | Ga0207680_10241784 | Ga0207680_102417842 | 70 |
| 246 | 3300025904 | Ga0207647_10013855 | Ga0207647_100138556 | 70 |
| 247 | 3300025904 | Ga0207647_10032885 | Ga0207647_100328853 | 70 |
| 248 | 3300025904 | Ga0207647_10236297 | Ga0207647_102362972 | 70 |
| 249 | 3300025905 | Ga0207685_10045627 | Ga0207685_100456273 | 70 |
| 250 | 3300025906 | Ga0207699_10079667 | Ga0207699_100796672 | 70 |
| 251 | 3300025907 | Ga0207645_10023364 | Ga0207645_100233644 | 70 |
| 252 | 3300025907 | Ga0207645_10075446 | Ga0207645_100754463 | 70 |
| 253 | 3300025908 | Ga0207643_10979186 | Ga0207643_109791862 | 70 |
| 254 | 3300025911 | Ga0207654_10016336 | Ga0207654_100163366 | 70 |
| 255 | 3300025911 | Ga0207654_10938003 | Ga0207654_109380032 | 70 |
| 256 | 3300025913 | Ga0207695_11494871 | Ga0207695_114948711 | 70 |
| 257 | 3300025914 | Ga0207671_10063989 | Ga0207671_100639892 | 70 |
| 258 | 3300025915 | Ga0207693_10000705 | Ga0207693_1000070521 | 70 |
| 259 | 3300025915 | Ga0207693_10014488 | Ga0207693_100144882 | 70 |
| 260 | 3300025916 | Ga0207663_10012077 | Ga0207663_100120775 | 70 |
| 261 | 3300025916 | Ga0207663_10036477 | Ga0207663_100364772 | 70 |
| 262 | 3300025916 | Ga0207663_10223299 | Ga0207663_102232992 | 70 |
| 263 | 3300025917 | Ga0207660_10212161 | Ga0207660_102121612 | 70 |
| 264 | 3300025918 | Ga0207662_10042550 | Ga0207662_100425503 | 70 |
| 265 | 3300025919 | Ga0207657_10264694 | Ga0207657_102646942 | 70 |
| 266 | 3300025923 | Ga0207681_10019220 | Ga0207681_100192202 | 70 |
| 267 | 3300025924 | Ga0207694_10407905 | Ga0207694_104079052 | 70 |
| 268 | 3300025924 | Ga0207694_10752049 | Ga0207694_107520492 | 70 |
| 269 | 3300025926 | Ga0207659_10645944 | Ga0207659_106459442 | 70 |
| 270 | 3300025926 | Ga0207659_11221445 | Ga0207659_112214452 | 70 |
| 271 | 3300025927 | Ga0207687_10002750 | Ga0207687_100027509 | 70 |
| 272 | 3300025927 | Ga0207687_10245396 | Ga0207687_102453962 | 70 |
| 273 | 3300025928 | Ga0207700_10761709 | Ga0207700_107617092 | 70 |
| 274 | 3300025929 | Ga0207664_10116929 | Ga0207664_101169293 | 70 |
| 275 | 3300025929 | Ga0207664_10881835 | Ga0207664_108818351 | 70 |
| 276 | 3300025929 | Ga0207664_11108804 | Ga0207664_111088042 | 70 |
| 277 | 3300025931 | Ga0207644_10484073 | Ga0207644_104840732 | 70 |
| 278 | 3300025932 | Ga0207690_10157873 | Ga0207690_101578732 | 70 |
| 279 | 3300025933 | Ga0207706_10122796 | Ga0207706_101227963 | 70 |
| 280 | 3300025933 | Ga0207706_10142306 | Ga0207706_101423063 | 70 |
| 281 | 3300025934 | Ga0207686_10040315 | Ga0207686_100403152 | 70 |
| 282 | 3300025934 | Ga0207686_11613863 | Ga0207686_116138632 | 70 |
| 283 | 3300025935 | Ga0207709_10008492 | Ga0207709_100084922 | 70 |
| 284 | 3300025935 | Ga0207709_10383785 | Ga0207709_103837852 | 70 |
| 285 | 3300025936 | Ga0207670_11524807 | Ga0207670_115248072 | 70 |
| 286 | 3300025937 | Ga0207669_10000318 | Ga0207669_1000031824 | 70 |
| 287 | 3300025937 | Ga0207669_10013923 | Ga0207669_100139232 | 70 |
| 288 | 3300025937 | Ga0207669_10596041 | Ga0207669_105960411 | 70 |
| 289 | 3300025938 | Ga0207704_10001564 | Ga0207704_100015648 | 70 |
| 290 | 3300025939 | Ga0207665_10136793 | Ga0207665_101367932 | 70 |
| 291 | 3300025939 | Ga0207665_10501737 | Ga0207665_105017372 | 70 |
| 292 | 3300025940 | Ga0207691_10497271 | Ga0207691_104972711 | 70 |
| 293 | 3300025941 | Ga0207711_10072577 | Ga0207711_100725772 | 70 |
| 294 | 3300025941 | Ga0207711_10336827 | Ga0207711_103368272 | 70 |
| 295 | 3300025941 | Ga0207711_10556838 | Ga0207711_105568382 | 70 |
| 296 | 3300025942 | Ga0207689_10008722 | Ga0207689_100087222 | 70 |
| 297 | 3300025942 | Ga0207689_10052197 | Ga0207689_100521972 | 70 |
| 298 | 3300025945 | Ga0207679_12120200 | Ga0207679_121202002 | 70 |
| 299 | 3300025949 | Ga0207667_10084343 | Ga0207667_100843434 | 70 |
| 300 | 3300025960 | Ga0207651_10192997 | Ga0207651_101929972 | 70 |
| 301 | 3300025961 | Ga0207712_10097042 | Ga0207712_100970422 | 70 |
| 302 | 3300025961 | Ga0207712_10147110 | Ga0207712_101471102 | 70 |
| 303 | 3300025972 | Ga0207668_10063791 | Ga0207668_100637915 | 70 |
| 304 | 3300025972 | Ga0207668_10751311 | Ga0207668_107513112 | 70 |
| 305 | 3300025981 | Ga0207640_10000920 | Ga0207640_1000092018 | 70 |
| 306 | 3300025986 | Ga0207658_10007579 | Ga0207658_100075792 | 70 |
| 307 | 3300025986 | Ga0207658_10307397 | Ga0207658_103073972 | 70 |
| 308 | 3300026023 | Ga0207677_10001170 | Ga0207677_100011703 | 70 |
| 309 | 3300026023 | Ga0207677_10067731 | Ga0207677_100677312 | 70 |
| 310 | 3300026035 | Ga0207703_10018029 | Ga0207703_100180298 | 70 |
| 311 | 3300026035 | Ga0207703_10484620 | Ga0207703_104846202 | 70 |
| 312 | 3300026035 | Ga0207703_10889197 | Ga0207703_108891972 | 70 |
| 313 | 3300026041 | Ga0207639_10072000 | Ga0207639_100720002 | 70 |
| 314 | 3300026041 | Ga0207639_10117959 | Ga0207639_101179594 | 70 |
| 315 | 3300026067 | Ga0207678_10003485 | Ga0207678_1000348511 | 70 |
| 316 | 3300026075 | Ga0207708_10003132 | Ga0207708_100031328 | 70 |
| 317 | 3300026075 | Ga0207708_10078454 | Ga0207708_100784543 | 70 |
| 318 | 3300026089 | Ga0207648_10010874 | Ga0207648_1001087410 | 70 |
| 319 | 3300026089 | Ga0207648_12208047 | Ga0207648_122080472 | 70 |
| 320 | 3300026118 | Ga0207675_100000941 | Ga0207675_10000094121 | 70 |
| 321 | 3300026118 | Ga0207675_100020330 | Ga0207675_1000203303 | 70 |
| 322 | 3300026121 | Ga0207683_10027074 | Ga0207683_100270743 | 70 |
| 323 | 3300026142 | Ga0207698_10132787 | Ga0207698_101327872 | 70 |
| 324 | 3300026142 | Ga0207698_12700485 | Ga0207698_127004852 | 70 |
| 325 | 3300028379 | Ga0268266_10033590 | Ga0268266_100335902 | 70 |
| 326 | 3300028379 | Ga0268266_10049602 | Ga0268266_100496024 | 70 |
| 327 | 3300028379 | Ga0268266_11983100 | Ga0268266_119831002 | 70 |
| 328 | 3300028380 | Ga0268265_10005537 | Ga0268265_100055378 | 70 |
| 329 | 3300028381 | Ga0268264_10004799 | Ga0268264_100047996 | 70 |
| 330 | 3300028381 | Ga0268264_10168335 | Ga0268264_101683353 | 70 |
| 331 | 3300031251 | Ga0265327_10000081 | Ga0265327_1000008186 | 70 |
| 332 | 3300031251 | Ga0265327_10009711 | Ga0265327_100097117 | 70 |
| 333 | 3300031548 | Ga0307408_102457974 | Ga0307408_1024579742 | 70 |
| 334 | 3300031691 | Ga0316579_10506410 | Ga0316579_105064102 | 70 |
| 335 | 3300031728 | Ga0316578_10329255 | Ga0316578_103292552 | 70 |
| 336 | 3300031901 | Ga0307406_10099386 | Ga0307406_100993863 | 70 |
| 337 | 3300031901 | Ga0307406_10412082 | Ga0307406_104120822 | 70 |
| 338 | 3300031901 | Ga0307406_11427850 | Ga0307406_114278501 | 70 |
| 339 | 3300032002 | Ga0307416_103678548 | Ga0307416_1036785482 | 70 |
| 340 | 3300032004 | Ga0307414_12051271 | Ga0307414_120512712 | 70 |
| 341 | 3300032126 | Ga0307415_100239738 | Ga0307415_1002397383 | 70 |
| 342 | 3300035084 | Ga0373928_0064638 | Ga0373928_0064638_249_464 | 70 |
| 343 | 3300035085 | Ga0373929_0220861 | Ga0373929_0220861_236_448 | 70 |
| 344 | 3300035088 | Ga0373940_0145333 | Ga0373940_0145333_211_426 | 70 |
| 345 | 3300035092 | Ga0373952_0250296 | Ga0373952_0250296_60_272 | 70 |
| 346 | 3300035115 | Ga0373941_0139590 | Ga0373941_0139590_604_816 | 70 |
| 347 | 3300035121 | Ga0373960_0249558 | Ga0373960_0249558_26_253 | 70 |
| 348 | 3300035207 | Ga0373942_0073698 | Ga0373942_0073698_586_801 | 70 |
| 349 | 3300035241 | Ga0373961_0221235 | Ga0373961_0221235_188_415 | 70 |
| 350 | 3300035398 | Ga0316574_0383710 | Ga0316574_0383710_50_277 | 70 |
| 351 | 3300035691 | Ga0373931_0020790 | Ga0373931_0020790_1873_2088 | 70 |
| 352 | 3300035691 | Ga0373931_0662850 | Ga0373931_0662850_188_400 | 70 |
| 353 | 3300036712 | Ga0316584_0120309 | Ga0316584_0120309_1457_1684 | 70 |
| 354 | 3300037853 | Ga0436364_0273491 | Ga0436364_0273491_157_399 | 70 |
| 355 | 3300037853 | Ga0436364_1115493 | Ga0436364_1115493_503_730 | 70 |
| 356 | 3300039437 | Ga0436365_0280180 | Ga0436365_0280180_293_535 | 70 |
| 357 | 3300039437 | Ga0436365_1896310 | Ga0436365_1896310_585_812 | 70 |
| 358 | 3300039438 | Ga0436360_0729409 | Ga0436360_0729409_232_471 | 70 |
| 359 | 3300039450 | Ga0436363_0130242 | Ga0436363_0130242_1868_2095 | 70 |
| 360 | 3300041410 | Ga0439461_0000435 | Ga0439461_0000435_2386_2634 | 70 |
| 361 | 3300041411 | Ga0439466_0017914 | Ga0439466_0017914_1572_1820 | 70 |
| 362 | 3300041413 | Ga0439465_0009389 | Ga0439465_0009389_1388_1636 | 70 |
| 363 | 3300041997 | Ga0439431_0002555 | Ga0439431_0002555_3440_3688 | 70 |
| 364 | 3300042004 | Ga0439445_0001715 | Ga0439445_0001715_1917_2165 | 70 |
| 365 | 3300042005 | Ga0439448_0297977 | Ga0439448_0297977_221_448 | 70 |
| 366 | 3300042435 | Ga0439434_0020654 | Ga0439434_0020654_1701_1949 | 70 |
| 367 | 3300044656 | Ga0466969_0141606 | Ga0466969_0141606_566_796 | 70 |
| 368 | 3300044656 | Ga0466969_0394524 | Ga0466969_0394524_286_522 | 70 |
| 369 | 3300044656 | Ga0466969_0516392 | Ga0466969_0516392_79_306 | 70 |
| 370 | 3300044658 | Ga0466972_0022960 | Ga0466972_0022960_1401_1637 | 70 |
| 371 | 3300044658 | Ga0466972_0260320 | Ga0466972_0260320_268_504 | 70 |
| 372 | 3300044658 | Ga0466972_0311424 | Ga0466972_0311424_64_312 | 70 |
| 373 | 3300044683 | Ga0466965_0000977 | Ga0466965_0000977_9173_9409 | 70 |
| 374 | 3300044683 | Ga0466965_0008391 | Ga0466965_0008391_644_886 | 70 |
| 375 | 3300044683 | Ga0466965_0384490 | Ga0466965_0384490_53_283 | 70 |
| 376 | 3300044684 | Ga0466966_0030434 | Ga0466966_0030434_2220_2450 | 70 |
| 377 | 3300044684 | Ga0466966_0033245 | Ga0466966_0033245_2237_2467 | 70 |
| 378 | 3300044693 | Ga0466961_0049072 | Ga0466961_0049072_2182_2412 | 70 |
| 379 | 3300044693 | Ga0466961_0202714 | Ga0466961_0202714_107_337 | 70 |
| 380 | 3300044694 | Ga0466963_0053388 | Ga0466963_0053388_403_630 | 70 |
| 381 | 3300044694 | Ga0466963_1307540 | Ga0466963_1307540_30_257 | 70 |
| 382 | 3300044706 | Ga0466964_0126579 | Ga0466964_0126579_528_764 | 70 |
| 383 | 3300044706 | Ga0466964_0262692 | Ga0466964_0262692_112_342 | 70 |
| 384 | 3300044706 | Ga0466964_0444635 | Ga0466964_0444635_91_336 | 70 |
| 385 | 3300044706 | Ga0466964_0767852 | Ga0466964_0767852_202_429 | 70 |
| 386 | 3300044719 | Ga0466971_0087548 | Ga0466971_0087548_59_304 | 70 |
| 387 | 3300044719 | Ga0466971_0229653 | Ga0466971_0229653_185_421 | 70 |
| 388 | 3300044735 | Ga0466968_0001250 | Ga0466968_0001250_6036_6272 | 70 |
| 389 | 3300044735 | Ga0466968_0005889 | Ga0466968_0005889_3387_3617 | 70 |
| 390 | 3300044735 | Ga0466968_0141465 | Ga0466968_0141465_821_1048 | 70 |
| 391 | 3300044735 | Ga0466968_0299122 | Ga0466968_0299122_416_646 | 70 |
| 392 | 3300044765 | Ga0466970_0020643 | Ga0466970_0020643_2288_2524 | 70 |
| 393 | 3300044765 | Ga0466970_0136300 | Ga0466970_0136300_252_482 | 70 |
| 394 | 3300044765 | Ga0466970_0172418 | Ga0466970_0172418_564_824 | 70 |
| 395 | 3300044842 | Ga0466957_0004000 | Ga0466957_0004000_5644_5880 | 70 |
| 396 | 3300044842 | Ga0466957_0019061 | Ga0466957_0019061_2840_3070 | 70 |
| 397 | 3300044842 | Ga0466957_0145888 | Ga0466957_0145888_594_839 | 70 |
| 398 | 3300044842 | Ga0466957_0561008 | Ga0466957_0561008_520_744 | 70 |
| 399 | 3300044842 | Ga0466957_0669524 | Ga0466957_0669524_376_606 | 70 |
| 400 | 3300044901 | Ga0466960_0000150 | Ga0466960_0000150_15689_15931 | 70 |
| 401 | 3300044901 | Ga0466960_0015817 | Ga0466960_0015817_1469_1705 | 70 |
| 402 | 3300045049 | Ga0466959_0008385 | Ga0466959_0008385_5332_5562 | 70 |
| 403 | 3300045049 | Ga0466959_0008423 | Ga0466959_0008423_1469_1705 | 70 |
| 404 | 3300045049 | Ga0466959_0023497 | Ga0466959_0023497_798_1028 | 70 |
| 405 | 3300045836 | Ga0466958_0036476 | Ga0466958_0036476_2330_2560 | 70 |
| 406 | 3300045836 | Ga0466958_0212903 | Ga0466958_0212903_720_965 | 70 |
| 407 | 3300045836 | Ga0466958_0429535 | Ga0466958_0429535_281_517 | 70 |
| 408 | 3300045836 | Ga0466958_0437539 | Ga0466958_0437539_183_413 | 70 |
| 409 | 3300045836 | Ga0466958_0643682 | Ga0466958_0643682_130_363 | 70 |
| 410 | 3300045836 | Ga0466958_1087591 | Ga0466958_1087591_10_237 | 70 |
| 411 | 3300045836 | Ga0466958_1098780 | Ga0466958_1098780_113_340 | 70 |
| 412 | 3300045976 | Ga0466967_0002298 | Ga0466967_0002298_11184_11429 | 70 |
| 413 | 3300045976 | Ga0466967_0008237 | Ga0466967_0008237_4362_4589 | 70 |
| 414 | 3300045976 | Ga0466967_0011056 | Ga0466967_0011056_5954_6190 | 70 |
| 415 | 3300045976 | Ga0466967_0107084 | Ga0466967_0107084_513_740 | 70 |
| 416 | 3300045976 | Ga0466967_0257249 | Ga0466967_0257249_360_584 | 70 |
| 417 | 3300045976 | Ga0466967_1140213 | Ga0466967_1140213_382_624 | 70 |
| 418 | 3300045976 | Ga0466967_1772513 | Ga0466967_1772513_36_269 | 70 |
| 419 | 3300046460 | Ga0495638_0030522 | Ga0495638_0030522_259_486 | 70 |
| 420 | 3300046514 | Ga0495618_0588312 | Ga0495618_0588312_195_437 | 70 |
| 421 | 3300046539 | Ga0495621_0519457 | Ga0495621_0519457_193_420 | 70 |
| 422 | 3300046694 | Ga0495649_0378951 | Ga0495649_0378951_425_652 | 70 |
| 423 | 3300047319 | Ga0495674_0758019 | Ga0495674_0758019_168_410 | 70 |
| 424 | 3300047320 | Ga0495672_0077710 | Ga0495672_0077710_28_255 | 70 |
| 425 | 3300048088 | Ga0495602_0360943 | Ga0495602_0360943_159_401 | 70 |
| 426 | 3300048091 | Ga0495626_0179203 | Ga0495626_0179203_198_425 | 70 |
| 427 | 3300048903 | Ga0496100_0027855 | Ga0496100_0027855_2192_2404 | 70 |
| 428 | 3300048903 | Ga0496100_0522999 | Ga0496100_0522999_76_312 | 70 |
| 429 | 3300048903 | Ga0496100_0646190 | Ga0496100_0646190_544_759 | 70 |
| 430 | 3300048904 | Ga0496101_0012357 | Ga0496101_0012357_3475_3714 | 70 |
| 431 | 3300048904 | Ga0496101_0030556 | Ga0496101_0030556_2861_3097 | 70 |
| 432 | 3300048904 | Ga0496101_0119027 | Ga0496101_0119027_947_1168 | 70 |
| 433 | 3300048904 | Ga0496101_0143376 | Ga0496101_0143376_864_1076 | 70 |
| 434 | 3300048904 | Ga0496101_0764148 | Ga0496101_0764148_415_630 | 70 |
| 435 | 3300048905 | Ga0496102_0005951 | Ga0496102_0005951_7866_8078 | 70 |
| 436 | 3300048905 | Ga0496102_0173271 | Ga0496102_0173271_1247_1462 | 70 |
| 437 | 3300048905 | Ga0496102_0430388 | Ga0496102_0430388_554_781 | 70 |
| 438 | 3300048906 | Ga0496103_0000932 | Ga0496103_0000932_6491_6703 | 70 |
| 439 | 3300048907 | Ga0496104_0100919 | Ga0496104_0100919_482_697 | 70 |
| 440 | 3300048907 | Ga0496104_0221836 | Ga0496104_0221836_347_586 | 70 |
| 441 | 3300048907 | Ga0496104_0544049 | Ga0496104_0544049_19_264 | 70 |
| 442 | 3300048907 | Ga0496104_0580203 | Ga0496104_0580203_418_645 | 70 |
| 443 | 3300048908 | Ga0496105_0072825 | Ga0496105_0072825_284_499 | 70 |
| 444 | 3300048909 | Ga0496106_0009592 | Ga0496106_0009592_5764_5976 | 70 |
| 445 | 3300048909 | Ga0496106_0038341 | Ga0496106_0038341_280_495 | 70 |
| 446 | 3300048909 | Ga0496106_0081969 | Ga0496106_0081969_2006_2245 | 70 |
| 447 | 3300048909 | Ga0496106_0252927 | Ga0496106_0252927_795_1040 | 70 |
| 448 | 3300048909 | Ga0496106_0325178 | Ga0496106_0325178_879_1100 | 70 |
| 449 | 3300048909 | Ga0496106_1038721 | Ga0496106_1038721_297_524 | 70 |
| 450 | 3300048910 | Ga0496107_0001310 | Ga0496107_0001310_1158_1370 | 70 |
| 451 | 3300048910 | Ga0496107_0208427 | Ga0496107_0208427_443_658 | 70 |
| 452 | 3300048911 | Ga0496108_0000404 | Ga0496108_0000404_5066_5281 | 70 |
| 453 | 3300048911 | Ga0496108_0129414 | Ga0496108_0129414_1672_1911 | 70 |
| 454 | 3300048911 | Ga0496108_0268994 | Ga0496108_0268994_1195_1440 | 70 |
| 455 | 3300048912 | Ga0496109_0000670 | Ga0496109_0000670_6361_6576 | 70 |
| 456 | 3300048912 | Ga0496109_0049676 | Ga0496109_0049676_694_939 | 70 |
| 457 | 3300048912 | Ga0496109_0610993 | Ga0496109_0610993_170_409 | 70 |
| 458 | 3300048913 | Ga0496110_0097586 | Ga0496110_0097586_1735_1950 | 70 |
| 459 | 3300048913 | Ga0496110_1013782 | Ga0496110_1013782_376_606 | 70 |
| 460 | 3300048914 | Ga0496111_0490113 | Ga0496111_0490113_164_379 | 70 |
| 461 | 3300048914 | Ga0496111_1298238 | Ga0496111_1298238_106_345 | 70 |
| 462 | 3300048915 | Ga0496112_0068714 | Ga0496112_0068714_863_1078 | 70 |
| 463 | 3300048915 | Ga0496112_0516874 | Ga0496112_0516874_504_743 | 70 |
| 464 | 3300048915 | Ga0496112_0795893 | Ga0496112_0795893_540_776 | 70 |
| 465 | 3300048916 | Ga0496113_0043659 | Ga0496113_0043659_3048_3284 | 70 |
| 466 | 3300048917 | Ga0496114_0002700 | Ga0496114_0002700_5785_5997 | 70 |
| 467 | 3300048917 | Ga0496114_0169767 | Ga0496114_0169767_1509_1748 | 70 |
| 468 | 3300048917 | Ga0496114_0285102 | Ga0496114_0285102_1175_1420 | 70 |
| 469 | 3300048917 | Ga0496114_0694585 | Ga0496114_0694585_510_752 | 70 |
| 470 | 3300048918 | Ga0496115_0020339 | Ga0496115_0020339_2309_2521 | 70 |
| 471 | 3300048918 | Ga0496115_0531507 | Ga0496115_0531507_251_466 | 70 |
| 472 | 3300048918 | Ga0496115_0537960 | Ga0496115_0537960_286_525 | 70 |
| 473 | 3300048922 | Ga0496119_0090437 | Ga0496119_0090437_1450_1686 | 70 |
| 474 | 3300048925 | Ga0496122_0024627 | Ga0496122_0024627_2752_2988 | 70 |
| 475 | 3300048926 | Ga0496123_0006092 | Ga0496123_0006092_1073_1309 | 70 |
| 476 | 3300048928 | Ga0496125_0395886 | Ga0496125_0395886_277_507 | 70 |
| 477 | 3300048929 | Ga0496126_0006189 | Ga0496126_0006189_4362_4598 | 70 |
| 478 | 3300048929 | Ga0496126_0158087 | Ga0496126_0158087_314_544 | 70 |
| 479 | 3300049568 | Ga0501031_0261930 | Ga0501031_0261930_151_390 | 70 |
| 480 | 3300049569 | Ga0501032_0008663 | Ga0501032_0008663_4996_5223 | 70 |
| 481 | 3300049569 | Ga0501032_0016051 | Ga0501032_0016051_2046_2285 | 70 |
| 482 | 3300049569 | Ga0501032_0026234 | Ga0501032_0026234_1520_1768 | 70 |
| 483 | 3300049570 | Ga0501033_0088689 | Ga0501033_0088689_157_384 | 70 |
| 484 | 3300049570 | Ga0501033_0139368 | Ga0501033_0139368_171_398 | 70 |
| 485 | 3300049570 | Ga0501033_0170475 | Ga0501033_0170475_833_1072 | 70 |
| 486 | 3300049571 | Ga0501034_0002996 | Ga0501034_0002996_10363_10611 | 70 |
| 487 | 3300049571 | Ga0501034_0013493 | Ga0501034_0013493_5833_6060 | 70 |
| 488 | 3300049571 | Ga0501034_0048428 | Ga0501034_0048428_2628_2867 | 70 |
| 489 | 3300049572 | Ga0501036_0009512 | Ga0501036_0009512_2028_2276 | 70 |
| 490 | 3300049572 | Ga0501036_0111723 | Ga0501036_0111723_182_409 | 70 |
| 491 | 3300049572 | Ga0501036_0555674 | Ga0501036_0555674_395_634 | 70 |
| 492 | 3300049573 | Ga0501037_0005727 | Ga0501037_0005727_7498_7746 | 70 |
| 493 | 3300049573 | Ga0501037_0017959 | Ga0501037_0017959_1054_1281 | 70 |
| 494 | 3300049573 | Ga0501037_0079814 | Ga0501037_0079814_804_1043 | 70 |
| 495 | 3300049574 | Ga0501038_0046860 | Ga0501038_0046860_1708_1956 | 70 |
| 496 | 3300049574 | Ga0501038_0334922 | Ga0501038_0334922_467_694 | 70 |
| 497 | 3300049574 | Ga0501038_0728780 | Ga0501038_0728780_168_407 | 70 |
| 498 | 3300049575 | Ga0501039_0001425 | Ga0501039_0001425_2243_2491 | 70 |
| 499 | 3300049575 | Ga0501039_0772481 | Ga0501039_0772481_456_683 | 70 |
| 500 | 3300049579 | Ga0501043_0000337 | Ga0501043_0000337_14507_14755 | 70 |
| 501 | 3300049579 | Ga0501043_0271960 | Ga0501043_0271960_907_1146 | 70 |
| 502 | 3300049579 | Ga0501043_0532674 | Ga0501043_0532674_262_489 | 70 |
| 503 | 3300049580 | Ga0501046_0008004 | Ga0501046_0008004_5582_5809 | 70 |
| 504 | 3300049581 | Ga0501047_0002406 | Ga0501047_0002406_12474_12713 | 70 |
| 505 | 3300049581 | Ga0501047_0012600 | Ga0501047_0012600_1249_1476 | 70 |
| 506 | 3300049581 | Ga0501047_0276401 | Ga0501047_0276401_200_436 | 70 |
| 507 | 3300049582 | Ga0501048_0568694 | Ga0501048_0568694_259_486 | 70 |
| 508 | 3300049582 | Ga0501048_1113764 | Ga0501048_1113764_289_525 | 70 |
| 509 | 3300049583 | Ga0501067_0098142 | Ga0501067_0098142_570_818 | 70 |
| 510 | 3300049584 | Ga0501068_0057078 | Ga0501068_0057078_1301_1549 | 70 |
| 511 | 3300049585 | Ga0501069_0035338 | Ga0501069_0035338_1716_1943 | 70 |
| 512 | 3300049586 | Ga0501070_0000642 | Ga0501070_0000642_4412_4660 | 70 |
| 513 | 3300049586 | Ga0501070_0005878 | Ga0501070_0005878_4527_4754 | 70 |
| 514 | 3300049587 | Ga0501071_0253507 | Ga0501071_0253507_658_906 | 70 |
| 515 | 3300049589 | Ga0501073_0016559 | Ga0501073_0016559_3096_3344 | 70 |
| 516 | 3300049593 | Ga0501077_0714166 | Ga0501077_0714166_290_538 | 70 |
| 517 | 3300049742 | Ga0501080_0095347 | Ga0501080_0095347_120_347 | 70 |
| 518 | 3300049822 | Ga0501035_0000279 | Ga0501035_0000279_47099_47338 | 70 |
| 519 | 3300049822 | Ga0501035_0004831 | Ga0501035_0004831_3430_3657 | 70 |
| 520 | 3300049823 | Ga0501044_0000637 | Ga0501044_0000637_36408_36647 | 70 |
| 521 | 3300049823 | Ga0501044_0003653 | Ga0501044_0003653_11376_11603 | 70 |
| 522 | 3300049823 | Ga0501044_0014514 | Ga0501044_0014514_6188_6415 | 70 |
| 523 | 3300049823 | Ga0501044_0033874 | Ga0501044_0033874_4245_4493 | 70 |
| 524 | 3300049823 | Ga0501044_0071845 | Ga0501044_0071845_2509_2745 | 70 |
| 525 | 3300050490 | nmdc:mga03n38_778012_c1 | nmdc:mga03n38_778012_c1_196_423 | 70 |
| 526 | 3300050490 | nmdc:mga03n38_83293_c1 | nmdc:mga03n38_83293_c1_477_704 | 70 |
| 527 | 3300050491 | nmdc:mga00v17_178913_c1 | nmdc:mga00v17_178913_c1_695_943 | 70 |
| 528 | 3300050491 | nmdc:mga00v17_33218_c1 | nmdc:mga00v17_33218_c1_1415_1663 | 70 |
| 529 | 3300050491 | nmdc:mga00v17_3681_c1 | nmdc:mga00v17_3681_c1_4941_5201 | 70 |
| 530 | 3300050492 | nmdc:mga0yw44_104045_c1 | nmdc:mga0yw44_104045_c1_246_473 | 70 |
| 531 | 3300050492 | nmdc:mga0yw44_155474_c1 | nmdc:mga0yw44_155474_c1_576_824 | 70 |
| 532 | 3300050492 | nmdc:mga0yw44_181596_c1 | nmdc:mga0yw44_181596_c1_753_980 | 70 |
| 533 | 3300050492 | nmdc:mga0yw44_28241_c1 | nmdc:mga0yw44_28241_c1_1311_1559 | 70 |
| 534 | 3300050492 | nmdc:mga0yw44_516685_c1 | nmdc:mga0yw44_516685_c1_548_775 | 70 |
| 535 | 3300050496 | nmdc:mga07m45_25292_c1 | nmdc:mga07m45_25292_c1_85_312 | 70 |
| 536 | 3300050496 | nmdc:mga07m45_499923_c1 | nmdc:mga07m45_499923_c1_212_439 | 70 |
| 537 | 3300050516 | nmdc:mga0sz30_26439_c2 | nmdc:mga0sz30_26439_c2_1161_1391 | 70 |
| 538 | 3300050516 | nmdc:mga0sz30_505175_c1 | nmdc:mga0sz30_505175_c1_29_256 | 70 |
| 539 | 3300053077 | Ga0495601_0845506 | Ga0495601_0845506_74_316 | 70 |
| 540 | 3300053080 | Ga0500635_0005811 | Ga0500635_0005811_626_865 | 70 |
| 541 | 3300053080 | Ga0500635_0448813 | Ga0500635_0448813_119_346 | 70 |
| 542 | 3300053083 | Ga0495655_0035940 | Ga0495655_0035940_101_316 | 70 |
| 543 | 3300053087 | Ga0500643_043243 | Ga0500643_043243_474_701 | 70 |
| 544 | 3300053092 | Ga0500583_0450319 | Ga0500583_0450319_319_546 | 70 |
| 545 | 3300053096 | Ga0500641_0042822 | Ga0500641_0042822_281_508 | 70 |
| 546 | 3300053096 | Ga0500641_0220558 | Ga0500641_0220558_556_792 | 70 |
| 547 | 3300053118 | Ga0500594_0199295 | Ga0500594_0199295_42_269 | 70 |
| 548 | 3300053131 | Ga0500652_000985 | Ga0500652_000985_3250_3489 | 70 |
| 549 | 3300053131 | Ga0500652_022549 | Ga0500652_022549_2052_2279 | 70 |
| 550 | 3300053136 | Ga0500559_0164184 | Ga0500559_0164184_147_374 | 70 |
| 551 | 3300053136 | Ga0500559_0438984 | Ga0500559_0438984_46_273 | 70 |
| 552 | 3300053139 | Ga0500568_0304617 | Ga0500568_0304617_67_297 | 70 |
| 553 | 3300053156 | Ga0500622_0427570 | Ga0500622_0427570_111_362 | 70 |
| 554 | 3300053158 | Ga0500627_0050332 | Ga0500627_0050332_506_733 | 70 |
| 555 | 3300053730 | Ga0500645_000030 | Ga0500645_000030_26350_26580 | 70 |
| 556 | 3300053730 | Ga0500645_040989 | Ga0500645_040989_992_1219 | 70 |
| 557 | 3300061719 | Ga0466962_0011963 | Ga0466962_0011963_183_428 | 70 |
| 558 | 3300061719 | Ga0466962_0013769 | Ga0466962_0013769_59_295 | 70 |
| 559 | 3300061719 | Ga0466962_0236493 | Ga0466962_0236493_368_598 | 70 |
| 560 | iso_pu_bacteria | 2643221715 | 2644633764 | 70 |
| 561 | iso_pu_bacteria | 2738541264 | 2738665130 | 70 |
| 562 | iso_pu_bacteria | 2738541274 | 2738707618 | 70 |
| 563 | iso_pu_bacteria | 2738541356 | 2739144264 | 70 |
| 564 | iso_pu_bacteria | 2738543028 | 2739332630 | 70 |
| 565 | iso_pu_bacteria | 2902799365 | 2902801032 | 70 |
| 566 | iso_pu_bacteria | 2902810491 | 2902814942 | 70 |
| 567 | iso_pu_bacteria | 2929212328 | 2929215511 | 70 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y13-assembly1.cif.gz_A | structural analysis of plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (ptps) | 0.6823 | 43 | 63 |
| 6bzi-assembly4.cif.gz_D | crystal structure of halogenase pltm in complex with ethyl mercury and mercury | 0.6806 | 42 | 63 |
| 3m0n-assembly1.cif.gz_A | plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant | 0.6788 | 43 | 63 |
| 3lze-assembly1.cif.gz_A | plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant | 0.6761 | 43 | 63 |
| 2a0s-assembly1.cif.gz_A | crystal structure of 6-pyruvoyl tetrahydropterin synthase (ptps) from plasmodium vivax at 2.2 a resolution | 0.675 | 43 | 63 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37339_4_262_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.733 | 45 | 63 | 3.50.50.60 |
| af_P56329_165_306_3.30.30.170 | Alpha Beta;2-Layer Sandwich;Defensin A-like; | 0.6691 | 34 | 63 | 3.30.30.170 |
| 1y13C00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.6613 | 43 | 63 | 3.30.479.10 |
| af_Q4DY34_22_339_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6521 | 42 | 63 | 2.130.10.10 |
| af_Q0WVA1_111_488_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.6487 | 40 | 65 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A554UZK3-F1-model_v4 | Aminotransferase | 0.9628 | 7 | 70 |
|
| AF-A0A838A0K4-F1-model_v4 | Aminotransferase | 0.9606 | 9 | 70 |
|
| AF-A0A0U0W6Y6-F1-model_v4 | Aminotransferase | 0.9593 | 8 | 68 |
|
| AF-G7CAV0-F1-model_v4 | Aminotransferase | 0.9499 | 10 | 67 |
|
| AF-A0A2N0X568-F1-model_v4 | Aminotransferase | 0.9429 | 10 | 68 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar