F464506
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 340 | 531 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_11168625|Ga0114129_111686252 |
| Length | 229 |
| Sequence | MRERARRFEVGEHDPLQLRVDPQQREILEDPMSNSTVDASKRTWLIASSCAGAVGAGFVAVPFVSSFQPSERAKAAGAPVEVDISALQPGQKMTVEWRGKPVWILKRTPEQIASIKKTDSQVADPNSERKAYPIPEYAKNETRSIKPDVLVVVGICSHLGCSPTDKLVPGPQPSLPDDWQGGFLCPCHGSTFDLAGRVYRNKPAPDNLEVPPHMYLSDTRLVIGEDKKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 5 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 6 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 7 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 8 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 9 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 10 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 11 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 12 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 13 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 14 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 15 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 16 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 17 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 18 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 19 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 20 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 21 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 22 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 23 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 24 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 25 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 26 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 27 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 28 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 29 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 30 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 31 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 32 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 33 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 34 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 35 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 36 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 37 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 38 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 39 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 203 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 204 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 233 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 234 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 239 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 240 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 243 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 244 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 245 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 246 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 247 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 248 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 249 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 250 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 253 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 254 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 325 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 327 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 330 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 339 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 340 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.06 |
| Metatranscriptomes | 1.59 |
| Isolates | 6.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.29 |
| Nodule | 1.06 |
| Rhizoplane | 4.23 |
| Rhizosphere | 77.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1001185 | 3300002705 | Bacteria | 11600 |
| 2 | JGI25151J46595_10000864 | 3300003187 | Bacteria | 24005 |
| 3 | Ga0055538_1000038 | 3300003751 | Bacteria | 186588 |
| 4 | Ga0055539_1000049 | 3300003752 | Bacteria | 186588 |
| 5 | Ga0055533_1000060 | 3300003756 | Bacteria | 186588 |
| 6 | Ga0055525_1000068 | 3300003759 | Bacteria | 186588 |
| 7 | Ga0055524_1000013 | 3300003775 | Bacteria | 259850 |
| 8 | Ga0055530_10015172 | 3300003791 | Bacteria | 2532 |
| 9 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 10 | Ga0055540_1011442 | 3300003792 | Bacteria | 2859 |
| 11 | Ga0055531_10000257 | 3300003794 | Bacteria | 56547 |
| 12 | Ga0055531_10010669 | 3300003794 | Bacteria | 4535 |
| 13 | Ga0055541_1000036 | 3300003841 | Bacteria | 186588 |
| 14 | Ga0065715_10124382 | 3300005293 | Bacteria | 2155 |
| 15 | Ga0070658_10190477 | 3300005327 | Bacteria | 1728 |
| 16 | Ga0070658_10261294 | 3300005327 | Bacteria | 1470 |
| 17 | Ga0070658_10352166 | 3300005327 | Bacteria | 1260 |
| 18 | Ga0070676_10019669 | 3300005328 | Bacteria | 3761 |
| 19 | Ga0070676_10526572 | 3300005328 | Bacteria | 843 |
| 20 | Ga0070676_10640135 | 3300005328 | Bacteria | 771 |
| 21 | Ga0070683_100302591 | 3300005329 | Bacteria | 1521 |
| 22 | Ga0070690_100027294 | 3300005330 | Bacteria | 3529 |
| 23 | Ga0070670_100001787 | 3300005331 | Bacteria | 17505 |
| 24 | Ga0070670_100056429 | 3300005331 | Bacteria | 3370 |
| 25 | Ga0070670_100082233 | 3300005331 | Bacteria | 2767 |
| 26 | Ga0070670_100175075 | 3300005331 | Bacteria | 1862 |
| 27 | Ga0070670_100225003 | 3300005331 | Bacteria | 1632 |
| 28 | Ga0070670_100511435 | 3300005331 | Bacteria | 1069 |
| 29 | Ga0070670_100575144 | 3300005331 | Bacteria | 1006 |
| 30 | Ga0070677_10012687 | 3300005333 | Bacteria | 2929 |
| 31 | Ga0070677_10019872 | 3300005333 | Bacteria | 2439 |
| 32 | Ga0070677_10037630 | 3300005333 | Bacteria | 1888 |
| 33 | Ga0070666_10005194 | 3300005335 | Bacteria | 7975 |
| 34 | Ga0070682_100332138 | 3300005337 | Bacteria | 1127 |
| 35 | Ga0070682_100414925 | 3300005337 | Bacteria | 1022 |
| 36 | Ga0068868_100000966 | 3300005338 | Bacteria | 19576 |
| 37 | Ga0068868_100060218 | 3300005338 | Bacteria | 3005 |
| 38 | Ga0068868_100251567 | 3300005338 | Bacteria | 1487 |
| 39 | Ga0068868_100332809 | 3300005338 | Bacteria | 1296 |
| 40 | Ga0070689_100033031 | 3300005340 | Bacteria | 3940 |
| 41 | Ga0070687_100021471 | 3300005343 | Bacteria | 3035 |
| 42 | Ga0070661_100007516 | 3300005344 | Bacteria | 7517 |
| 43 | Ga0070661_100325800 | 3300005344 | Bacteria | 1201 |
| 44 | Ga0070661_100643032 | 3300005344 | Bacteria | 860 |
| 45 | Ga0070668_100101677 | 3300005347 | Bacteria | 2278 |
| 46 | Ga0070668_100130279 | 3300005347 | Bacteria | 2018 |
| 47 | Ga0070668_100382209 | 3300005347 | Bacteria | 1198 |
| 48 | Ga0070668_100893251 | 3300005347 | Bacteria | 794 |
| 49 | Ga0070669_100101679 | 3300005353 | Bacteria | 2169 |
| 50 | Ga0070669_100271417 | 3300005353 | Bacteria | 1356 |
| 51 | Ga0070675_100007798 | 3300005354 | Bacteria | 8291 |
| 52 | Ga0070675_100059035 | 3300005354 | Bacteria | 3164 |
| 53 | Ga0070675_100071831 | 3300005354 | Bacteria | 2872 |
| 54 | Ga0070675_100296186 | 3300005354 | Bacteria | 1424 |
| 55 | Ga0070671_100003392 | 3300005355 | Bacteria | 12430 |
| 56 | Ga0070671_100080633 | 3300005355 | Bacteria | 2721 |
| 57 | Ga0070674_100101588 | 3300005356 | Bacteria | 2096 |
| 58 | Ga0070674_100270579 | 3300005356 | Bacteria | 1342 |
| 59 | Ga0070674_100923742 | 3300005356 | Bacteria | 761 |
| 60 | Ga0070673_100040581 | 3300005364 | Bacteria | 3571 |
| 61 | Ga0070673_100140074 | 3300005364 | Bacteria | 2039 |
| 62 | Ga0070673_100143620 | 3300005364 | Bacteria | 2015 |
| 63 | Ga0070673_100408454 | 3300005364 | Bacteria | 1215 |
| 64 | Ga0070673_100824476 | 3300005364 | Bacteria | 857 |
| 65 | Ga0070659_100246959 | 3300005366 | Bacteria | 1478 |
| 66 | Ga0070659_100520511 | 3300005366 | Bacteria | 1015 |
| 67 | Ga0070667_100031351 | 3300005367 | Bacteria | 4433 |
| 68 | Ga0070667_100064801 | 3300005367 | Bacteria | 3101 |
| 69 | Ga0070667_100227943 | 3300005367 | Bacteria | 1660 |
| 70 | Ga0070701_10322081 | 3300005438 | Bacteria | 957 |
| 71 | Ga0070700_100272002 | 3300005441 | Bacteria | 1224 |
| 72 | Ga0070678_100005704 | 3300005456 | Bacteria | 7232 |
| 73 | Ga0070678_100012914 | 3300005456 | Bacteria | 5214 |
| 74 | Ga0070678_100085907 | 3300005456 | Bacteria | 2398 |
| 75 | Ga0070678_100099794 | 3300005456 | Bacteria | 2247 |
| 76 | Ga0070678_100185099 | 3300005456 | Bacteria | 1708 |
| 77 | Ga0070678_100243614 | 3300005456 | Bacteria | 1504 |
| 78 | Ga0070678_100498987 | 3300005456 | Bacteria | 1073 |
| 79 | Ga0070662_100177439 | 3300005457 | Bacteria | 1677 |
| 80 | Ga0070662_100476676 | 3300005457 | Bacteria | 1038 |
| 81 | Ga0070681_10533713 | 3300005458 | Bacteria | 1087 |
| 82 | Ga0068867_100066600 | 3300005459 | Bacteria | 2683 |
| 83 | Ga0070672_100008932 | 3300005543 | Bacteria | 6886 |
| 84 | Ga0070672_100118022 | 3300005543 | Bacteria | 2169 |
| 85 | Ga0070672_100312456 | 3300005543 | Bacteria | 1334 |
| 86 | Ga0070672_100472174 | 3300005543 | Bacteria | 1082 |
| 87 | Ga0070672_100480844 | 3300005543 | Bacteria | 1072 |
| 88 | Ga0070686_100290146 | 3300005544 | Bacteria | 1210 |
| 89 | Ga0070665_100023730 | 3300005548 | Bacteria | 6178 |
| 90 | Ga0068855_100004108 | 3300005563 | Bacteria | 17755 |
| 91 | Ga0068855_100408641 | 3300005563 | Bacteria | 1487 |
| 92 | Ga0070664_100116201 | 3300005564 | Bacteria | 2339 |
| 93 | Ga0070664_100220335 | 3300005564 | Bacteria | 1697 |
| 94 | Ga0070664_100298845 | 3300005564 | Bacteria | 1454 |
| 95 | Ga0068856_100007776 | 3300005614 | Bacteria | 10473 |
| 96 | Ga0068856_100362132 | 3300005614 | Bacteria | 1469 |
| 97 | Ga0070702_100192744 | 3300005615 | Bacteria | 1342 |
| 98 | Ga0068852_100060003 | 3300005616 | Bacteria | 3301 |
| 99 | Ga0068852_100107340 | 3300005616 | Bacteria | 2532 |
| 100 | Ga0068852_100119867 | 3300005616 | Bacteria | 2406 |
| 101 | Ga0068852_100311429 | 3300005616 | Bacteria | 1526 |
| 102 | Ga0068852_100345451 | 3300005616 | Bacteria | 1451 |
| 103 | Ga0068852_100663935 | 3300005616 | Bacteria | 1051 |
| 104 | Ga0068852_100914048 | 3300005616 | Bacteria | 895 |
| 105 | Ga0068859_100023273 | 3300005617 | Bacteria | 6217 |
| 106 | Ga0068859_100138540 | 3300005617 | Bacteria | 2507 |
| 107 | Ga0068864_100002065 | 3300005618 | Bacteria | 16597 |
| 108 | Ga0068864_100034125 | 3300005618 | Bacteria | 4326 |
| 109 | Ga0068864_100117385 | 3300005618 | Bacteria | 2375 |
| 110 | Ga0068864_100208549 | 3300005618 | Bacteria | 1798 |
| 111 | Ga0068866_10055652 | 3300005718 | Bacteria | 2032 |
| 112 | Ga0068866_10067821 | 3300005718 | Bacteria | 1874 |
| 113 | Ga0068861_100043238 | 3300005719 | Bacteria | 3380 |
| 114 | Ga0068861_100422040 | 3300005719 | Bacteria | 1189 |
| 115 | Ga0068861_100754073 | 3300005719 | Bacteria | 909 |
| 116 | Ga0068851_10031414 | 3300005834 | Bacteria | 2637 |
| 117 | Ga0068851_10084706 | 3300005834 | Bacteria | 1660 |
| 118 | Ga0068851_10092912 | 3300005834 | Bacteria | 1590 |
| 119 | Ga0068851_10165438 | 3300005834 | Bacteria | 1217 |
| 120 | Ga0068870_10143448 | 3300005840 | Bacteria | 1399 |
| 121 | Ga0068863_100019244 | 3300005841 | Bacteria | 6532 |
| 122 | Ga0068863_100058378 | 3300005841 | Bacteria | 3651 |
| 123 | Ga0068863_100135245 | 3300005841 | Bacteria | 2355 |
| 124 | Ga0068863_100396977 | 3300005841 | Bacteria | 1348 |
| 125 | Ga0068858_100008614 | 3300005842 | Bacteria | 9799 |
| 126 | Ga0068858_100150332 | 3300005842 | Bacteria | 2189 |
| 127 | Ga0068858_100610245 | 3300005842 | Bacteria | 1059 |
| 128 | Ga0068860_100007016 | 3300005843 | Bacteria | 11281 |
| 129 | Ga0068860_100151850 | 3300005843 | Bacteria | 2231 |
| 130 | Ga0068862_100041306 | 3300005844 | Bacteria | 3923 |
| 131 | Ga0068862_100097384 | 3300005844 | Bacteria | 2568 |
| 132 | Ga0070717_10009296 | 3300006028 | Bacteria | 7386 |
| 133 | Ga0075365_10004820 | 3300006038 | Bacteria | 7197 |
| 134 | Ga0075365_10051467 | 3300006038 | Bacteria | 2720 |
| 135 | Ga0075365_10093861 | 3300006038 | Bacteria | 2047 |
| 136 | Ga0075365_10474755 | 3300006038 | Bacteria | 884 |
| 137 | Ga0075368_10086394 | 3300006042 | Bacteria | 1280 |
| 138 | Ga0075363_100256117 | 3300006048 | Bacteria | 1009 |
| 139 | Ga0075367_10161645 | 3300006178 | Bacteria | 1393 |
| 140 | Ga0075367_10249889 | 3300006178 | Bacteria | 1112 |
| 141 | Ga0075366_10085626 | 3300006195 | Bacteria | 1885 |
| 142 | Ga0075366_10276794 | 3300006195 | Bacteria | 1025 |
| 143 | Ga0097621_100030577 | 3300006237 | Bacteria | 4264 |
| 144 | Ga0097621_100082351 | 3300006237 | Bacteria | 2679 |
| 145 | Ga0075370_10237519 | 3300006353 | Bacteria | 1079 |
| 146 | Ga0068871_100039576 | 3300006358 | Bacteria | 3773 |
| 147 | Ga0068871_100306424 | 3300006358 | Bacteria | 1395 |
| 148 | Ga0075428_101073449 | 3300006844 | Bacteria | 851 |
| 149 | Ga0075430_100133848 | 3300006846 | Bacteria | 2066 |
| 150 | Ga0075429_100048258 | 3300006880 | Bacteria | 3703 |
| 151 | Ga0075429_100396307 | 3300006880 | Bacteria | 1209 |
| 152 | Ga0068865_100543685 | 3300006881 | Bacteria | 974 |
| 153 | Ga0097620_100023272 | 3300006931 | Bacteria | 6217 |
| 154 | Ga0097620_100138542 | 3300006931 | Bacteria | 2507 |
| 155 | Ga0079104_1000070 | 3300006946 | Bacteria | 153879 |
| 156 | Ga0079104_1006956 | 3300006946 | Bacteria | 4176 |
| 157 | Ga0079104_1007690 | 3300006946 | Bacteria | 3863 |
| 158 | Ga0105240_10360767 | 3300009093 | Bacteria | 1646 |
| 159 | Ga0105240_10475490 | 3300009093 | Bacteria | 1394 |
| 160 | Ga0105245_10268171 | 3300009098 | Bacteria | 1664 |
| 161 | Ga0105245_10766541 | 3300009098 | Bacteria | 1001 |
| 162 | Ga0114129_11168625 | 3300009147 | Bacteria | 960 |
| 163 | Ga0105243_10096253 | 3300009148 | Bacteria | 2449 |
| 164 | Ga0105248_10051344 | 3300009177 | Bacteria | 4627 |
| 165 | Ga0105248_10200227 | 3300009177 | Bacteria | 2250 |
| 166 | Ga0105248_10276432 | 3300009177 | Bacteria | 1891 |
| 167 | Ga0105237_10273494 | 3300009545 | Bacteria | 1692 |
| 168 | Ga0105237_10314487 | 3300009545 | Bacteria | 1569 |
| 169 | Ga0105238_10000037 | 3300009551 | Bacteria | 163954 |
| 170 | Ga0105238_10005477 | 3300009551 | Bacteria | 12552 |
| 171 | Ga0105249_10106513 | 3300009553 | Bacteria | 2645 |
| 172 | Ga0105239_10003694 | 3300010375 | Bacteria | 18647 |
| 173 | Ga0157373_10133902 | 3300013100 | Bacteria | 1742 |
| 174 | Ga0157371_10063837 | 3300013102 | Bacteria | 2610 |
| 175 | Ga0157371_10131978 | 3300013102 | Bacteria | 1777 |
| 176 | Ga0157369_10653134 | 3300013105 | Bacteria | 1084 |
| 177 | Ga0157374_10091075 | 3300013296 | Bacteria | 2908 |
| 178 | Ga0157378_10700956 | 3300013297 | Bacteria | 1032 |
| 179 | Ga0157372_10269502 | 3300013307 | Bacteria | 1978 |
| 180 | Ga0157372_10598551 | 3300013307 | Bacteria | 1285 |
| 181 | Ga0157375_10134369 | 3300013308 | Bacteria | 2596 |
| 182 | Ga0157375_10260281 | 3300013308 | Bacteria | 1896 |
| 183 | Ga0157375_10750916 | 3300013308 | Bacteria | 1127 |
| 184 | Ga0163163_10035273 | 3300014325 | Bacteria | 4852 |
| 185 | Ga0163163_10102638 | 3300014325 | Bacteria | 2884 |
| 186 | Ga0157380_10185851 | 3300014326 | Bacteria | 1830 |
| 187 | Ga0157380_10325853 | 3300014326 | Bacteria | 1426 |
| 188 | Ga0157380_10526215 | 3300014326 | Bacteria | 1154 |
| 189 | Ga0157379_10055008 | 3300014968 | Bacteria | 3556 |
| 190 | Ga0157379_10098500 | 3300014968 | Bacteria | 2625 |
| 191 | Ga0157376_10042949 | 3300014969 | Bacteria | 3708 |
| 192 | Ga0157376_10147904 | 3300014969 | Bacteria | 2115 |
| 193 | Ga0157376_10403153 | 3300014969 | Bacteria | 1323 |
| 194 | Ga0182006_1000102 | 3300015261 | Bacteria | 94384 |
| 195 | Ga0182005_1000006 | 3300015265 | Bacteria | 515188 |
| 196 | Ga0163161_10013100 | 3300017792 | Bacteria | 5764 |
| 197 | Ga0163161_10060133 | 3300017792 | Bacteria | 2765 |
| 198 | Ga0163161_10177820 | 3300017792 | Bacteria | 1630 |
| 199 | Ga0163161_10296468 | 3300017792 | Bacteria | 1272 |
| 200 | Ga0213872_10002128 | 3300021361 | Bacteria | 11902 |
| 201 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 202 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 203 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 204 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 205 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 206 | Ga0209565_1004707 | 3300025263 | Bacteria | 4099 |
| 207 | Ga0207666_1002451 | 3300025271 | Bacteria | 2238 |
| 208 | Ga0209673_1005215 | 3300025273 | Bacteria | 6625 |
| 209 | Ga0209675_1009287 | 3300025291 | Bacteria | 3489 |
| 210 | Ga0209050_1000730 | 3300025298 | Bacteria | 47896 |
| 211 | Ga0209050_1023274 | 3300025298 | Bacteria | 2186 |
| 212 | Ga0209256_1000061 | 3300025299 | Bacteria | 260890 |
| 213 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 214 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 215 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 216 | Ga0209257_1000461 | 3300025304 | Bacteria | 75360 |
| 217 | Ga0207656_10080050 | 3300025321 | Bacteria | 1467 |
| 218 | Ga0207655_1002585 | 3300025728 | Bacteria | 14437 |
| 219 | Ga0207682_10029330 | 3300025893 | Bacteria | 2200 |
| 220 | Ga0207642_10007097 | 3300025899 | Bacteria | 3764 |
| 221 | Ga0207688_10033176 | 3300025901 | Bacteria | 2854 |
| 222 | Ga0207680_10002711 | 3300025903 | Bacteria | 8272 |
| 223 | Ga0207680_10045424 | 3300025903 | Bacteria | 2590 |
| 224 | Ga0207685_10139029 | 3300025905 | Bacteria | 1087 |
| 225 | Ga0207645_10067098 | 3300025907 | Bacteria | 2293 |
| 226 | Ga0207645_10590918 | 3300025907 | Bacteria | 754 |
| 227 | Ga0207705_10045619 | 3300025909 | Bacteria | 3149 |
| 228 | Ga0207705_10172892 | 3300025909 | Bacteria | 1627 |
| 229 | Ga0207695_10014674 | 3300025913 | Bacteria | 9264 |
| 230 | Ga0207662_10005846 | 3300025918 | Bacteria | 6595 |
| 231 | Ga0207657_10164635 | 3300025919 | Bacteria | 1799 |
| 232 | Ga0207649_10014780 | 3300025920 | Bacteria | 4378 |
| 233 | Ga0207649_10218481 | 3300025920 | Bacteria | 1356 |
| 234 | Ga0207681_10119486 | 3300025923 | Bacteria | 1930 |
| 235 | Ga0207681_10289422 | 3300025923 | Bacteria | 1292 |
| 236 | Ga0207681_10355075 | 3300025923 | Bacteria | 1174 |
| 237 | Ga0207694_10029099 | 3300025924 | Bacteria | 4213 |
| 238 | Ga0207650_10010685 | 3300025925 | Bacteria | 6307 |
| 239 | Ga0207650_10022106 | 3300025925 | Bacteria | 4501 |
| 240 | Ga0207650_10118137 | 3300025925 | Bacteria | 2061 |
| 241 | Ga0207650_10483410 | 3300025925 | Bacteria | 1033 |
| 242 | Ga0207659_10002170 | 3300025926 | Bacteria | 11657 |
| 243 | Ga0207659_10039901 | 3300025926 | Bacteria | 3278 |
| 244 | Ga0207659_10100788 | 3300025926 | Bacteria | 2176 |
| 245 | Ga0207659_10679410 | 3300025926 | Bacteria | 881 |
| 246 | Ga0207644_10002319 | 3300025931 | Bacteria | 12312 |
| 247 | Ga0207644_10178867 | 3300025931 | Bacteria | 1661 |
| 248 | Ga0207644_10200133 | 3300025931 | Bacteria | 1575 |
| 249 | Ga0207644_10900493 | 3300025931 | Bacteria | 741 |
| 250 | Ga0207706_10442293 | 3300025933 | Bacteria | 1125 |
| 251 | Ga0207686_10062692 | 3300025934 | Bacteria | 2362 |
| 252 | Ga0207686_10471043 | 3300025934 | Bacteria | 970 |
| 253 | Ga0207670_10033210 | 3300025936 | Bacteria | 3324 |
| 254 | Ga0207704_10037758 | 3300025938 | Bacteria | 2793 |
| 255 | Ga0207704_10518695 | 3300025938 | Bacteria | 963 |
| 256 | Ga0207665_10604735 | 3300025939 | Bacteria | 856 |
| 257 | Ga0207691_10004404 | 3300025940 | Bacteria | 13651 |
| 258 | Ga0207691_10078833 | 3300025940 | Bacteria | 2965 |
| 259 | Ga0207691_10152235 | 3300025940 | Bacteria | 2033 |
| 260 | Ga0207691_10440089 | 3300025940 | Bacteria | 1110 |
| 261 | Ga0207691_10449364 | 3300025940 | Bacteria | 1097 |
| 262 | Ga0207691_10745921 | 3300025940 | Bacteria | 824 |
| 263 | Ga0207711_10019236 | 3300025941 | Bacteria | 5686 |
| 264 | Ga0207711_10117888 | 3300025941 | Bacteria | 2368 |
| 265 | Ga0207689_10030687 | 3300025942 | Bacteria | 4479 |
| 266 | Ga0207679_10062453 | 3300025945 | Bacteria | 2776 |
| 267 | Ga0207679_11014652 | 3300025945 | Bacteria | 761 |
| 268 | Ga0207667_10000043 | 3300025949 | Bacteria | 261426 |
| 269 | Ga0207651_10009154 | 3300025960 | Bacteria | 5396 |
| 270 | Ga0207651_10059158 | 3300025960 | Bacteria | 2652 |
| 271 | Ga0207651_10174777 | 3300025960 | Bacteria | 1697 |
| 272 | Ga0207651_10489629 | 3300025960 | Bacteria | 1061 |
| 273 | Ga0207712_10029229 | 3300025961 | Bacteria | 3695 |
| 274 | Ga0207712_10726267 | 3300025961 | Bacteria | 869 |
| 275 | Ga0207668_10124497 | 3300025972 | Bacteria | 1957 |
| 276 | Ga0207668_10188242 | 3300025972 | Bacteria | 1633 |
| 277 | Ga0207668_10472824 | 3300025972 | Bacteria | 1074 |
| 278 | Ga0207668_11209192 | 3300025972 | Bacteria | 679 |
| 279 | Ga0207640_10216146 | 3300025981 | Bacteria | 1464 |
| 280 | Ga0207640_10828040 | 3300025981 | Bacteria | 804 |
| 281 | Ga0207658_10004072 | 3300025986 | Bacteria | 10205 |
| 282 | Ga0207658_10138894 | 3300025986 | Bacteria | 1963 |
| 283 | Ga0207677_10001522 | 3300026023 | Bacteria | 12255 |
| 284 | Ga0207677_10059377 | 3300026023 | Bacteria | 2638 |
| 285 | Ga0207677_10739198 | 3300026023 | Bacteria | 876 |
| 286 | Ga0207677_10800620 | 3300026023 | Bacteria | 844 |
| 287 | Ga0207703_10006064 | 3300026035 | Bacteria | 9665 |
| 288 | Ga0207703_10025831 | 3300026035 | Bacteria | 4622 |
| 289 | Ga0207703_10435705 | 3300026035 | Bacteria | 1222 |
| 290 | Ga0207639_10409656 | 3300026041 | Bacteria | 1223 |
| 291 | Ga0207639_10699521 | 3300026041 | Bacteria | 940 |
| 292 | Ga0207708_10060894 | 3300026075 | Bacteria | 2882 |
| 293 | Ga0207708_10307812 | 3300026075 | Bacteria | 1290 |
| 294 | Ga0207702_10004429 | 3300026078 | Bacteria | 12481 |
| 295 | Ga0207702_10652496 | 3300026078 | Bacteria | 1035 |
| 296 | Ga0207641_10019502 | 3300026088 | Bacteria | 5567 |
| 297 | Ga0207641_10034241 | 3300026088 | Bacteria | 4224 |
| 298 | Ga0207641_10314816 | 3300026088 | Bacteria | 1482 |
| 299 | Ga0207648_10147355 | 3300026089 | Bacteria | 2076 |
| 300 | Ga0207648_10793028 | 3300026089 | Bacteria | 881 |
| 301 | Ga0207676_10002741 | 3300026095 | Bacteria | 12542 |
| 302 | Ga0207676_10018678 | 3300026095 | Bacteria | 5045 |
| 303 | Ga0207676_10397318 | 3300026095 | Bacteria | 1287 |
| 304 | Ga0207676_10560034 | 3300026095 | Bacteria | 1093 |
| 305 | Ga0207674_10337827 | 3300026116 | Bacteria | 1456 |
| 306 | Ga0207675_100044476 | 3300026118 | Bacteria | 4150 |
| 307 | Ga0207675_100152755 | 3300026118 | Bacteria | 2198 |
| 308 | Ga0207675_100926177 | 3300026118 | Bacteria | 888 |
| 309 | Ga0207683_10484206 | 3300026121 | Bacteria | 1142 |
| 310 | Ga0207683_10489057 | 3300026121 | Bacteria | 1136 |
| 311 | Ga0207683_10633657 | 3300026121 | Bacteria | 990 |
| 312 | Ga0207698_10063349 | 3300026142 | Bacteria | 2893 |
| 313 | Ga0207698_10090270 | 3300026142 | Bacteria | 2505 |
| 314 | Ga0207698_10266650 | 3300026142 | Bacteria | 1576 |
| 315 | Ga0207698_10987811 | 3300026142 | Bacteria | 852 |
| 316 | Ga0209281_1000103 | 3300027111 | Bacteria | 221425 |
| 317 | Ga0209281_1003429 | 3300027111 | Bacteria | 5248 |
| 318 | Ga0209281_1005531 | 3300027111 | Bacteria | 3492 |
| 319 | Ga0209813_10021609 | 3300027866 | Bacteria | 1811 |
| 320 | Ga0268265_10062030 | 3300028380 | Bacteria | 2871 |
| 321 | Ga0268264_10013629 | 3300028381 | Bacteria | 6691 |
| 322 | Ga0268264_10112004 | 3300028381 | Bacteria | 2392 |
| 323 | Ga0307517_10003685 | 3300028786 | Bacteria | 23834 |
| 324 | Ga0307515_10001484 | 3300028794 | Bacteria | 52674 |
| 325 | Ga0316181_1248234 | 3300030744 | Bacteria | 1442 |
| 326 | Ga0265328_10040645 | 3300031239 | Bacteria | 1713 |
| 327 | Ga0265331_10001643 | 3300031250 | Bacteria | 16261 |
| 328 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 329 | Ga0265327_10038138 | 3300031251 | Bacteria | 2625 |
| 330 | Ga0307513_10065124 | 3300031456 | Bacteria | 3835 |
| 331 | Ga0307513_10343040 | 3300031456 | Bacteria | 1244 |
| 332 | Ga0307509_10407590 | 3300031507 | Bacteria | 1064 |
| 333 | Ga0307514_10000355 | 3300031649 | Bacteria | 106758 |
| 334 | Ga0316575_10037334 | 3300031665 | Bacteria | 1914 |
| 335 | Ga0316576_10163425 | 3300031727 | Bacteria | 1679 |
| 336 | Ga0307516_10002915 | 3300031730 | Bacteria | 22407 |
| 337 | Ga0307516_10080487 | 3300031730 | Bacteria | 3101 |
| 338 | Ga0307516_10196609 | 3300031730 | Bacteria | 1739 |
| 339 | Ga0307410_10372995 | 3300031852 | Bacteria | 1146 |
| 340 | Ga0307406_10772657 | 3300031901 | Bacteria | 808 |
| 341 | Ga0307407_10207438 | 3300031903 | Bacteria | 1317 |
| 342 | Ga0307412_11053087 | 3300031911 | Bacteria | 721 |
| 343 | Ga0307414_10277038 | 3300032004 | Bacteria | 1408 |
| 344 | Ga0307510_10003212 | 3300033180 | Bacteria | 19002 |
| 345 | Ga0316596_1053168 | 3300033541 | Bacteria | 1074 |
| 346 | Ga0373934_0143239 | 3300035086 | Bacteria | 978 |
| 347 | Ga0373944_0032880 | 3300035089 | Bacteria | 1569 |
| 348 | Ga0373944_0067501 | 3300035089 | Bacteria | 1159 |
| 349 | Ga0373945_0114625 | 3300035116 | Bacteria | 1066 |
| 350 | Ga0373954_0080714 | 3300035118 | Bacteria | 1554 |
| 351 | Ga0373943_0063600 | 3300035170 | Bacteria | 1850 |
| 352 | Ga0373946_0195126 | 3300035171 | Bacteria | 967 |
| 353 | Ga0316574_0044253 | 3300035398 | Bacteria | 2754 |
| 354 | Ga0373924_0157818 | 3300035410 | Bacteria | 994 |
| 355 | Ga0373931_0096810 | 3300035691 | Bacteria | 1654 |
| 356 | Ga0373927_0448846 | 3300035695 | Bacteria | 852 |
| 357 | Ga0373933_0196148 | 3300035724 | Bacteria | 1291 |
| 358 | Ga0373947_0380754 | 3300035725 | Bacteria | 950 |
| 359 | Ga0373925_0124979 | 3300037068 | Bacteria | 2000 |
| 360 | Ga0373925_0867582 | 3300037068 | Bacteria | 744 |
| 361 | Ga0395899_0008661 | 3300037312 | Bacteria | 7828 |
| 362 | Ga0395900_0047478 | 3300037418 | Bacteria | 4421 |
| 363 | Ga0395900_0592541 | 3300037418 | Bacteria | 1050 |
| 364 | Ga0395898_0018204 | 3300037466 | Bacteria | 7165 |
| 365 | Ga0395898_0100918 | 3300037466 | Bacteria | 2772 |
| 366 | Ga0395905_0009245 | 3300037471 | Bacteria | 9647 |
| 367 | Ga0395905_0019544 | 3300037471 | Bacteria | 6420 |
| 368 | Ga0395905_0367100 | 3300037471 | Bacteria | 1332 |
| 369 | Ga0395905_0454049 | 3300037471 | Bacteria | 1179 |
| 370 | Ga0395905_0499223 | 3300037471 | Bacteria | 1117 |
| 371 | Ga0436365_0515661 | 3300039437 | Bacteria | 1111 |
| 372 | Ga0436361_0266216 | 3300039447 | Bacteria | 5390 |
| 373 | Ga0436361_0548576 | 3300039447 | Bacteria | 1380 |
| 374 | Ga0436361_0704696 | 3300039447 | Bacteria | 13555 |
| 375 | Ga0439439_0080551 | 3300041406 | Bacteria | 880 |
| 376 | Ga0439453_0068146 | 3300041408 | Bacteria | 748 |
| 377 | Ga0451800_1666127 | 3300041459 | Bacteria | 1020 |
| 378 | Ga0451802_1504526 | 3300041460 | Bacteria | 1117 |
| 379 | Ga0451839_0444511 | 3300041496 | Bacteria | 1086 |
| 380 | Ga0451853_2548672 | 3300041512 | Bacteria | 1051 |
| 381 | Ga0439449_0001504 | 3300042007 | Bacteria | 9128 |
| 382 | Ga0439450_012902 | 3300042008 | Bacteria | 1668 |
| 383 | Ga0439457_029445 | 3300042014 | Bacteria | 1217 |
| 384 | Ga0439462_0023380 | 3300042015 | Bacteria | 1620 |
| 385 | Ga0439463_098707 | 3300042016 | Bacteria | 753 |
| 386 | Ga0450911_001247 | 3300042115 | Bacteria | 6107 |
| 387 | Ga0450912_004814 | 3300042116 | Bacteria | 1015 |
| 388 | Ga0450914_005362 | 3300042118 | Bacteria | 1084 |
| 389 | Ga0450890_004603 | 3300042127 | Bacteria | 1799 |
| 390 | Ga0450897_000220 | 3300042128 | Bacteria | 2880 |
| 391 | Ga0450896_026009 | 3300042133 | Bacteria | 872 |
| 392 | Ga0439446_0103067 | 3300042156 | Bacteria | 904 |
| 393 | Ga0439458_0029326 | 3300042157 | Bacteria | 1305 |
| 394 | Ga0439434_0078516 | 3300042435 | Bacteria | 1045 |
| 395 | Ga0439434_0142528 | 3300042435 | Bacteria | 790 |
| 396 | Ga0439435_0139308 | 3300042436 | Bacteria | 772 |
| 397 | Ga0439444_0018308 | 3300042437 | Bacteria | 1212 |
| 398 | Ga0439460_0011243 | 3300042461 | Bacteria | 2306 |
| 399 | Ga0439460_0032543 | 3300042461 | Bacteria | 1494 |
| 400 | Ga0451577_0073985 | 3300042876 | Bacteria | 3039 |
| 401 | Ga0453683_0001910 | 3300044673 | Bacteria | 17016 |
| 402 | Ga0453683_0041666 | 3300044673 | Bacteria | 2884 |
| 403 | Ga0453683_0251108 | 3300044673 | Bacteria | 1127 |
| 404 | Ga0453684_0000163 | 3300044712 | Bacteria | 296196 |
| 405 | Ga0453684_0489944 | 3300044712 | Bacteria | 1363 |
| 406 | Ga0466957_0162753 | 3300044842 | Bacteria | 1450 |
| 407 | Ga0451576_0042696 | 3300045051 | Bacteria | 4786 |
| 408 | Ga0451576_0044571 | 3300045051 | Bacteria | 4676 |
| 409 | Ga0451576_0056425 | 3300045051 | Bacteria | 4107 |
| 410 | Ga0451576_0178645 | 3300045051 | Bacteria | 2216 |
| 411 | Ga0451576_0248415 | 3300045051 | Bacteria | 1859 |
| 412 | Ga0451576_0334769 | 3300045051 | Bacteria | 1584 |
| 413 | Ga0495617_000128 | 3300046452 | Bacteria | 50370 |
| 414 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 415 | Ga0495627_064516 | 3300046453 | Bacteria | 1077 |
| 416 | Ga0495590_0036502 | 3300046457 | Bacteria | 1714 |
| 417 | Ga0495629_0099975 | 3300046459 | Bacteria | 2024 |
| 418 | Ga0495653_0000056 | 3300046463 | Bacteria | 100732 |
| 419 | Ga0495650_0008661 | 3300046471 | Bacteria | 5893 |
| 420 | Ga0495582_0166867 | 3300046473 | Bacteria | 1253 |
| 421 | Ga0495664_0192042 | 3300046477 | Bacteria | 1238 |
| 422 | Ga0495585_0051090 | 3300046492 | Bacteria | 2291 |
| 423 | Ga0495607_0007679 | 3300046501 | Bacteria | 7432 |
| 424 | Ga0495606_0000400 | 3300046507 | Bacteria | 73341 |
| 425 | Ga0495606_0000589 | 3300046507 | Bacteria | 57638 |
| 426 | Ga0495610_0000027 | 3300046512 | Bacteria | 275273 |
| 427 | Ga0495610_0044528 | 3300046512 | Bacteria | 2202 |
| 428 | Ga0495618_0501969 | 3300046514 | Bacteria | 731 |
| 429 | Ga0495648_0130404 | 3300046524 | Bacteria | 1337 |
| 430 | Ga0495642_0026987 | 3300046528 | Bacteria | 2284 |
| 431 | Ga0495642_0071958 | 3300046528 | Bacteria | 1447 |
| 432 | Ga0495654_0023598 | 3300046530 | Bacteria | 3184 |
| 433 | Ga0495654_0089042 | 3300046530 | Bacteria | 1435 |
| 434 | Ga0495598_0027295 | 3300046537 | Bacteria | 1573 |
| 435 | Ga0495598_0036180 | 3300046537 | Bacteria | 1417 |
| 436 | Ga0495598_0094554 | 3300046537 | Bacteria | 980 |
| 437 | Ga0495609_0006051 | 3300046538 | Bacteria | 6232 |
| 438 | Ga0495621_0139529 | 3300046539 | Bacteria | 948 |
| 439 | Ga0495597_0050595 | 3300046542 | Bacteria | 1833 |
| 440 | Ga0495645_0117436 | 3300046543 | Bacteria | 1876 |
| 441 | Ga0495645_0286886 | 3300046543 | Bacteria | 1080 |
| 442 | Ga0495633_0002867 | 3300046558 | Bacteria | 11817 |
| 443 | Ga0495633_0149228 | 3300046558 | Bacteria | 1080 |
| 444 | Ga0495668_0004543 | 3300046616 | Bacteria | 9793 |
| 445 | Ga0495625_0036581 | 3300046660 | Bacteria | 3608 |
| 446 | Ga0495625_0094169 | 3300046660 | Bacteria | 2067 |
| 447 | Ga0495661_0085594 | 3300046665 | Bacteria | 1806 |
| 448 | Ga0495647_0135825 | 3300046681 | Bacteria | 1045 |
| 449 | Ga0495658_0050051 | 3300046683 | Bacteria | 2362 |
| 450 | Ga0495658_0083861 | 3300046683 | Bacteria | 1875 |
| 451 | Ga0495670_0300473 | 3300046691 | Bacteria | 860 |
| 452 | Ga0495671_0001731 | 3300046692 | Bacteria | 14172 |
| 453 | Ga0495660_0005482 | 3300046810 | Bacteria | 7600 |
| 454 | Ga0495660_0044458 | 3300046810 | Bacteria | 2443 |
| 455 | Ga0495660_0046622 | 3300046810 | Bacteria | 2376 |
| 456 | Ga0495683_0143448 | 3300047323 | Bacteria | 1117 |
| 457 | Ga0495687_029636 | 3300047443 | Bacteria | 2529 |
| 458 | Ga0495679_009980 | 3300047446 | Bacteria | 3761 |
| 459 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 460 | Ga0495673_0000185 | 3300047469 | Bacteria | 100703 |
| 461 | Ga0495684_0101242 | 3300047471 | Bacteria | 2178 |
| 462 | Ga0495686_0094377 | 3300047472 | Bacteria | 1813 |
| 463 | Ga0496101_0323484 | 3300048904 | Bacteria | 1210 |
| 464 | Ga0496102_0290668 | 3300048905 | Bacteria | 1540 |
| 465 | Ga0496103_0005520 | 3300048906 | Bacteria | 7565 |
| 466 | Ga0496103_0017788 | 3300048906 | Bacteria | 4258 |
| 467 | Ga0496104_0580980 | 3300048907 | Bacteria | 1031 |
| 468 | Ga0496105_0042187 | 3300048908 | Bacteria | 3760 |
| 469 | Ga0496105_0295884 | 3300048908 | Bacteria | 1302 |
| 470 | Ga0496106_0235042 | 3300048909 | Bacteria | 1464 |
| 471 | Ga0496107_0075669 | 3300048910 | Bacteria | 2451 |
| 472 | Ga0496108_0016861 | 3300048911 | Bacteria | 5970 |
| 473 | Ga0496108_0057861 | 3300048911 | Bacteria | 3257 |
| 474 | Ga0496109_0086496 | 3300048912 | Bacteria | 2895 |
| 475 | Ga0496109_0119507 | 3300048912 | Bacteria | 2454 |
| 476 | Ga0496109_0449827 | 3300048912 | Bacteria | 1217 |
| 477 | Ga0496109_0776738 | 3300048912 | Bacteria | 896 |
| 478 | Ga0496110_0053981 | 3300048913 | Bacteria | 3534 |
| 479 | Ga0496110_0456924 | 3300048913 | Bacteria | 1164 |
| 480 | Ga0496110_0816026 | 3300048913 | Bacteria | 837 |
| 481 | Ga0496111_0315368 | 3300048914 | Bacteria | 1158 |
| 482 | Ga0496114_0019796 | 3300048917 | Bacteria | 5457 |
| 483 | Ga0496114_0125363 | 3300048917 | Bacteria | 2213 |
| 484 | Ga0496114_0342034 | 3300048917 | Bacteria | 1323 |
| 485 | Ga0496121_0021941 | 3300048924 | Bacteria | 6228 |
| 486 | Ga0496121_0096110 | 3300048924 | Bacteria | 2300 |
| 487 | Ga0496121_0290383 | 3300048924 | Bacteria | 1114 |
| 488 | Ga0496122_0110331 | 3300048925 | Bacteria | 1808 |
| 489 | Ga0496122_0299333 | 3300048925 | Bacteria | 868 |
| 490 | Ga0496123_0023826 | 3300048926 | Bacteria | 4674 |
| 491 | Ga0496124_0191264 | 3300048927 | Bacteria | 1566 |
| 492 | Ga0496124_0249867 | 3300048927 | Bacteria | 1313 |
| 493 | Ga0496124_0521464 | 3300048927 | Bacteria | 791 |
| 494 | Ga0496125_0017398 | 3300048928 | Bacteria | 6855 |
| 495 | Ga0496125_0024393 | 3300048928 | Bacteria | 5563 |
| 496 | Ga0496125_0068323 | 3300048928 | Bacteria | 2796 |
| 497 | Ga0496126_0003538 | 3300048929 | Bacteria | 19643 |
| 498 | Ga0496126_0087264 | 3300048929 | Bacteria | 2749 |
| 499 | Ga0501306_035081 | 3300049127 | Bacteria | 760 |
| 500 | Ga0501308_005171 | 3300049128 | Bacteria | 1288 |
| 501 | Ga0501308_042688 | 3300049128 | Bacteria | 643 |
| 502 | Ga0501304_002699 | 3300049160 | Bacteria | 1252 |
| 503 | Ga0495678_000149 | 3300049459 | Bacteria | 84717 |
| 504 | Ga0501311_022280 | 3300049527 | Bacteria | 870 |
| 505 | Ga0501314_002431 | 3300049530 | Bacteria | 1439 |
| 506 | Ga0501320_011426 | 3300049536 | Bacteria | 920 |
| 507 | Ga0501320_030631 | 3300049536 | Bacteria | 668 |
| 508 | Ga0501033_0169638 | 3300049570 | Bacteria | 1568 |
| 509 | Ga0501039_0335185 | 3300049575 | Bacteria | 1189 |
| 510 | Ga0501047_0417163 | 3300049581 | Bacteria | 1174 |
| 511 | Ga0501222_007245 | 3300049662 | Bacteria | 1481 |
| 512 | Ga0501249_002886 | 3300049679 | Bacteria | 3458 |
| 513 | Ga0501269_000242 | 3300049766 | Bacteria | 16005 |
| 514 | Ga0501044_0094562 | 3300049823 | Bacteria | 3013 |
| 515 | nmdc:mga0yw44_469383_c1 | 3300050492 | Bacteria | 853 |
| 516 | nmdc:mga0k408_242904_c1 | 3300050493 | Bacteria | 1075 |
| 517 | nmdc:mga0k408_67391_c1 | 3300050493 | Bacteria | 2086 |
| 518 | nmdc:mga06z11_304531_c1 | 3300050494 | Bacteria | 948 |
| 519 | nmdc:mga06z11_97419_c1 | 3300050494 | Bacteria | 1608 |
| 520 | nmdc:mga09592_16520_c1 | 3300050508 | Bacteria | 6039 |
| 521 | nmdc:mga0qj67_21804_c1 | 3300050509 | Bacteria | 4914 |
| 522 | nmdc:mga08y16_629389_c1 | 3300050511 | Bacteria | 1079 |
| 523 | Ga0495601_0071486 | 3300053077 | Bacteria | 2216 |
| 524 | Ga0495601_0211127 | 3300053077 | Bacteria | 1268 |
| 525 | Ga0495595_0272809 | 3300053084 | Bacteria | 848 |
| 526 | Ga0495619_0083709 | 3300053085 | Bacteria | 2152 |
| 527 | Ga0500618_008810 | 3300053125 | Bacteria | 2788 |
| 528 | Ga0500618_014077 | 3300053125 | Bacteria | 2053 |
| 529 | Ga0500586_000137 | 3300053145 | Bacteria | 13327 |
| 530 | Ga0590074_018157 | 3300059423 | Bacteria | 1203 |
| 531 | Ga0590077_019017 | 3300059426 | Bacteria | 1453 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046528 | Ga0495642_0071958 | Ga0495642_0071958_842_1351 | 169 |
| 2 | 3300047443 | Ga0495687_029636 | Ga0495687_029636_1765_2274 | 169 |
| 3 | 3300048905 | Ga0496102_0290668 | Ga0496102_0290668_1003_1512 | 169 |
| 4 | 3300048917 | Ga0496114_0342034 | Ga0496114_0342034_747_1256 | 169 |
| 5 | 3300049527 | Ga0501311_022280 | Ga0501311_022280_18_533 | 170 |
| 6 | iso_pu_bacteria | 2521172590 | 2521560051 | 172 |
| 7 | iso_pu_bacteria | 2904439833 | 2904440915 | 172 |
| 8 | iso_pu_bacteria | 2904530477 | 2904535517 | 172 |
| 9 | iso_pu_bacteria | 2904584206 | 2904588342 | 172 |
| 10 | iso_pu_bacteria | 2904589729 | 2904594770 | 172 |
| 11 | iso_pu_bacteria | 2904601388 | 2904606033 | 172 |
| 12 | iso_pu_bacteria | 2919046199 | 2919049082 | 172 |
| 13 | iso_pu_bacteria | 2919079590 | 2919084691 | 172 |
| 14 | iso_pu_bacteria | 2923510766 | 2923513782 | 172 |
| 15 | iso_pu_bacteria | 2928130867 | 2928134381 | 172 |
| 16 | iso_pu_bacteria | 2904424332 | 2904427924 | 174 |
| 17 | 3300009551 | Ga0105238_10000037 | Ga0105238_100000378 | 176 |
| 18 | 3300010375 | Ga0105239_10003694 | Ga0105239_100036947 | 176 |
| 19 | 3300025224 | Ga0209784_100021 | Ga0209784_100021233 | 176 |
| 20 | 3300025225 | Ga0209566_100039 | Ga0209566_100039234 | 176 |
| 21 | 3300025226 | Ga0209674_100036 | Ga0209674_100036233 | 176 |
| 22 | 3300025230 | Ga0209563_100040 | Ga0209563_100040233 | 176 |
| 23 | 3300025253 | Ga0209677_100023 | Ga0209677_100023233 | 176 |
| 24 | 3300039447 | Ga0436361_0704696 | Ga0436361_0704696_3420_3950 | 176 |
| 25 | 3300049127 | Ga0501306_035081 | Ga0501306_035081_16_549 | 176 |
| 26 | 3300053125 | Ga0500618_008810 | Ga0500618_008810_2161_2691 | 176 |
| 27 | 3300009177 | Ga0105248_10051344 | Ga0105248_100513443 | 177 |
| 28 | 3300006028 | Ga0070717_10009296 | Ga0070717_100092965 | 179 |
| 29 | 3300035691 | Ga0373931_0096810 | Ga0373931_0096810_590_1186 | 179 |
| 30 | 3300035086 | Ga0373934_0143239 | Ga0373934_0143239_358_960 | 182 |
| 31 | 3300042435 | Ga0439434_0142528 | Ga0439434_0142528_41_601 | 186 |
| 32 | 3300013105 | Ga0157369_10653134 | Ga0157369_106531341 | 187 |
| 33 | 3300031727 | Ga0316576_10163425 | Ga0316576_101634252 | 187 |
| 34 | 3300033541 | Ga0316596_1053168 | Ga0316596_10531682 | 187 |
| 35 | 3300049536 | Ga0501320_030631 | Ga0501320_030631_22_591 | 189 |
| 36 | 3300048904 | Ga0496101_0323484 | Ga0496101_0323484_350_958 | 190 |
| 37 | 3300006048 | Ga0075363_100256117 | Ga0075363_1002561172 | 191 |
| 38 | iso_pu_bacteria | 2932422444 | 2932424015 | 194 |
| 39 | 3300031665 | Ga0316575_10037334 | Ga0316575_100373342 | 195 |
| 40 | 3300035398 | Ga0316574_0044253 | Ga0316574_0044253_720_1316 | 195 |
| 41 | 3300042876 | Ga0451577_0073985 | Ga0451577_0073985_718_1305 | 195 |
| 42 | 3300044673 | Ga0453683_0041666 | Ga0453683_0041666_2054_2641 | 195 |
| 43 | 3300044673 | Ga0453683_0251108 | Ga0453683_0251108_138_725 | 195 |
| 44 | 3300045051 | Ga0451576_0042696 | Ga0451576_0042696_3802_4389 | 195 |
| 45 | iso_pu_bacteria | 2643221596 | 2643991603 | 195 |
| 46 | iso_pu_bacteria | 2643221654 | 2644301378 | 195 |
| 47 | iso_pu_bacteria | 2643221717 | 2644648512 | 195 |
| 48 | 3300045051 | Ga0451576_0248415 | Ga0451576_0248415_800_1390 | 196 |
| 49 | 3300014326 | Ga0157380_10325853 | Ga0157380_103258532 | 197 |
| 50 | iso_pu_bacteria | 2857553236 | 2857556442 | 197 |
| 51 | 3300003792 | Ga0055540_1011442 | Ga0055540_10114422 | 198 |
| 52 | 3300003794 | Ga0055531_10000257 | Ga0055531_1000025743 | 198 |
| 53 | 3300005327 | Ga0070658_10190477 | Ga0070658_101904772 | 198 |
| 54 | 3300005327 | Ga0070658_10261294 | Ga0070658_102612942 | 198 |
| 55 | 3300005331 | Ga0070670_100001787 | Ga0070670_1000017877 | 198 |
| 56 | 3300005338 | Ga0068868_100332809 | Ga0068868_1003328092 | 198 |
| 57 | 3300005347 | Ga0070668_100893251 | Ga0070668_1008932511 | 198 |
| 58 | 3300005354 | Ga0070675_100059035 | Ga0070675_1000590353 | 198 |
| 59 | 3300005355 | Ga0070671_100080633 | Ga0070671_1000806331 | 198 |
| 60 | 3300005364 | Ga0070673_100143620 | Ga0070673_1001436202 | 198 |
| 61 | 3300005543 | Ga0070672_100008932 | Ga0070672_1000089326 | 198 |
| 62 | 3300005618 | Ga0068864_100034125 | Ga0068864_1000341252 | 198 |
| 63 | 3300005834 | Ga0068851_10092912 | Ga0068851_100929122 | 198 |
| 64 | 3300005842 | Ga0068858_100610245 | Ga0068858_1006102452 | 198 |
| 65 | 3300006038 | Ga0075365_10051467 | Ga0075365_100514673 | 198 |
| 66 | 3300006038 | Ga0075365_10093861 | Ga0075365_100938612 | 198 |
| 67 | 3300006038 | Ga0075365_10474755 | Ga0075365_104747552 | 198 |
| 68 | 3300006042 | Ga0075368_10086394 | Ga0075368_100863942 | 198 |
| 69 | 3300006178 | Ga0075367_10161645 | Ga0075367_101616452 | 198 |
| 70 | 3300006178 | Ga0075367_10249889 | Ga0075367_102498892 | 198 |
| 71 | 3300006195 | Ga0075366_10276794 | Ga0075366_102767942 | 198 |
| 72 | 3300006237 | Ga0097621_100082351 | Ga0097621_1000823512 | 198 |
| 73 | 3300006353 | Ga0075370_10237519 | Ga0075370_102375192 | 198 |
| 74 | 3300006358 | Ga0068871_100039576 | Ga0068871_1000395762 | 198 |
| 75 | 3300006880 | Ga0075429_100396307 | Ga0075429_1003963072 | 198 |
| 76 | 3300009147 | Ga0114129_11168625 | Ga0114129_111686252 | 198 |
| 77 | 3300013308 | Ga0157375_10260281 | Ga0157375_102602812 | 198 |
| 78 | 3300014968 | Ga0157379_10098500 | Ga0157379_100985002 | 198 |
| 79 | 3300014969 | Ga0157376_10403153 | Ga0157376_104031532 | 198 |
| 80 | 3300025273 | Ga0209673_1005215 | Ga0209673_10052155 | 198 |
| 81 | 3300025303 | Ga0209051_1000025 | Ga0209051_100002515 | 198 |
| 82 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039593 | 198 |
| 83 | 3300025909 | Ga0207705_10172892 | Ga0207705_101728922 | 198 |
| 84 | 3300025925 | Ga0207650_10022106 | Ga0207650_100221063 | 198 |
| 85 | 3300025926 | Ga0207659_10039901 | Ga0207659_100399012 | 198 |
| 86 | 3300025931 | Ga0207644_10900493 | Ga0207644_109004931 | 198 |
| 87 | 3300025940 | Ga0207691_10004404 | Ga0207691_100044042 | 198 |
| 88 | 3300025945 | Ga0207679_11014652 | Ga0207679_110146522 | 198 |
| 89 | 3300025960 | Ga0207651_10009154 | Ga0207651_100091542 | 198 |
| 90 | 3300026035 | Ga0207703_10435705 | Ga0207703_104357052 | 198 |
| 91 | 3300026088 | Ga0207641_10314816 | Ga0207641_103148162 | 198 |
| 92 | 3300026095 | Ga0207676_10002741 | Ga0207676_100027414 | 198 |
| 93 | 3300026121 | Ga0207683_10484206 | Ga0207683_104842062 | 198 |
| 94 | 3300026142 | Ga0207698_10987811 | Ga0207698_109878111 | 198 |
| 95 | 3300027866 | Ga0209813_10021609 | Ga0209813_100216092 | 198 |
| 96 | 3300028794 | Ga0307515_10001484 | Ga0307515_1000148429 | 198 |
| 97 | 3300031239 | Ga0265328_10040645 | Ga0265328_100406452 | 198 |
| 98 | 3300031250 | Ga0265331_10001643 | Ga0265331_1000164317 | 198 |
| 99 | 3300031251 | Ga0265327_10000012 | Ga0265327_10000012219 | 198 |
| 100 | 3300031251 | Ga0265327_10038138 | Ga0265327_100381383 | 198 |
| 101 | 3300031649 | Ga0307514_10000355 | Ga0307514_100003552 | 198 |
| 102 | 3300031730 | Ga0307516_10080487 | Ga0307516_100804873 | 198 |
| 103 | 3300031911 | Ga0307412_11053087 | Ga0307412_110530871 | 198 |
| 104 | 3300037312 | Ga0395899_0008661 | Ga0395899_0008661_2851_3447 | 198 |
| 105 | 3300037418 | Ga0395900_0047478 | Ga0395900_0047478_2057_2653 | 198 |
| 106 | 3300037466 | Ga0395898_0018204 | Ga0395898_0018204_4918_5514 | 198 |
| 107 | 3300039447 | Ga0436361_0266216 | Ga0436361_0266216_63_659 | 198 |
| 108 | 3300039447 | Ga0436361_0548576 | Ga0436361_0548576_690_1286 | 198 |
| 109 | 3300041406 | Ga0439439_0080551 | Ga0439439_0080551_133_729 | 198 |
| 110 | 3300041408 | Ga0439453_0068146 | Ga0439453_0068146_55_651 | 198 |
| 111 | 3300041496 | Ga0451839_0444511 | Ga0451839_0444511_163_765 | 198 |
| 112 | 3300042007 | Ga0439449_0001504 | Ga0439449_0001504_2326_2922 | 198 |
| 113 | 3300042014 | Ga0439457_029445 | Ga0439457_029445_195_791 | 198 |
| 114 | 3300042015 | Ga0439462_0023380 | Ga0439462_0023380_774_1370 | 198 |
| 115 | 3300042116 | Ga0450912_004814 | Ga0450912_004814_121_717 | 198 |
| 116 | 3300042118 | Ga0450914_005362 | Ga0450914_005362_229_918 | 198 |
| 117 | 3300042127 | Ga0450890_004603 | Ga0450890_004603_1043_1732 | 198 |
| 118 | 3300042128 | Ga0450897_000220 | Ga0450897_000220_1646_2242 | 198 |
| 119 | 3300042157 | Ga0439458_0029326 | Ga0439458_0029326_438_1127 | 198 |
| 120 | 3300042435 | Ga0439434_0078516 | Ga0439434_0078516_106_795 | 198 |
| 121 | 3300042437 | Ga0439444_0018308 | Ga0439444_0018308_405_1001 | 198 |
| 122 | 3300042461 | Ga0439460_0032543 | Ga0439460_0032543_563_1159 | 198 |
| 123 | 3300044673 | Ga0453683_0001910 | Ga0453683_0001910_721_1317 | 198 |
| 124 | 3300044712 | Ga0453684_0000163 | Ga0453684_0000163_268340_268936 | 198 |
| 125 | 3300044842 | Ga0466957_0162753 | Ga0466957_0162753_172_768 | 198 |
| 126 | 3300045051 | Ga0451576_0044571 | Ga0451576_0044571_277_873 | 198 |
| 127 | 3300045051 | Ga0451576_0056425 | Ga0451576_0056425_2949_3545 | 198 |
| 128 | 3300045051 | Ga0451576_0178645 | Ga0451576_0178645_454_1050 | 198 |
| 129 | 3300045051 | Ga0451576_0334769 | Ga0451576_0334769_776_1372 | 198 |
| 130 | 3300046459 | Ga0495629_0099975 | Ga0495629_0099975_1375_1971 | 198 |
| 131 | 3300046477 | Ga0495664_0192042 | Ga0495664_0192042_170_766 | 198 |
| 132 | 3300046543 | Ga0495645_0117436 | Ga0495645_0117436_1125_1721 | 198 |
| 133 | 3300046558 | Ga0495633_0002867 | Ga0495633_0002867_486_1082 | 198 |
| 134 | 3300046683 | Ga0495658_0083861 | Ga0495658_0083861_428_1024 | 198 |
| 135 | 3300048912 | Ga0496109_0449827 | Ga0496109_0449827_256_852 | 198 |
| 136 | 3300048925 | Ga0496122_0299333 | Ga0496122_0299333_262_858 | 198 |
| 137 | 3300049128 | Ga0501308_005171 | Ga0501308_005171_74_670 | 198 |
| 138 | 3300049160 | Ga0501304_002699 | Ga0501304_002699_585_1181 | 198 |
| 139 | 3300049530 | Ga0501314_002431 | Ga0501314_002431_167_763 | 198 |
| 140 | 3300049570 | Ga0501033_0169638 | Ga0501033_0169638_86_682 | 198 |
| 141 | 3300049575 | Ga0501039_0335185 | Ga0501039_0335185_484_1080 | 198 |
| 142 | 3300049581 | Ga0501047_0417163 | Ga0501047_0417163_459_1055 | 198 |
| 143 | 3300049662 | Ga0501222_007245 | Ga0501222_007245_311_907 | 198 |
| 144 | 3300049823 | Ga0501044_0094562 | Ga0501044_0094562_1702_2298 | 198 |
| 145 | 3300050492 | nmdc:mga0yw44_469383_c1 | nmdc:mga0yw44_469383_c1_175_771 | 198 |
| 146 | 3300050493 | nmdc:mga0k408_67391_c1 | nmdc:mga0k408_67391_c1_1395_1991 | 198 |
| 147 | 3300050494 | nmdc:mga06z11_304531_c1 | nmdc:mga06z11_304531_c1_167_763 | 198 |
| 148 | 3300050494 | nmdc:mga06z11_97419_c1 | nmdc:mga06z11_97419_c1_924_1520 | 198 |
| 149 | 3300053077 | Ga0495601_0071486 | Ga0495601_0071486_240_836 | 198 |
| 150 | 3300053084 | Ga0495595_0272809 | Ga0495595_0272809_54_650 | 198 |
| 151 | 3300059423 | Ga0590074_018157 | Ga0590074_018157_466_1062 | 198 |
| 152 | 3300059426 | Ga0590077_019017 | Ga0590077_019017_636_1232 | 198 |
| 153 | iso_pu_bacteria | 2511231003 | 2511249704 | 198 |
| 154 | iso_pu_bacteria | 2511231026 | 2511385595 | 198 |
| 155 | iso_pu_bacteria | 2551306416 | 2553008079 | 198 |
| 156 | iso_pu_bacteria | 2643221603 | 2644027031 | 198 |
| 157 | iso_pu_bacteria | 2738541280 | 2738738266 | 198 |
| 158 | iso_pu_bacteria | 2738541297 | 2738826601 | 198 |
| 159 | iso_pu_bacteria | 2738541357 | 2739150398 | 198 |
| 160 | iso_pu_bacteria | 2738543003 | 2739192317 | 198 |
| 161 | iso_pu_bacteria | 2738543026 | 2739318794 | 198 |
| 162 | iso_pu_bacteria | 2738543029 | 2739337035 | 198 |
| 163 | iso_pu_bacteria | 2808606415 | 2809129570 | 198 |
| 164 | iso_pu_bacteria | 2808606419 | 2809149375 | 198 |
| 165 | iso_pu_bacteria | 2821131069 | 2821135313 | 198 |
| 166 | iso_pu_bacteria | 2842711865 | 2842717377 | 198 |
| 167 | iso_pu_bacteria | 2857558681 | 2857562176 | 198 |
| 168 | iso_pu_bacteria | 2857564685 | 2857567830 | 198 |
| 169 | iso_pu_bacteria | 2919476304 | 2919476788 | 198 |
| 170 | 3300003187 | JGI25151J46595_10000864 | JGI25151J46595_100008646 | 199 |
| 171 | 3300003775 | Ga0055524_1000013 | Ga0055524_1000013249 | 199 |
| 172 | 3300003791 | Ga0055530_10015172 | Ga0055530_100151722 | 199 |
| 173 | 3300003792 | Ga0055540_1000001 | Ga0055540_100000112 | 199 |
| 174 | 3300003794 | Ga0055531_10010669 | Ga0055531_100106693 | 199 |
| 175 | 3300005293 | Ga0065715_10124382 | Ga0065715_101243821 | 199 |
| 176 | 3300005327 | Ga0070658_10352166 | Ga0070658_103521662 | 199 |
| 177 | 3300005328 | Ga0070676_10019669 | Ga0070676_100196693 | 199 |
| 178 | 3300005328 | Ga0070676_10640135 | Ga0070676_106401351 | 199 |
| 179 | 3300005329 | Ga0070683_100302591 | Ga0070683_1003025912 | 199 |
| 180 | 3300005330 | Ga0070690_100027294 | Ga0070690_1000272943 | 199 |
| 181 | 3300005331 | Ga0070670_100056429 | Ga0070670_1000564294 | 199 |
| 182 | 3300005331 | Ga0070670_100082233 | Ga0070670_1000822332 | 199 |
| 183 | 3300005331 | Ga0070670_100225003 | Ga0070670_1002250032 | 199 |
| 184 | 3300005331 | Ga0070670_100511435 | Ga0070670_1005114352 | 199 |
| 185 | 3300005331 | Ga0070670_100575144 | Ga0070670_1005751441 | 199 |
| 186 | 3300005333 | Ga0070677_10012687 | Ga0070677_100126872 | 199 |
| 187 | 3300005333 | Ga0070677_10019872 | Ga0070677_100198722 | 199 |
| 188 | 3300005333 | Ga0070677_10037630 | Ga0070677_100376302 | 199 |
| 189 | 3300005335 | Ga0070666_10005194 | Ga0070666_100051947 | 199 |
| 190 | 3300005337 | Ga0070682_100414925 | Ga0070682_1004149252 | 199 |
| 191 | 3300005338 | Ga0068868_100000966 | Ga0068868_10000096622 | 199 |
| 192 | 3300005338 | Ga0068868_100060218 | Ga0068868_1000602181 | 199 |
| 193 | 3300005338 | Ga0068868_100251567 | Ga0068868_1002515672 | 199 |
| 194 | 3300005340 | Ga0070689_100033031 | Ga0070689_1000330312 | 199 |
| 195 | 3300005343 | Ga0070687_100021471 | Ga0070687_1000214712 | 199 |
| 196 | 3300005344 | Ga0070661_100007516 | Ga0070661_1000075161 | 199 |
| 197 | 3300005344 | Ga0070661_100325800 | Ga0070661_1003258002 | 199 |
| 198 | 3300005344 | Ga0070661_100643032 | Ga0070661_1006430321 | 199 |
| 199 | 3300005347 | Ga0070668_100101677 | Ga0070668_1001016772 | 199 |
| 200 | 3300005347 | Ga0070668_100130279 | Ga0070668_1001302793 | 199 |
| 201 | 3300005347 | Ga0070668_100382209 | Ga0070668_1003822091 | 199 |
| 202 | 3300005353 | Ga0070669_100101679 | Ga0070669_1001016793 | 199 |
| 203 | 3300005353 | Ga0070669_100271417 | Ga0070669_1002714172 | 199 |
| 204 | 3300005354 | Ga0070675_100007798 | Ga0070675_1000077983 | 199 |
| 205 | 3300005354 | Ga0070675_100071831 | Ga0070675_1000718313 | 199 |
| 206 | 3300005354 | Ga0070675_100296186 | Ga0070675_1002961862 | 199 |
| 207 | 3300005355 | Ga0070671_100003392 | Ga0070671_1000033927 | 199 |
| 208 | 3300005356 | Ga0070674_100101588 | Ga0070674_1001015883 | 199 |
| 209 | 3300005356 | Ga0070674_100270579 | Ga0070674_1002705792 | 199 |
| 210 | 3300005356 | Ga0070674_100923742 | Ga0070674_1009237421 | 199 |
| 211 | 3300005364 | Ga0070673_100040581 | Ga0070673_1000405812 | 199 |
| 212 | 3300005364 | Ga0070673_100140074 | Ga0070673_1001400742 | 199 |
| 213 | 3300005364 | Ga0070673_100408454 | Ga0070673_1004084542 | 199 |
| 214 | 3300005364 | Ga0070673_100824476 | Ga0070673_1008244761 | 199 |
| 215 | 3300005366 | Ga0070659_100246959 | Ga0070659_1002469592 | 199 |
| 216 | 3300005366 | Ga0070659_100520511 | Ga0070659_1005205112 | 199 |
| 217 | 3300005367 | Ga0070667_100031351 | Ga0070667_1000313514 | 199 |
| 218 | 3300005367 | Ga0070667_100064801 | Ga0070667_1000648014 | 199 |
| 219 | 3300005367 | Ga0070667_100227943 | Ga0070667_1002279432 | 199 |
| 220 | 3300005438 | Ga0070701_10322081 | Ga0070701_103220812 | 199 |
| 221 | 3300005441 | Ga0070700_100272002 | Ga0070700_1002720022 | 199 |
| 222 | 3300005456 | Ga0070678_100005704 | Ga0070678_1000057042 | 199 |
| 223 | 3300005456 | Ga0070678_100012914 | Ga0070678_1000129143 | 199 |
| 224 | 3300005456 | Ga0070678_100085907 | Ga0070678_1000859072 | 199 |
| 225 | 3300005456 | Ga0070678_100099794 | Ga0070678_1000997943 | 199 |
| 226 | 3300005456 | Ga0070678_100185099 | Ga0070678_1001850992 | 199 |
| 227 | 3300005456 | Ga0070678_100243614 | Ga0070678_1002436142 | 199 |
| 228 | 3300005456 | Ga0070678_100498987 | Ga0070678_1004989872 | 199 |
| 229 | 3300005457 | Ga0070662_100177439 | Ga0070662_1001774392 | 199 |
| 230 | 3300005457 | Ga0070662_100476676 | Ga0070662_1004766761 | 199 |
| 231 | 3300005458 | Ga0070681_10533713 | Ga0070681_105337132 | 199 |
| 232 | 3300005459 | Ga0068867_100066600 | Ga0068867_1000666002 | 199 |
| 233 | 3300005543 | Ga0070672_100118022 | Ga0070672_1001180223 | 199 |
| 234 | 3300005543 | Ga0070672_100312456 | Ga0070672_1003124562 | 199 |
| 235 | 3300005543 | Ga0070672_100472174 | Ga0070672_1004721742 | 199 |
| 236 | 3300005543 | Ga0070672_100480844 | Ga0070672_1004808441 | 199 |
| 237 | 3300005544 | Ga0070686_100290146 | Ga0070686_1002901462 | 199 |
| 238 | 3300005563 | Ga0068855_100408641 | Ga0068855_1004086412 | 199 |
| 239 | 3300005564 | Ga0070664_100116201 | Ga0070664_1001162011 | 199 |
| 240 | 3300005564 | Ga0070664_100220335 | Ga0070664_1002203352 | 199 |
| 241 | 3300005564 | Ga0070664_100298845 | Ga0070664_1002988452 | 199 |
| 242 | 3300005614 | Ga0068856_100007776 | Ga0068856_10000777614 | 199 |
| 243 | 3300005614 | Ga0068856_100362132 | Ga0068856_1003621322 | 199 |
| 244 | 3300005615 | Ga0070702_100192744 | Ga0070702_1001927441 | 199 |
| 245 | 3300005616 | Ga0068852_100060003 | Ga0068852_1000600032 | 199 |
| 246 | 3300005616 | Ga0068852_100107340 | Ga0068852_1001073402 | 199 |
| 247 | 3300005616 | Ga0068852_100119867 | Ga0068852_1001198673 | 199 |
| 248 | 3300005616 | Ga0068852_100311429 | Ga0068852_1003114292 | 199 |
| 249 | 3300005616 | Ga0068852_100345451 | Ga0068852_1003454512 | 199 |
| 250 | 3300005616 | Ga0068852_100663935 | Ga0068852_1006639352 | 199 |
| 251 | 3300005617 | Ga0068859_100023273 | Ga0068859_1000232733 | 199 |
| 252 | 3300005617 | Ga0068859_100138540 | Ga0068859_1001385403 | 199 |
| 253 | 3300005618 | Ga0068864_100002065 | Ga0068864_1000020654 | 199 |
| 254 | 3300005618 | Ga0068864_100117385 | Ga0068864_1001173851 | 199 |
| 255 | 3300005618 | Ga0068864_100208549 | Ga0068864_1002085492 | 199 |
| 256 | 3300005718 | Ga0068866_10055652 | Ga0068866_100556522 | 199 |
| 257 | 3300005718 | Ga0068866_10067821 | Ga0068866_100678213 | 199 |
| 258 | 3300005719 | Ga0068861_100043238 | Ga0068861_1000432382 | 199 |
| 259 | 3300005719 | Ga0068861_100422040 | Ga0068861_1004220402 | 199 |
| 260 | 3300005719 | Ga0068861_100754073 | Ga0068861_1007540731 | 199 |
| 261 | 3300005834 | Ga0068851_10031414 | Ga0068851_100314141 | 199 |
| 262 | 3300005834 | Ga0068851_10084706 | Ga0068851_100847062 | 199 |
| 263 | 3300005834 | Ga0068851_10165438 | Ga0068851_101654381 | 199 |
| 264 | 3300005840 | Ga0068870_10143448 | Ga0068870_101434482 | 199 |
| 265 | 3300005841 | Ga0068863_100019244 | Ga0068863_1000192443 | 199 |
| 266 | 3300005841 | Ga0068863_100058378 | Ga0068863_1000583783 | 199 |
| 267 | 3300005841 | Ga0068863_100135245 | Ga0068863_1001352452 | 199 |
| 268 | 3300005841 | Ga0068863_100396977 | Ga0068863_1003969772 | 199 |
| 269 | 3300005842 | Ga0068858_100008614 | Ga0068858_1000086146 | 199 |
| 270 | 3300005842 | Ga0068858_100150332 | Ga0068858_1001503323 | 199 |
| 271 | 3300005843 | Ga0068860_100007016 | Ga0068860_1000070164 | 199 |
| 272 | 3300005843 | Ga0068860_100151850 | Ga0068860_1001518502 | 199 |
| 273 | 3300005844 | Ga0068862_100041306 | Ga0068862_1000413063 | 199 |
| 274 | 3300005844 | Ga0068862_100097384 | Ga0068862_1000973842 | 199 |
| 275 | 3300006038 | Ga0075365_10004820 | Ga0075365_100048205 | 199 |
| 276 | 3300006195 | Ga0075366_10085626 | Ga0075366_100856261 | 199 |
| 277 | 3300006237 | Ga0097621_100030577 | Ga0097621_1000305774 | 199 |
| 278 | 3300006358 | Ga0068871_100306424 | Ga0068871_1003064242 | 199 |
| 279 | 3300006844 | Ga0075428_101073449 | Ga0075428_1010734491 | 199 |
| 280 | 3300006846 | Ga0075430_100133848 | Ga0075430_1001338482 | 199 |
| 281 | 3300006880 | Ga0075429_100048258 | Ga0075429_1000482582 | 199 |
| 282 | 3300006881 | Ga0068865_100543685 | Ga0068865_1005436852 | 199 |
| 283 | 3300006931 | Ga0097620_100023272 | Ga0097620_1000232723 | 199 |
| 284 | 3300006931 | Ga0097620_100138542 | Ga0097620_1001385423 | 199 |
| 285 | 3300006946 | Ga0079104_1000070 | Ga0079104_100007047 | 199 |
| 286 | 3300009098 | Ga0105245_10268171 | Ga0105245_102681712 | 199 |
| 287 | 3300009098 | Ga0105245_10766541 | Ga0105245_107665411 | 199 |
| 288 | 3300009148 | Ga0105243_10096253 | Ga0105243_100962533 | 199 |
| 289 | 3300009177 | Ga0105248_10200227 | Ga0105248_102002272 | 199 |
| 290 | 3300009177 | Ga0105248_10276432 | Ga0105248_102764322 | 199 |
| 291 | 3300009551 | Ga0105238_10005477 | Ga0105238_100054773 | 199 |
| 292 | 3300009553 | Ga0105249_10106513 | Ga0105249_101065132 | 199 |
| 293 | 3300013100 | Ga0157373_10133902 | Ga0157373_101339023 | 199 |
| 294 | 3300013102 | Ga0157371_10063837 | Ga0157371_100638373 | 199 |
| 295 | 3300013102 | Ga0157371_10131978 | Ga0157371_101319782 | 199 |
| 296 | 3300013296 | Ga0157374_10091075 | Ga0157374_100910752 | 199 |
| 297 | 3300013297 | Ga0157378_10700956 | Ga0157378_107009562 | 199 |
| 298 | 3300013307 | Ga0157372_10269502 | Ga0157372_102695022 | 199 |
| 299 | 3300013307 | Ga0157372_10598551 | Ga0157372_105985511 | 199 |
| 300 | 3300013308 | Ga0157375_10134369 | Ga0157375_101343693 | 199 |
| 301 | 3300013308 | Ga0157375_10750916 | Ga0157375_107509162 | 199 |
| 302 | 3300014325 | Ga0163163_10035273 | Ga0163163_100352733 | 199 |
| 303 | 3300014325 | Ga0163163_10102638 | Ga0163163_101026382 | 199 |
| 304 | 3300014326 | Ga0157380_10185851 | Ga0157380_101858512 | 199 |
| 305 | 3300014326 | Ga0157380_10526215 | Ga0157380_105262152 | 199 |
| 306 | 3300014968 | Ga0157379_10055008 | Ga0157379_100550082 | 199 |
| 307 | 3300014969 | Ga0157376_10042949 | Ga0157376_100429492 | 199 |
| 308 | 3300017792 | Ga0163161_10013100 | Ga0163161_100131002 | 199 |
| 309 | 3300017792 | Ga0163161_10177820 | Ga0163161_101778202 | 199 |
| 310 | 3300017792 | Ga0163161_10296468 | Ga0163161_102964682 | 199 |
| 311 | 3300025263 | Ga0209565_1004707 | Ga0209565_10047073 | 199 |
| 312 | 3300025271 | Ga0207666_1002451 | Ga0207666_10024512 | 199 |
| 313 | 3300025291 | Ga0209675_1009287 | Ga0209675_10092872 | 199 |
| 314 | 3300025298 | Ga0209050_1000730 | Ga0209050_100073053 | 199 |
| 315 | 3300025298 | Ga0209050_1023274 | Ga0209050_10232741 | 199 |
| 316 | 3300025299 | Ga0209256_1000061 | Ga0209256_1000061251 | 199 |
| 317 | 3300025303 | Ga0209051_1000018 | Ga0209051_1000018438 | 199 |
| 318 | 3300025304 | Ga0209257_1000461 | Ga0209257_100046113 | 199 |
| 319 | 3300025321 | Ga0207656_10080050 | Ga0207656_100800502 | 199 |
| 320 | 3300025893 | Ga0207682_10029330 | Ga0207682_100293303 | 199 |
| 321 | 3300025899 | Ga0207642_10007097 | Ga0207642_100070972 | 199 |
| 322 | 3300025901 | Ga0207688_10033176 | Ga0207688_100331763 | 199 |
| 323 | 3300025903 | Ga0207680_10002711 | Ga0207680_100027113 | 199 |
| 324 | 3300025903 | Ga0207680_10045424 | Ga0207680_100454243 | 199 |
| 325 | 3300025905 | Ga0207685_10139029 | Ga0207685_101390291 | 199 |
| 326 | 3300025907 | Ga0207645_10067098 | Ga0207645_100670983 | 199 |
| 327 | 3300025907 | Ga0207645_10590918 | Ga0207645_105909181 | 199 |
| 328 | 3300025909 | Ga0207705_10045619 | Ga0207705_100456193 | 199 |
| 329 | 3300025918 | Ga0207662_10005846 | Ga0207662_100058466 | 199 |
| 330 | 3300025919 | Ga0207657_10164635 | Ga0207657_101646352 | 199 |
| 331 | 3300025920 | Ga0207649_10014780 | Ga0207649_100147806 | 199 |
| 332 | 3300025920 | Ga0207649_10218481 | Ga0207649_102184811 | 199 |
| 333 | 3300025923 | Ga0207681_10119486 | Ga0207681_101194862 | 199 |
| 334 | 3300025923 | Ga0207681_10289422 | Ga0207681_102894222 | 199 |
| 335 | 3300025923 | Ga0207681_10355075 | Ga0207681_103550752 | 199 |
| 336 | 3300025924 | Ga0207694_10029099 | Ga0207694_100290994 | 199 |
| 337 | 3300025925 | Ga0207650_10010685 | Ga0207650_100106855 | 199 |
| 338 | 3300025925 | Ga0207650_10118137 | Ga0207650_101181373 | 199 |
| 339 | 3300025925 | Ga0207650_10483410 | Ga0207650_104834102 | 199 |
| 340 | 3300025926 | Ga0207659_10002170 | Ga0207659_100021706 | 199 |
| 341 | 3300025926 | Ga0207659_10100788 | Ga0207659_101007882 | 199 |
| 342 | 3300025926 | Ga0207659_10679410 | Ga0207659_106794101 | 199 |
| 343 | 3300025931 | Ga0207644_10002319 | Ga0207644_100023197 | 199 |
| 344 | 3300025931 | Ga0207644_10178867 | Ga0207644_101788672 | 199 |
| 345 | 3300025931 | Ga0207644_10200133 | Ga0207644_102001332 | 199 |
| 346 | 3300025933 | Ga0207706_10442293 | Ga0207706_104422931 | 199 |
| 347 | 3300025934 | Ga0207686_10062692 | Ga0207686_100626923 | 199 |
| 348 | 3300025934 | Ga0207686_10471043 | Ga0207686_104710431 | 199 |
| 349 | 3300025936 | Ga0207670_10033210 | Ga0207670_100332103 | 199 |
| 350 | 3300025938 | Ga0207704_10037758 | Ga0207704_100377582 | 199 |
| 351 | 3300025938 | Ga0207704_10518695 | Ga0207704_105186951 | 199 |
| 352 | 3300025939 | Ga0207665_10604735 | Ga0207665_106047351 | 199 |
| 353 | 3300025940 | Ga0207691_10078833 | Ga0207691_100788333 | 199 |
| 354 | 3300025940 | Ga0207691_10152235 | Ga0207691_101522352 | 199 |
| 355 | 3300025940 | Ga0207691_10440089 | Ga0207691_104400892 | 199 |
| 356 | 3300025940 | Ga0207691_10449364 | Ga0207691_104493642 | 199 |
| 357 | 3300025940 | Ga0207691_10745921 | Ga0207691_107459212 | 199 |
| 358 | 3300025941 | Ga0207711_10019236 | Ga0207711_100192363 | 199 |
| 359 | 3300025941 | Ga0207711_10117888 | Ga0207711_101178883 | 199 |
| 360 | 3300025942 | Ga0207689_10030687 | Ga0207689_100306873 | 199 |
| 361 | 3300025945 | Ga0207679_10062453 | Ga0207679_100624532 | 199 |
| 362 | 3300025960 | Ga0207651_10059158 | Ga0207651_100591582 | 199 |
| 363 | 3300025960 | Ga0207651_10174777 | Ga0207651_101747771 | 199 |
| 364 | 3300025960 | Ga0207651_10489629 | Ga0207651_104896292 | 199 |
| 365 | 3300025961 | Ga0207712_10029229 | Ga0207712_100292293 | 199 |
| 366 | 3300025961 | Ga0207712_10726267 | Ga0207712_107262671 | 199 |
| 367 | 3300025972 | Ga0207668_10124497 | Ga0207668_101244972 | 199 |
| 368 | 3300025972 | Ga0207668_10188242 | Ga0207668_101882422 | 199 |
| 369 | 3300025972 | Ga0207668_10472824 | Ga0207668_104728242 | 199 |
| 370 | 3300025972 | Ga0207668_11209192 | Ga0207668_112091921 | 199 |
| 371 | 3300025981 | Ga0207640_10216146 | Ga0207640_102161462 | 199 |
| 372 | 3300025981 | Ga0207640_10828040 | Ga0207640_108280401 | 199 |
| 373 | 3300025986 | Ga0207658_10004072 | Ga0207658_100040727 | 199 |
| 374 | 3300025986 | Ga0207658_10138894 | Ga0207658_101388942 | 199 |
| 375 | 3300026023 | Ga0207677_10001522 | Ga0207677_1000152215 | 199 |
| 376 | 3300026023 | Ga0207677_10739198 | Ga0207677_107391981 | 199 |
| 377 | 3300026023 | Ga0207677_10800620 | Ga0207677_108006201 | 199 |
| 378 | 3300026035 | Ga0207703_10006064 | Ga0207703_100060644 | 199 |
| 379 | 3300026035 | Ga0207703_10025831 | Ga0207703_100258314 | 199 |
| 380 | 3300026041 | Ga0207639_10409656 | Ga0207639_104096561 | 199 |
| 381 | 3300026041 | Ga0207639_10699521 | Ga0207639_106995211 | 199 |
| 382 | 3300026075 | Ga0207708_10060894 | Ga0207708_100608943 | 199 |
| 383 | 3300026075 | Ga0207708_10307812 | Ga0207708_103078122 | 199 |
| 384 | 3300026078 | Ga0207702_10004429 | Ga0207702_1000442917 | 199 |
| 385 | 3300026088 | Ga0207641_10019502 | Ga0207641_100195022 | 199 |
| 386 | 3300026088 | Ga0207641_10034241 | Ga0207641_100342412 | 199 |
| 387 | 3300026089 | Ga0207648_10147355 | Ga0207648_101473552 | 199 |
| 388 | 3300026089 | Ga0207648_10793028 | Ga0207648_107930281 | 199 |
| 389 | 3300026095 | Ga0207676_10018678 | Ga0207676_100186784 | 199 |
| 390 | 3300026095 | Ga0207676_10397318 | Ga0207676_103973182 | 199 |
| 391 | 3300026095 | Ga0207676_10560034 | Ga0207676_105600342 | 199 |
| 392 | 3300026118 | Ga0207675_100044476 | Ga0207675_1000444763 | 199 |
| 393 | 3300026118 | Ga0207675_100152755 | Ga0207675_1001527552 | 199 |
| 394 | 3300026118 | Ga0207675_100926177 | Ga0207675_1009261771 | 199 |
| 395 | 3300026121 | Ga0207683_10489057 | Ga0207683_104890572 | 199 |
| 396 | 3300026121 | Ga0207683_10633657 | Ga0207683_106336571 | 199 |
| 397 | 3300026142 | Ga0207698_10063349 | Ga0207698_100633493 | 199 |
| 398 | 3300026142 | Ga0207698_10090270 | Ga0207698_100902703 | 199 |
| 399 | 3300026142 | Ga0207698_10266650 | Ga0207698_102666502 | 199 |
| 400 | 3300027111 | Ga0209281_1000103 | Ga0209281_100010347 | 199 |
| 401 | 3300028380 | Ga0268265_10062030 | Ga0268265_100620302 | 199 |
| 402 | 3300028381 | Ga0268264_10013629 | Ga0268264_100136293 | 199 |
| 403 | 3300028381 | Ga0268264_10112004 | Ga0268264_101120043 | 199 |
| 404 | 3300031456 | Ga0307513_10065124 | Ga0307513_100651242 | 199 |
| 405 | 3300031456 | Ga0307513_10343040 | Ga0307513_103430402 | 199 |
| 406 | 3300031730 | Ga0307516_10196609 | Ga0307516_101966092 | 199 |
| 407 | 3300031852 | Ga0307410_10372995 | Ga0307410_103729952 | 199 |
| 408 | 3300031901 | Ga0307406_10772657 | Ga0307406_107726572 | 199 |
| 409 | 3300031903 | Ga0307407_10207438 | Ga0307407_102074382 | 199 |
| 410 | 3300032004 | Ga0307414_10277038 | Ga0307414_102770382 | 199 |
| 411 | 3300035089 | Ga0373944_0032880 | Ga0373944_0032880_875_1474 | 199 |
| 412 | 3300035089 | Ga0373944_0067501 | Ga0373944_0067501_439_1038 | 199 |
| 413 | 3300035116 | Ga0373945_0114625 | Ga0373945_0114625_173_784 | 199 |
| 414 | 3300035118 | Ga0373954_0080714 | Ga0373954_0080714_372_971 | 199 |
| 415 | 3300035170 | Ga0373943_0063600 | Ga0373943_0063600_496_1095 | 199 |
| 416 | 3300035171 | Ga0373946_0195126 | Ga0373946_0195126_327_926 | 199 |
| 417 | 3300035410 | Ga0373924_0157818 | Ga0373924_0157818_189_788 | 199 |
| 418 | 3300035695 | Ga0373927_0448846 | Ga0373927_0448846_118_717 | 199 |
| 419 | 3300035724 | Ga0373933_0196148 | Ga0373933_0196148_390_989 | 199 |
| 420 | 3300035725 | Ga0373947_0380754 | Ga0373947_0380754_296_895 | 199 |
| 421 | 3300037068 | Ga0373925_0124979 | Ga0373925_0124979_925_1524 | 199 |
| 422 | 3300037068 | Ga0373925_0867582 | Ga0373925_0867582_106_705 | 199 |
| 423 | 3300037471 | Ga0395905_0009245 | Ga0395905_0009245_1594_2193 | 199 |
| 424 | 3300037471 | Ga0395905_0019544 | Ga0395905_0019544_3880_4479 | 199 |
| 425 | 3300037471 | Ga0395905_0367100 | Ga0395905_0367100_373_972 | 199 |
| 426 | 3300037471 | Ga0395905_0454049 | Ga0395905_0454049_219_818 | 199 |
| 427 | 3300037471 | Ga0395905_0499223 | Ga0395905_0499223_494_1093 | 199 |
| 428 | 3300039437 | Ga0436365_0515661 | Ga0436365_0515661_58_720 | 199 |
| 429 | 3300041512 | Ga0451853_2548672 | Ga0451853_2548672_123_752 | 199 |
| 430 | 3300042008 | Ga0439450_012902 | Ga0439450_012902_921_1520 | 199 |
| 431 | 3300042016 | Ga0439463_098707 | Ga0439463_098707_141_740 | 199 |
| 432 | 3300042115 | Ga0450911_001247 | Ga0450911_001247_4944_5543 | 199 |
| 433 | 3300042133 | Ga0450896_026009 | Ga0450896_026009_12_611 | 199 |
| 434 | 3300042436 | Ga0439435_0139308 | Ga0439435_0139308_89_688 | 199 |
| 435 | 3300042461 | Ga0439460_0011243 | Ga0439460_0011243_434_1033 | 199 |
| 436 | 3300044712 | Ga0453684_0489944 | Ga0453684_0489944_540_1157 | 199 |
| 437 | 3300046457 | Ga0495590_0036502 | Ga0495590_0036502_178_777 | 199 |
| 438 | 3300046473 | Ga0495582_0166867 | Ga0495582_0166867_156_755 | 199 |
| 439 | 3300046537 | Ga0495598_0027295 | Ga0495598_0027295_716_1315 | 199 |
| 440 | 3300046537 | Ga0495598_0036180 | Ga0495598_0036180_510_1121 | 199 |
| 441 | 3300046539 | Ga0495621_0139529 | Ga0495621_0139529_72_671 | 199 |
| 442 | 3300046543 | Ga0495645_0286886 | Ga0495645_0286886_26_625 | 199 |
| 443 | 3300046681 | Ga0495647_0135825 | Ga0495647_0135825_366_965 | 199 |
| 444 | 3300046683 | Ga0495658_0050051 | Ga0495658_0050051_1001_1600 | 199 |
| 445 | 3300046691 | Ga0495670_0300473 | Ga0495670_0300473_151_750 | 199 |
| 446 | 3300046810 | Ga0495660_0046622 | Ga0495660_0046622_291_890 | 199 |
| 447 | 3300047471 | Ga0495684_0101242 | Ga0495684_0101242_1128_1727 | 199 |
| 448 | 3300047472 | Ga0495686_0094377 | Ga0495686_0094377_308_907 | 199 |
| 449 | 3300048907 | Ga0496104_0580980 | Ga0496104_0580980_266_877 | 199 |
| 450 | 3300048908 | Ga0496105_0042187 | Ga0496105_0042187_1288_1887 | 199 |
| 451 | 3300048911 | Ga0496108_0057861 | Ga0496108_0057861_638_1237 | 199 |
| 452 | 3300048912 | Ga0496109_0086496 | Ga0496109_0086496_1955_2554 | 199 |
| 453 | 3300048912 | Ga0496109_0776738 | Ga0496109_0776738_142_741 | 199 |
| 454 | 3300048913 | Ga0496110_0456924 | Ga0496110_0456924_27_626 | 199 |
| 455 | 3300048913 | Ga0496110_0816026 | Ga0496110_0816026_195_794 | 199 |
| 456 | 3300048917 | Ga0496114_0125363 | Ga0496114_0125363_1455_2054 | 199 |
| 457 | 3300048924 | Ga0496121_0021941 | Ga0496121_0021941_5502_6101 | 199 |
| 458 | 3300048927 | Ga0496124_0191264 | Ga0496124_0191264_684_1283 | 199 |
| 459 | 3300048928 | Ga0496125_0017398 | Ga0496125_0017398_328_927 | 199 |
| 460 | 3300048928 | Ga0496125_0024393 | Ga0496125_0024393_4521_5120 | 199 |
| 461 | 3300048928 | Ga0496125_0068323 | Ga0496125_0068323_34_633 | 199 |
| 462 | 3300048929 | Ga0496126_0087264 | Ga0496126_0087264_1987_2586 | 199 |
| 463 | 3300049128 | Ga0501308_042688 | Ga0501308_042688_15_614 | 199 |
| 464 | 3300049536 | Ga0501320_011426 | Ga0501320_011426_300_899 | 199 |
| 465 | 3300050493 | nmdc:mga0k408_242904_c1 | nmdc:mga0k408_242904_c1_227_826 | 199 |
| 466 | 3300050508 | nmdc:mga09592_16520_c1 | nmdc:mga09592_16520_c1_936_1535 | 199 |
| 467 | 3300050509 | nmdc:mga0qj67_21804_c1 | nmdc:mga0qj67_21804_c1_1026_1625 | 199 |
| 468 | 3300050511 | nmdc:mga08y16_629389_c1 | nmdc:mga08y16_629389_c1_279_878 | 199 |
| 469 | 3300053077 | Ga0495601_0211127 | Ga0495601_0211127_153_752 | 199 |
| 470 | 3300053085 | Ga0495619_0083709 | Ga0495619_0083709_702_1301 | 199 |
| 471 | iso_pu_bacteria | 2842747753 | 2842748899 | 199 |
| 472 | iso_pu_bacteria | 2904541872 | 2904547948 | 199 |
| 473 | iso_pu_bacteria | 2929160207 | 2929161673 | 199 |
| 474 | 3300005328 | Ga0070676_10526572 | Ga0070676_105265722 | 200 |
| 475 | 3300005331 | Ga0070670_100175075 | Ga0070670_1001750753 | 200 |
| 476 | 3300005548 | Ga0070665_100023730 | Ga0070665_1000237304 | 200 |
| 477 | 3300005616 | Ga0068852_100914048 | Ga0068852_1009140481 | 200 |
| 478 | 3300026023 | Ga0207677_10059377 | Ga0207677_100593772 | 200 |
| 479 | 3300026078 | Ga0207702_10652496 | Ga0207702_106524962 | 200 |
| 480 | 3300026116 | Ga0207674_10337827 | Ga0207674_103378272 | 200 |
| 481 | 3300028786 | Ga0307517_10003685 | Ga0307517_100036858 | 200 |
| 482 | 3300031507 | Ga0307509_10407590 | Ga0307509_104075902 | 200 |
| 483 | 3300031730 | Ga0307516_10002915 | Ga0307516_1000291510 | 200 |
| 484 | 3300033180 | Ga0307510_10003212 | Ga0307510_1000321223 | 200 |
| 485 | 3300041459 | Ga0451800_1666127 | Ga0451800_1666127_255_857 | 200 |
| 486 | 3300041460 | Ga0451802_1504526 | Ga0451802_1504526_499_1101 | 200 |
| 487 | 3300046514 | Ga0495618_0501969 | Ga0495618_0501969_24_629 | 200 |
| 488 | 3300005337 | Ga0070682_100332138 | Ga0070682_1003321381 | 201 |
| 489 | 3300046453 | Ga0495627_000004 | Ga0495627_000004_561986_562591 | 201 |
| 490 | 3300046530 | Ga0495654_0089042 | Ga0495654_0089042_224_829 | 201 |
| 491 | 3300046538 | Ga0495609_0006051 | Ga0495609_0006051_2338_2943 | 201 |
| 492 | 3300046810 | Ga0495660_0005482 | Ga0495660_0005482_4743_5348 | 201 |
| 493 | 3300048927 | Ga0496124_0249867 | Ga0496124_0249867_536_1141 | 201 |
| 494 | 3300049459 | Ga0495678_000149 | Ga0495678_000149_6876_7481 | 201 |
| 495 | 3300002705 | JGI25156J39149_1001185 | JGI25156J39149_100118514 | 202 |
| 496 | 3300003751 | Ga0055538_1000038 | Ga0055538_1000038133 | 202 |
| 497 | 3300003752 | Ga0055539_1000049 | Ga0055539_1000049133 | 202 |
| 498 | 3300003756 | Ga0055533_1000060 | Ga0055533_1000060133 | 202 |
| 499 | 3300003759 | Ga0055525_1000068 | Ga0055525_100006862 | 202 |
| 500 | 3300003841 | Ga0055541_1000036 | Ga0055541_100003662 | 202 |
| 501 | 3300005563 | Ga0068855_100004108 | Ga0068855_10000410811 | 202 |
| 502 | 3300006946 | Ga0079104_1006956 | Ga0079104_10069563 | 202 |
| 503 | 3300006946 | Ga0079104_1007690 | Ga0079104_10076902 | 202 |
| 504 | 3300009093 | Ga0105240_10360767 | Ga0105240_103607671 | 202 |
| 505 | 3300009093 | Ga0105240_10475490 | Ga0105240_104754902 | 202 |
| 506 | 3300009545 | Ga0105237_10273494 | Ga0105237_102734942 | 202 |
| 507 | 3300009545 | Ga0105237_10314487 | Ga0105237_103144872 | 202 |
| 508 | 3300014969 | Ga0157376_10147904 | Ga0157376_101479042 | 202 |
| 509 | 3300015261 | Ga0182006_1000102 | Ga0182006_100010213 | 202 |
| 510 | 3300015265 | Ga0182005_1000006 | Ga0182005_1000006380 | 202 |
| 511 | 3300017792 | Ga0163161_10060133 | Ga0163161_100601332 | 202 |
| 512 | 3300021361 | Ga0213872_10002128 | Ga0213872_100021287 | 202 |
| 513 | 3300025728 | Ga0207655_1002585 | Ga0207655_10025857 | 202 |
| 514 | 3300025913 | Ga0207695_10014674 | Ga0207695_1001467412 | 202 |
| 515 | 3300025949 | Ga0207667_10000043 | Ga0207667_100000435 | 202 |
| 516 | 3300027111 | Ga0209281_1003429 | Ga0209281_10034296 | 202 |
| 517 | 3300027111 | Ga0209281_1005531 | Ga0209281_10055312 | 202 |
| 518 | 3300030744 | Ga0316181_1248234 | Ga0316181_12482342 | 202 |
| 519 | 3300037418 | Ga0395900_0592541 | Ga0395900_0592541_277_909 | 202 |
| 520 | 3300037466 | Ga0395898_0100918 | Ga0395898_0100918_112_720 | 202 |
| 521 | 3300042156 | Ga0439446_0103067 | Ga0439446_0103067_187_798 | 202 |
| 522 | 3300046452 | Ga0495617_000128 | Ga0495617_000128_42298_42906 | 202 |
| 523 | 3300046453 | Ga0495627_064516 | Ga0495627_064516_19_627 | 202 |
| 524 | 3300046463 | Ga0495653_0000056 | Ga0495653_0000056_91495_92103 | 202 |
| 525 | 3300046471 | Ga0495650_0008661 | Ga0495650_0008661_319_927 | 202 |
| 526 | 3300046492 | Ga0495585_0051090 | Ga0495585_0051090_1194_1802 | 202 |
| 527 | 3300046501 | Ga0495607_0007679 | Ga0495607_0007679_197_805 | 202 |
| 528 | 3300046507 | Ga0495606_0000400 | Ga0495606_0000400_66470_67078 | 202 |
| 529 | 3300046507 | Ga0495606_0000589 | Ga0495606_0000589_45009_45617 | 202 |
| 530 | 3300046512 | Ga0495610_0000027 | Ga0495610_0000027_186944_187552 | 202 |
| 531 | 3300046512 | Ga0495610_0044528 | Ga0495610_0044528_411_1019 | 202 |
| 532 | 3300046524 | Ga0495648_0130404 | Ga0495648_0130404_43_651 | 202 |
| 533 | 3300046528 | Ga0495642_0026987 | Ga0495642_0026987_1483_2091 | 202 |
| 534 | 3300046530 | Ga0495654_0023598 | Ga0495654_0023598_893_1501 | 202 |
| 535 | 3300046537 | Ga0495598_0094554 | Ga0495598_0094554_260_868 | 202 |
| 536 | 3300046542 | Ga0495597_0050595 | Ga0495597_0050595_47_655 | 202 |
| 537 | 3300046558 | Ga0495633_0149228 | Ga0495633_0149228_408_1016 | 202 |
| 538 | 3300046616 | Ga0495668_0004543 | Ga0495668_0004543_185_793 | 202 |
| 539 | 3300046660 | Ga0495625_0036581 | Ga0495625_0036581_205_813 | 202 |
| 540 | 3300046660 | Ga0495625_0094169 | Ga0495625_0094169_186_794 | 202 |
| 541 | 3300046665 | Ga0495661_0085594 | Ga0495661_0085594_442_1050 | 202 |
| 542 | 3300046692 | Ga0495671_0001731 | Ga0495671_0001731_8742_9350 | 202 |
| 543 | 3300046810 | Ga0495660_0044458 | Ga0495660_0044458_1366_1974 | 202 |
| 544 | 3300047323 | Ga0495683_0143448 | Ga0495683_0143448_286_990 | 202 |
| 545 | 3300047446 | Ga0495679_009980 | Ga0495679_009980_2650_3258 | 202 |
| 546 | 3300047469 | Ga0495673_0000009 | Ga0495673_0000009_87813_88421 | 202 |
| 547 | 3300047469 | Ga0495673_0000185 | Ga0495673_0000185_94812_95420 | 202 |
| 548 | 3300048906 | Ga0496103_0005520 | Ga0496103_0005520_4223_4831 | 202 |
| 549 | 3300048906 | Ga0496103_0017788 | Ga0496103_0017788_2421_3029 | 202 |
| 550 | 3300048908 | Ga0496105_0295884 | Ga0496105_0295884_449_1057 | 202 |
| 551 | 3300048909 | Ga0496106_0235042 | Ga0496106_0235042_438_1046 | 202 |
| 552 | 3300048910 | Ga0496107_0075669 | Ga0496107_0075669_1606_2214 | 202 |
| 553 | 3300048911 | Ga0496108_0016861 | Ga0496108_0016861_2958_3566 | 202 |
| 554 | 3300048912 | Ga0496109_0119507 | Ga0496109_0119507_571_1179 | 202 |
| 555 | 3300048913 | Ga0496110_0053981 | Ga0496110_0053981_2672_3280 | 202 |
| 556 | 3300048914 | Ga0496111_0315368 | Ga0496111_0315368_450_1058 | 202 |
| 557 | 3300048917 | Ga0496114_0019796 | Ga0496114_0019796_183_791 | 202 |
| 558 | 3300048924 | Ga0496121_0096110 | Ga0496121_0096110_174_782 | 202 |
| 559 | 3300048924 | Ga0496121_0290383 | Ga0496121_0290383_335_943 | 202 |
| 560 | 3300048925 | Ga0496122_0110331 | Ga0496122_0110331_269_877 | 202 |
| 561 | 3300048926 | Ga0496123_0023826 | Ga0496123_0023826_3006_3614 | 202 |
| 562 | 3300048927 | Ga0496124_0521464 | Ga0496124_0521464_138_746 | 202 |
| 563 | 3300048929 | Ga0496126_0003538 | Ga0496126_0003538_1302_1910 | 202 |
| 564 | 3300049679 | Ga0501249_002886 | Ga0501249_002886_1065_1673 | 202 |
| 565 | 3300049766 | Ga0501269_000242 | Ga0501269_000242_4965_5573 | 202 |
| 566 | 3300053125 | Ga0500618_014077 | Ga0500618_014077_360_968 | 202 |
| 567 | 3300053145 | Ga0500586_000137 | Ga0500586_000137_9898_10506 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yra-assembly1.cif.gz_B | crystal structure of [2fe-2s]-ttpeta | 0.9643 | 50 | 198 |
| 7yra-assembly1.cif.gz_B | crystal structure of [2fe-2s]-ttpeta | 0.9514 | 50 | 198 |
| 8smr-assembly1.cif.gz_C | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.9 | 33 | 197 |
| 6fo2-assembly1.cif.gz_R | cryoem structure of bovine cytochrome bc1 with no ligand bound | 0.8834 | 67 | 195 |
| 6fo2-assembly1.cif.gz_E | cryoem structure of bovine cytochrome bc1 with no ligand bound | 0.8834 | 67 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l71E02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8279 | 49 | 195 | 2.102.10.10 |
| 1l0nE02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.801 | 50 | 195 | 2.102.10.10 |
| 2yiuC02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.7986 | 46 | 195 | 2.102.10.10 |
| af_Q4DS82_165_295_2.102.10.10 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.7891 | 49 | 195 | 2.102.10.10 |
| 3l71E02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.7749 | 49 | 195 | 2.102.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0BYK6-F1-model_v4 | Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) | 0.9808 | 50 | 200 |
GO:0008121
GO:0016020 GO:0046872 GO:0051537 |
| AF-A0A4R3V318-F1-model_v4 | deleted | 0.9765 | 62 | 202 |
|
| AF-H0BYK6-F1-model_v4 | Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) | 0.9744 | 50 | 200 |
GO:0008121
GO:0016020 GO:0046872 GO:0051537 |
| AF-A0A4R3V318-F1-model_v4 | deleted | 0.9697 | 62 | 202 |
|
| AF-A0A536Y491-F1-model_v4 | Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) | 0.9696 | 47 | 199 |
GO:0008121
GO:0016020 GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar