F464506

General Info

Members Datasets Scaffolds Average Seq Length
567 340 531 198

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11168625|Ga0114129_111686252
Length 229
Sequence MRERARRFEVGEHDPLQLRVDPQQREILEDPMSNSTVDASKRTWLIASSCAGAVGAGFVAVPFVSSFQPSERAKAAGAPVEVDISALQPGQKMTVEWRGKPVWILKRTPEQIASIKKTDSQVADPNSERKAYPIPEYAKNETRSIKPDVLVVVGICSHLGCSPTDKLVPGPQPSLPDDWQGGFLCPCHGSTFDLAGRVYRNKPAPDNLEVPPHMYLSDTRLVIGEDKKA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2643221596 Acidovorax sp. Root70 Isolate Unclassified
6 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2643221717 Acidovorax sp. Root267 Isolate Unclassified
9 2738541280 Massilia sp. GV090 Isolate Unclassified
10 2738541297 Duganella sp. GV083 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543026 Duganella sp. GV089 Isolate Unclassified
14 2738543029 Duganella sp. GV039 Isolate Unclassified
15 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
16 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
17 2821131069 Duganella sp. 1224 Isolate Unclassified
18 2842711865 Duganella sp. R-73148 Isolate Unclassified
19 2842747753 Variovorax sp. R-72060 Isolate Unclassified
20 2857553236 Duganella sp. R-74557 Isolate Unclassified
21 2857558681 Duganella sp. R-74565 Isolate Unclassified
22 2857564685 Duganella sp. R-74599 Isolate Unclassified
23 2904424332 Duganella sp. 1411 Isolate Rhizosphere
24 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
25 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
26 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
27 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
28 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
29 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
30 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
31 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
32 2919476304 Duganella sp. 3397 Isolate Unclassified
33 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
34 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
35 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
36 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
37 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
204 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
234 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
235 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
236 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
243 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
244 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
245 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
246 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
247 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
248 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
254 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
261 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
276 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
279 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
293 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
318 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
325 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
326 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
338 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
339 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.06
Metatranscriptomes 1.59
Isolates 6.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 1.06
Rhizoplane 4.23
Rhizosphere 77.07
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001185 3300002705 Bacteria 11600
2 JGI25151J46595_10000864 3300003187 Bacteria 24005
3 Ga0055538_1000038 3300003751 Bacteria 186588
4 Ga0055539_1000049 3300003752 Bacteria 186588
5 Ga0055533_1000060 3300003756 Bacteria 186588
6 Ga0055525_1000068 3300003759 Bacteria 186588
7 Ga0055524_1000013 3300003775 Bacteria 259850
8 Ga0055530_10015172 3300003791 Bacteria 2532
9 Ga0055540_1000001 3300003792 Bacteria 466834
10 Ga0055540_1011442 3300003792 Bacteria 2859
11 Ga0055531_10000257 3300003794 Bacteria 56547
12 Ga0055531_10010669 3300003794 Bacteria 4535
13 Ga0055541_1000036 3300003841 Bacteria 186588
14 Ga0065715_10124382 3300005293 Bacteria 2155
15 Ga0070658_10190477 3300005327 Bacteria 1728
16 Ga0070658_10261294 3300005327 Bacteria 1470
17 Ga0070658_10352166 3300005327 Bacteria 1260
18 Ga0070676_10019669 3300005328 Bacteria 3761
19 Ga0070676_10526572 3300005328 Bacteria 843
20 Ga0070676_10640135 3300005328 Bacteria 771
21 Ga0070683_100302591 3300005329 Bacteria 1521
22 Ga0070690_100027294 3300005330 Bacteria 3529
23 Ga0070670_100001787 3300005331 Bacteria 17505
24 Ga0070670_100056429 3300005331 Bacteria 3370
25 Ga0070670_100082233 3300005331 Bacteria 2767
26 Ga0070670_100175075 3300005331 Bacteria 1862
27 Ga0070670_100225003 3300005331 Bacteria 1632
28 Ga0070670_100511435 3300005331 Bacteria 1069
29 Ga0070670_100575144 3300005331 Bacteria 1006
30 Ga0070677_10012687 3300005333 Bacteria 2929
31 Ga0070677_10019872 3300005333 Bacteria 2439
32 Ga0070677_10037630 3300005333 Bacteria 1888
33 Ga0070666_10005194 3300005335 Bacteria 7975
34 Ga0070682_100332138 3300005337 Bacteria 1127
35 Ga0070682_100414925 3300005337 Bacteria 1022
36 Ga0068868_100000966 3300005338 Bacteria 19576
37 Ga0068868_100060218 3300005338 Bacteria 3005
38 Ga0068868_100251567 3300005338 Bacteria 1487
39 Ga0068868_100332809 3300005338 Bacteria 1296
40 Ga0070689_100033031 3300005340 Bacteria 3940
41 Ga0070687_100021471 3300005343 Bacteria 3035
42 Ga0070661_100007516 3300005344 Bacteria 7517
43 Ga0070661_100325800 3300005344 Bacteria 1201
44 Ga0070661_100643032 3300005344 Bacteria 860
45 Ga0070668_100101677 3300005347 Bacteria 2278
46 Ga0070668_100130279 3300005347 Bacteria 2018
47 Ga0070668_100382209 3300005347 Bacteria 1198
48 Ga0070668_100893251 3300005347 Bacteria 794
49 Ga0070669_100101679 3300005353 Bacteria 2169
50 Ga0070669_100271417 3300005353 Bacteria 1356
51 Ga0070675_100007798 3300005354 Bacteria 8291
52 Ga0070675_100059035 3300005354 Bacteria 3164
53 Ga0070675_100071831 3300005354 Bacteria 2872
54 Ga0070675_100296186 3300005354 Bacteria 1424
55 Ga0070671_100003392 3300005355 Bacteria 12430
56 Ga0070671_100080633 3300005355 Bacteria 2721
57 Ga0070674_100101588 3300005356 Bacteria 2096
58 Ga0070674_100270579 3300005356 Bacteria 1342
59 Ga0070674_100923742 3300005356 Bacteria 761
60 Ga0070673_100040581 3300005364 Bacteria 3571
61 Ga0070673_100140074 3300005364 Bacteria 2039
62 Ga0070673_100143620 3300005364 Bacteria 2015
63 Ga0070673_100408454 3300005364 Bacteria 1215
64 Ga0070673_100824476 3300005364 Bacteria 857
65 Ga0070659_100246959 3300005366 Bacteria 1478
66 Ga0070659_100520511 3300005366 Bacteria 1015
67 Ga0070667_100031351 3300005367 Bacteria 4433
68 Ga0070667_100064801 3300005367 Bacteria 3101
69 Ga0070667_100227943 3300005367 Bacteria 1660
70 Ga0070701_10322081 3300005438 Bacteria 957
71 Ga0070700_100272002 3300005441 Bacteria 1224
72 Ga0070678_100005704 3300005456 Bacteria 7232
73 Ga0070678_100012914 3300005456 Bacteria 5214
74 Ga0070678_100085907 3300005456 Bacteria 2398
75 Ga0070678_100099794 3300005456 Bacteria 2247
76 Ga0070678_100185099 3300005456 Bacteria 1708
77 Ga0070678_100243614 3300005456 Bacteria 1504
78 Ga0070678_100498987 3300005456 Bacteria 1073
79 Ga0070662_100177439 3300005457 Bacteria 1677
80 Ga0070662_100476676 3300005457 Bacteria 1038
81 Ga0070681_10533713 3300005458 Bacteria 1087
82 Ga0068867_100066600 3300005459 Bacteria 2683
83 Ga0070672_100008932 3300005543 Bacteria 6886
84 Ga0070672_100118022 3300005543 Bacteria 2169
85 Ga0070672_100312456 3300005543 Bacteria 1334
86 Ga0070672_100472174 3300005543 Bacteria 1082
87 Ga0070672_100480844 3300005543 Bacteria 1072
88 Ga0070686_100290146 3300005544 Bacteria 1210
89 Ga0070665_100023730 3300005548 Bacteria 6178
90 Ga0068855_100004108 3300005563 Bacteria 17755
91 Ga0068855_100408641 3300005563 Bacteria 1487
92 Ga0070664_100116201 3300005564 Bacteria 2339
93 Ga0070664_100220335 3300005564 Bacteria 1697
94 Ga0070664_100298845 3300005564 Bacteria 1454
95 Ga0068856_100007776 3300005614 Bacteria 10473
96 Ga0068856_100362132 3300005614 Bacteria 1469
97 Ga0070702_100192744 3300005615 Bacteria 1342
98 Ga0068852_100060003 3300005616 Bacteria 3301
99 Ga0068852_100107340 3300005616 Bacteria 2532
100 Ga0068852_100119867 3300005616 Bacteria 2406
101 Ga0068852_100311429 3300005616 Bacteria 1526
102 Ga0068852_100345451 3300005616 Bacteria 1451
103 Ga0068852_100663935 3300005616 Bacteria 1051
104 Ga0068852_100914048 3300005616 Bacteria 895
105 Ga0068859_100023273 3300005617 Bacteria 6217
106 Ga0068859_100138540 3300005617 Bacteria 2507
107 Ga0068864_100002065 3300005618 Bacteria 16597
108 Ga0068864_100034125 3300005618 Bacteria 4326
109 Ga0068864_100117385 3300005618 Bacteria 2375
110 Ga0068864_100208549 3300005618 Bacteria 1798
111 Ga0068866_10055652 3300005718 Bacteria 2032
112 Ga0068866_10067821 3300005718 Bacteria 1874
113 Ga0068861_100043238 3300005719 Bacteria 3380
114 Ga0068861_100422040 3300005719 Bacteria 1189
115 Ga0068861_100754073 3300005719 Bacteria 909
116 Ga0068851_10031414 3300005834 Bacteria 2637
117 Ga0068851_10084706 3300005834 Bacteria 1660
118 Ga0068851_10092912 3300005834 Bacteria 1590
119 Ga0068851_10165438 3300005834 Bacteria 1217
120 Ga0068870_10143448 3300005840 Bacteria 1399
121 Ga0068863_100019244 3300005841 Bacteria 6532
122 Ga0068863_100058378 3300005841 Bacteria 3651
123 Ga0068863_100135245 3300005841 Bacteria 2355
124 Ga0068863_100396977 3300005841 Bacteria 1348
125 Ga0068858_100008614 3300005842 Bacteria 9799
126 Ga0068858_100150332 3300005842 Bacteria 2189
127 Ga0068858_100610245 3300005842 Bacteria 1059
128 Ga0068860_100007016 3300005843 Bacteria 11281
129 Ga0068860_100151850 3300005843 Bacteria 2231
130 Ga0068862_100041306 3300005844 Bacteria 3923
131 Ga0068862_100097384 3300005844 Bacteria 2568
132 Ga0070717_10009296 3300006028 Bacteria 7386
133 Ga0075365_10004820 3300006038 Bacteria 7197
134 Ga0075365_10051467 3300006038 Bacteria 2720
135 Ga0075365_10093861 3300006038 Bacteria 2047
136 Ga0075365_10474755 3300006038 Bacteria 884
137 Ga0075368_10086394 3300006042 Bacteria 1280
138 Ga0075363_100256117 3300006048 Bacteria 1009
139 Ga0075367_10161645 3300006178 Bacteria 1393
140 Ga0075367_10249889 3300006178 Bacteria 1112
141 Ga0075366_10085626 3300006195 Bacteria 1885
142 Ga0075366_10276794 3300006195 Bacteria 1025
143 Ga0097621_100030577 3300006237 Bacteria 4264
144 Ga0097621_100082351 3300006237 Bacteria 2679
145 Ga0075370_10237519 3300006353 Bacteria 1079
146 Ga0068871_100039576 3300006358 Bacteria 3773
147 Ga0068871_100306424 3300006358 Bacteria 1395
148 Ga0075428_101073449 3300006844 Bacteria 851
149 Ga0075430_100133848 3300006846 Bacteria 2066
150 Ga0075429_100048258 3300006880 Bacteria 3703
151 Ga0075429_100396307 3300006880 Bacteria 1209
152 Ga0068865_100543685 3300006881 Bacteria 974
153 Ga0097620_100023272 3300006931 Bacteria 6217
154 Ga0097620_100138542 3300006931 Bacteria 2507
155 Ga0079104_1000070 3300006946 Bacteria 153879
156 Ga0079104_1006956 3300006946 Bacteria 4176
157 Ga0079104_1007690 3300006946 Bacteria 3863
158 Ga0105240_10360767 3300009093 Bacteria 1646
159 Ga0105240_10475490 3300009093 Bacteria 1394
160 Ga0105245_10268171 3300009098 Bacteria 1664
161 Ga0105245_10766541 3300009098 Bacteria 1001
162 Ga0114129_11168625 3300009147 Bacteria 960
163 Ga0105243_10096253 3300009148 Bacteria 2449
164 Ga0105248_10051344 3300009177 Bacteria 4627
165 Ga0105248_10200227 3300009177 Bacteria 2250
166 Ga0105248_10276432 3300009177 Bacteria 1891
167 Ga0105237_10273494 3300009545 Bacteria 1692
168 Ga0105237_10314487 3300009545 Bacteria 1569
169 Ga0105238_10000037 3300009551 Bacteria 163954
170 Ga0105238_10005477 3300009551 Bacteria 12552
171 Ga0105249_10106513 3300009553 Bacteria 2645
172 Ga0105239_10003694 3300010375 Bacteria 18647
173 Ga0157373_10133902 3300013100 Bacteria 1742
174 Ga0157371_10063837 3300013102 Bacteria 2610
175 Ga0157371_10131978 3300013102 Bacteria 1777
176 Ga0157369_10653134 3300013105 Bacteria 1084
177 Ga0157374_10091075 3300013296 Bacteria 2908
178 Ga0157378_10700956 3300013297 Bacteria 1032
179 Ga0157372_10269502 3300013307 Bacteria 1978
180 Ga0157372_10598551 3300013307 Bacteria 1285
181 Ga0157375_10134369 3300013308 Bacteria 2596
182 Ga0157375_10260281 3300013308 Bacteria 1896
183 Ga0157375_10750916 3300013308 Bacteria 1127
184 Ga0163163_10035273 3300014325 Bacteria 4852
185 Ga0163163_10102638 3300014325 Bacteria 2884
186 Ga0157380_10185851 3300014326 Bacteria 1830
187 Ga0157380_10325853 3300014326 Bacteria 1426
188 Ga0157380_10526215 3300014326 Bacteria 1154
189 Ga0157379_10055008 3300014968 Bacteria 3556
190 Ga0157379_10098500 3300014968 Bacteria 2625
191 Ga0157376_10042949 3300014969 Bacteria 3708
192 Ga0157376_10147904 3300014969 Bacteria 2115
193 Ga0157376_10403153 3300014969 Bacteria 1323
194 Ga0182006_1000102 3300015261 Bacteria 94384
195 Ga0182005_1000006 3300015265 Bacteria 515188
196 Ga0163161_10013100 3300017792 Bacteria 5764
197 Ga0163161_10060133 3300017792 Bacteria 2765
198 Ga0163161_10177820 3300017792 Bacteria 1630
199 Ga0163161_10296468 3300017792 Bacteria 1272
200 Ga0213872_10002128 3300021361 Bacteria 11902
201 Ga0209784_100021 3300025224 Bacteria 408534
202 Ga0209566_100039 3300025225 Bacteria 303368
203 Ga0209674_100036 3300025226 Bacteria 408534
204 Ga0209563_100040 3300025230 Bacteria 408534
205 Ga0209677_100023 3300025253 Bacteria 408534
206 Ga0209565_1004707 3300025263 Bacteria 4099
207 Ga0207666_1002451 3300025271 Bacteria 2238
208 Ga0209673_1005215 3300025273 Bacteria 6625
209 Ga0209675_1009287 3300025291 Bacteria 3489
210 Ga0209050_1000730 3300025298 Bacteria 47896
211 Ga0209050_1023274 3300025298 Bacteria 2186
212 Ga0209256_1000061 3300025299 Bacteria 260890
213 Ga0209051_1000018 3300025303 Bacteria 527061
214 Ga0209051_1000025 3300025303 Bacteria 415397
215 Ga0209257_1000039 3300025304 Bacteria 591694
216 Ga0209257_1000461 3300025304 Bacteria 75360
217 Ga0207656_10080050 3300025321 Bacteria 1467
218 Ga0207655_1002585 3300025728 Bacteria 14437
219 Ga0207682_10029330 3300025893 Bacteria 2200
220 Ga0207642_10007097 3300025899 Bacteria 3764
221 Ga0207688_10033176 3300025901 Bacteria 2854
222 Ga0207680_10002711 3300025903 Bacteria 8272
223 Ga0207680_10045424 3300025903 Bacteria 2590
224 Ga0207685_10139029 3300025905 Bacteria 1087
225 Ga0207645_10067098 3300025907 Bacteria 2293
226 Ga0207645_10590918 3300025907 Bacteria 754
227 Ga0207705_10045619 3300025909 Bacteria 3149
228 Ga0207705_10172892 3300025909 Bacteria 1627
229 Ga0207695_10014674 3300025913 Bacteria 9264
230 Ga0207662_10005846 3300025918 Bacteria 6595
231 Ga0207657_10164635 3300025919 Bacteria 1799
232 Ga0207649_10014780 3300025920 Bacteria 4378
233 Ga0207649_10218481 3300025920 Bacteria 1356
234 Ga0207681_10119486 3300025923 Bacteria 1930
235 Ga0207681_10289422 3300025923 Bacteria 1292
236 Ga0207681_10355075 3300025923 Bacteria 1174
237 Ga0207694_10029099 3300025924 Bacteria 4213
238 Ga0207650_10010685 3300025925 Bacteria 6307
239 Ga0207650_10022106 3300025925 Bacteria 4501
240 Ga0207650_10118137 3300025925 Bacteria 2061
241 Ga0207650_10483410 3300025925 Bacteria 1033
242 Ga0207659_10002170 3300025926 Bacteria 11657
243 Ga0207659_10039901 3300025926 Bacteria 3278
244 Ga0207659_10100788 3300025926 Bacteria 2176
245 Ga0207659_10679410 3300025926 Bacteria 881
246 Ga0207644_10002319 3300025931 Bacteria 12312
247 Ga0207644_10178867 3300025931 Bacteria 1661
248 Ga0207644_10200133 3300025931 Bacteria 1575
249 Ga0207644_10900493 3300025931 Bacteria 741
250 Ga0207706_10442293 3300025933 Bacteria 1125
251 Ga0207686_10062692 3300025934 Bacteria 2362
252 Ga0207686_10471043 3300025934 Bacteria 970
253 Ga0207670_10033210 3300025936 Bacteria 3324
254 Ga0207704_10037758 3300025938 Bacteria 2793
255 Ga0207704_10518695 3300025938 Bacteria 963
256 Ga0207665_10604735 3300025939 Bacteria 856
257 Ga0207691_10004404 3300025940 Bacteria 13651
258 Ga0207691_10078833 3300025940 Bacteria 2965
259 Ga0207691_10152235 3300025940 Bacteria 2033
260 Ga0207691_10440089 3300025940 Bacteria 1110
261 Ga0207691_10449364 3300025940 Bacteria 1097
262 Ga0207691_10745921 3300025940 Bacteria 824
263 Ga0207711_10019236 3300025941 Bacteria 5686
264 Ga0207711_10117888 3300025941 Bacteria 2368
265 Ga0207689_10030687 3300025942 Bacteria 4479
266 Ga0207679_10062453 3300025945 Bacteria 2776
267 Ga0207679_11014652 3300025945 Bacteria 761
268 Ga0207667_10000043 3300025949 Bacteria 261426
269 Ga0207651_10009154 3300025960 Bacteria 5396
270 Ga0207651_10059158 3300025960 Bacteria 2652
271 Ga0207651_10174777 3300025960 Bacteria 1697
272 Ga0207651_10489629 3300025960 Bacteria 1061
273 Ga0207712_10029229 3300025961 Bacteria 3695
274 Ga0207712_10726267 3300025961 Bacteria 869
275 Ga0207668_10124497 3300025972 Bacteria 1957
276 Ga0207668_10188242 3300025972 Bacteria 1633
277 Ga0207668_10472824 3300025972 Bacteria 1074
278 Ga0207668_11209192 3300025972 Bacteria 679
279 Ga0207640_10216146 3300025981 Bacteria 1464
280 Ga0207640_10828040 3300025981 Bacteria 804
281 Ga0207658_10004072 3300025986 Bacteria 10205
282 Ga0207658_10138894 3300025986 Bacteria 1963
283 Ga0207677_10001522 3300026023 Bacteria 12255
284 Ga0207677_10059377 3300026023 Bacteria 2638
285 Ga0207677_10739198 3300026023 Bacteria 876
286 Ga0207677_10800620 3300026023 Bacteria 844
287 Ga0207703_10006064 3300026035 Bacteria 9665
288 Ga0207703_10025831 3300026035 Bacteria 4622
289 Ga0207703_10435705 3300026035 Bacteria 1222
290 Ga0207639_10409656 3300026041 Bacteria 1223
291 Ga0207639_10699521 3300026041 Bacteria 940
292 Ga0207708_10060894 3300026075 Bacteria 2882
293 Ga0207708_10307812 3300026075 Bacteria 1290
294 Ga0207702_10004429 3300026078 Bacteria 12481
295 Ga0207702_10652496 3300026078 Bacteria 1035
296 Ga0207641_10019502 3300026088 Bacteria 5567
297 Ga0207641_10034241 3300026088 Bacteria 4224
298 Ga0207641_10314816 3300026088 Bacteria 1482
299 Ga0207648_10147355 3300026089 Bacteria 2076
300 Ga0207648_10793028 3300026089 Bacteria 881
301 Ga0207676_10002741 3300026095 Bacteria 12542
302 Ga0207676_10018678 3300026095 Bacteria 5045
303 Ga0207676_10397318 3300026095 Bacteria 1287
304 Ga0207676_10560034 3300026095 Bacteria 1093
305 Ga0207674_10337827 3300026116 Bacteria 1456
306 Ga0207675_100044476 3300026118 Bacteria 4150
307 Ga0207675_100152755 3300026118 Bacteria 2198
308 Ga0207675_100926177 3300026118 Bacteria 888
309 Ga0207683_10484206 3300026121 Bacteria 1142
310 Ga0207683_10489057 3300026121 Bacteria 1136
311 Ga0207683_10633657 3300026121 Bacteria 990
312 Ga0207698_10063349 3300026142 Bacteria 2893
313 Ga0207698_10090270 3300026142 Bacteria 2505
314 Ga0207698_10266650 3300026142 Bacteria 1576
315 Ga0207698_10987811 3300026142 Bacteria 852
316 Ga0209281_1000103 3300027111 Bacteria 221425
317 Ga0209281_1003429 3300027111 Bacteria 5248
318 Ga0209281_1005531 3300027111 Bacteria 3492
319 Ga0209813_10021609 3300027866 Bacteria 1811
320 Ga0268265_10062030 3300028380 Bacteria 2871
321 Ga0268264_10013629 3300028381 Bacteria 6691
322 Ga0268264_10112004 3300028381 Bacteria 2392
323 Ga0307517_10003685 3300028786 Bacteria 23834
324 Ga0307515_10001484 3300028794 Bacteria 52674
325 Ga0316181_1248234 3300030744 Bacteria 1442
326 Ga0265328_10040645 3300031239 Bacteria 1713
327 Ga0265331_10001643 3300031250 Bacteria 16261
328 Ga0265327_10000012 3300031251 Bacteria 530403
329 Ga0265327_10038138 3300031251 Bacteria 2625
330 Ga0307513_10065124 3300031456 Bacteria 3835
331 Ga0307513_10343040 3300031456 Bacteria 1244
332 Ga0307509_10407590 3300031507 Bacteria 1064
333 Ga0307514_10000355 3300031649 Bacteria 106758
334 Ga0316575_10037334 3300031665 Bacteria 1914
335 Ga0316576_10163425 3300031727 Bacteria 1679
336 Ga0307516_10002915 3300031730 Bacteria 22407
337 Ga0307516_10080487 3300031730 Bacteria 3101
338 Ga0307516_10196609 3300031730 Bacteria 1739
339 Ga0307410_10372995 3300031852 Bacteria 1146
340 Ga0307406_10772657 3300031901 Bacteria 808
341 Ga0307407_10207438 3300031903 Bacteria 1317
342 Ga0307412_11053087 3300031911 Bacteria 721
343 Ga0307414_10277038 3300032004 Bacteria 1408
344 Ga0307510_10003212 3300033180 Bacteria 19002
345 Ga0316596_1053168 3300033541 Bacteria 1074
346 Ga0373934_0143239 3300035086 Bacteria 978
347 Ga0373944_0032880 3300035089 Bacteria 1569
348 Ga0373944_0067501 3300035089 Bacteria 1159
349 Ga0373945_0114625 3300035116 Bacteria 1066
350 Ga0373954_0080714 3300035118 Bacteria 1554
351 Ga0373943_0063600 3300035170 Bacteria 1850
352 Ga0373946_0195126 3300035171 Bacteria 967
353 Ga0316574_0044253 3300035398 Bacteria 2754
354 Ga0373924_0157818 3300035410 Bacteria 994
355 Ga0373931_0096810 3300035691 Bacteria 1654
356 Ga0373927_0448846 3300035695 Bacteria 852
357 Ga0373933_0196148 3300035724 Bacteria 1291
358 Ga0373947_0380754 3300035725 Bacteria 950
359 Ga0373925_0124979 3300037068 Bacteria 2000
360 Ga0373925_0867582 3300037068 Bacteria 744
361 Ga0395899_0008661 3300037312 Bacteria 7828
362 Ga0395900_0047478 3300037418 Bacteria 4421
363 Ga0395900_0592541 3300037418 Bacteria 1050
364 Ga0395898_0018204 3300037466 Bacteria 7165
365 Ga0395898_0100918 3300037466 Bacteria 2772
366 Ga0395905_0009245 3300037471 Bacteria 9647
367 Ga0395905_0019544 3300037471 Bacteria 6420
368 Ga0395905_0367100 3300037471 Bacteria 1332
369 Ga0395905_0454049 3300037471 Bacteria 1179
370 Ga0395905_0499223 3300037471 Bacteria 1117
371 Ga0436365_0515661 3300039437 Bacteria 1111
372 Ga0436361_0266216 3300039447 Bacteria 5390
373 Ga0436361_0548576 3300039447 Bacteria 1380
374 Ga0436361_0704696 3300039447 Bacteria 13555
375 Ga0439439_0080551 3300041406 Bacteria 880
376 Ga0439453_0068146 3300041408 Bacteria 748
377 Ga0451800_1666127 3300041459 Bacteria 1020
378 Ga0451802_1504526 3300041460 Bacteria 1117
379 Ga0451839_0444511 3300041496 Bacteria 1086
380 Ga0451853_2548672 3300041512 Bacteria 1051
381 Ga0439449_0001504 3300042007 Bacteria 9128
382 Ga0439450_012902 3300042008 Bacteria 1668
383 Ga0439457_029445 3300042014 Bacteria 1217
384 Ga0439462_0023380 3300042015 Bacteria 1620
385 Ga0439463_098707 3300042016 Bacteria 753
386 Ga0450911_001247 3300042115 Bacteria 6107
387 Ga0450912_004814 3300042116 Bacteria 1015
388 Ga0450914_005362 3300042118 Bacteria 1084
389 Ga0450890_004603 3300042127 Bacteria 1799
390 Ga0450897_000220 3300042128 Bacteria 2880
391 Ga0450896_026009 3300042133 Bacteria 872
392 Ga0439446_0103067 3300042156 Bacteria 904
393 Ga0439458_0029326 3300042157 Bacteria 1305
394 Ga0439434_0078516 3300042435 Bacteria 1045
395 Ga0439434_0142528 3300042435 Bacteria 790
396 Ga0439435_0139308 3300042436 Bacteria 772
397 Ga0439444_0018308 3300042437 Bacteria 1212
398 Ga0439460_0011243 3300042461 Bacteria 2306
399 Ga0439460_0032543 3300042461 Bacteria 1494
400 Ga0451577_0073985 3300042876 Bacteria 3039
401 Ga0453683_0001910 3300044673 Bacteria 17016
402 Ga0453683_0041666 3300044673 Bacteria 2884
403 Ga0453683_0251108 3300044673 Bacteria 1127
404 Ga0453684_0000163 3300044712 Bacteria 296196
405 Ga0453684_0489944 3300044712 Bacteria 1363
406 Ga0466957_0162753 3300044842 Bacteria 1450
407 Ga0451576_0042696 3300045051 Bacteria 4786
408 Ga0451576_0044571 3300045051 Bacteria 4676
409 Ga0451576_0056425 3300045051 Bacteria 4107
410 Ga0451576_0178645 3300045051 Bacteria 2216
411 Ga0451576_0248415 3300045051 Bacteria 1859
412 Ga0451576_0334769 3300045051 Bacteria 1584
413 Ga0495617_000128 3300046452 Bacteria 50370
414 Ga0495627_000004 3300046453 Bacteria 640612
415 Ga0495627_064516 3300046453 Bacteria 1077
416 Ga0495590_0036502 3300046457 Bacteria 1714
417 Ga0495629_0099975 3300046459 Bacteria 2024
418 Ga0495653_0000056 3300046463 Bacteria 100732
419 Ga0495650_0008661 3300046471 Bacteria 5893
420 Ga0495582_0166867 3300046473 Bacteria 1253
421 Ga0495664_0192042 3300046477 Bacteria 1238
422 Ga0495585_0051090 3300046492 Bacteria 2291
423 Ga0495607_0007679 3300046501 Bacteria 7432
424 Ga0495606_0000400 3300046507 Bacteria 73341
425 Ga0495606_0000589 3300046507 Bacteria 57638
426 Ga0495610_0000027 3300046512 Bacteria 275273
427 Ga0495610_0044528 3300046512 Bacteria 2202
428 Ga0495618_0501969 3300046514 Bacteria 731
429 Ga0495648_0130404 3300046524 Bacteria 1337
430 Ga0495642_0026987 3300046528 Bacteria 2284
431 Ga0495642_0071958 3300046528 Bacteria 1447
432 Ga0495654_0023598 3300046530 Bacteria 3184
433 Ga0495654_0089042 3300046530 Bacteria 1435
434 Ga0495598_0027295 3300046537 Bacteria 1573
435 Ga0495598_0036180 3300046537 Bacteria 1417
436 Ga0495598_0094554 3300046537 Bacteria 980
437 Ga0495609_0006051 3300046538 Bacteria 6232
438 Ga0495621_0139529 3300046539 Bacteria 948
439 Ga0495597_0050595 3300046542 Bacteria 1833
440 Ga0495645_0117436 3300046543 Bacteria 1876
441 Ga0495645_0286886 3300046543 Bacteria 1080
442 Ga0495633_0002867 3300046558 Bacteria 11817
443 Ga0495633_0149228 3300046558 Bacteria 1080
444 Ga0495668_0004543 3300046616 Bacteria 9793
445 Ga0495625_0036581 3300046660 Bacteria 3608
446 Ga0495625_0094169 3300046660 Bacteria 2067
447 Ga0495661_0085594 3300046665 Bacteria 1806
448 Ga0495647_0135825 3300046681 Bacteria 1045
449 Ga0495658_0050051 3300046683 Bacteria 2362
450 Ga0495658_0083861 3300046683 Bacteria 1875
451 Ga0495670_0300473 3300046691 Bacteria 860
452 Ga0495671_0001731 3300046692 Bacteria 14172
453 Ga0495660_0005482 3300046810 Bacteria 7600
454 Ga0495660_0044458 3300046810 Bacteria 2443
455 Ga0495660_0046622 3300046810 Bacteria 2376
456 Ga0495683_0143448 3300047323 Bacteria 1117
457 Ga0495687_029636 3300047443 Bacteria 2529
458 Ga0495679_009980 3300047446 Bacteria 3761
459 Ga0495673_0000009 3300047469 Bacteria 731993
460 Ga0495673_0000185 3300047469 Bacteria 100703
461 Ga0495684_0101242 3300047471 Bacteria 2178
462 Ga0495686_0094377 3300047472 Bacteria 1813
463 Ga0496101_0323484 3300048904 Bacteria 1210
464 Ga0496102_0290668 3300048905 Bacteria 1540
465 Ga0496103_0005520 3300048906 Bacteria 7565
466 Ga0496103_0017788 3300048906 Bacteria 4258
467 Ga0496104_0580980 3300048907 Bacteria 1031
468 Ga0496105_0042187 3300048908 Bacteria 3760
469 Ga0496105_0295884 3300048908 Bacteria 1302
470 Ga0496106_0235042 3300048909 Bacteria 1464
471 Ga0496107_0075669 3300048910 Bacteria 2451
472 Ga0496108_0016861 3300048911 Bacteria 5970
473 Ga0496108_0057861 3300048911 Bacteria 3257
474 Ga0496109_0086496 3300048912 Bacteria 2895
475 Ga0496109_0119507 3300048912 Bacteria 2454
476 Ga0496109_0449827 3300048912 Bacteria 1217
477 Ga0496109_0776738 3300048912 Bacteria 896
478 Ga0496110_0053981 3300048913 Bacteria 3534
479 Ga0496110_0456924 3300048913 Bacteria 1164
480 Ga0496110_0816026 3300048913 Bacteria 837
481 Ga0496111_0315368 3300048914 Bacteria 1158
482 Ga0496114_0019796 3300048917 Bacteria 5457
483 Ga0496114_0125363 3300048917 Bacteria 2213
484 Ga0496114_0342034 3300048917 Bacteria 1323
485 Ga0496121_0021941 3300048924 Bacteria 6228
486 Ga0496121_0096110 3300048924 Bacteria 2300
487 Ga0496121_0290383 3300048924 Bacteria 1114
488 Ga0496122_0110331 3300048925 Bacteria 1808
489 Ga0496122_0299333 3300048925 Bacteria 868
490 Ga0496123_0023826 3300048926 Bacteria 4674
491 Ga0496124_0191264 3300048927 Bacteria 1566
492 Ga0496124_0249867 3300048927 Bacteria 1313
493 Ga0496124_0521464 3300048927 Bacteria 791
494 Ga0496125_0017398 3300048928 Bacteria 6855
495 Ga0496125_0024393 3300048928 Bacteria 5563
496 Ga0496125_0068323 3300048928 Bacteria 2796
497 Ga0496126_0003538 3300048929 Bacteria 19643
498 Ga0496126_0087264 3300048929 Bacteria 2749
499 Ga0501306_035081 3300049127 Bacteria 760
500 Ga0501308_005171 3300049128 Bacteria 1288
501 Ga0501308_042688 3300049128 Bacteria 643
502 Ga0501304_002699 3300049160 Bacteria 1252
503 Ga0495678_000149 3300049459 Bacteria 84717
504 Ga0501311_022280 3300049527 Bacteria 870
505 Ga0501314_002431 3300049530 Bacteria 1439
506 Ga0501320_011426 3300049536 Bacteria 920
507 Ga0501320_030631 3300049536 Bacteria 668
508 Ga0501033_0169638 3300049570 Bacteria 1568
509 Ga0501039_0335185 3300049575 Bacteria 1189
510 Ga0501047_0417163 3300049581 Bacteria 1174
511 Ga0501222_007245 3300049662 Bacteria 1481
512 Ga0501249_002886 3300049679 Bacteria 3458
513 Ga0501269_000242 3300049766 Bacteria 16005
514 Ga0501044_0094562 3300049823 Bacteria 3013
515 nmdc:mga0yw44_469383_c1 3300050492 Bacteria 853
516 nmdc:mga0k408_242904_c1 3300050493 Bacteria 1075
517 nmdc:mga0k408_67391_c1 3300050493 Bacteria 2086
518 nmdc:mga06z11_304531_c1 3300050494 Bacteria 948
519 nmdc:mga06z11_97419_c1 3300050494 Bacteria 1608
520 nmdc:mga09592_16520_c1 3300050508 Bacteria 6039
521 nmdc:mga0qj67_21804_c1 3300050509 Bacteria 4914
522 nmdc:mga08y16_629389_c1 3300050511 Bacteria 1079
523 Ga0495601_0071486 3300053077 Bacteria 2216
524 Ga0495601_0211127 3300053077 Bacteria 1268
525 Ga0495595_0272809 3300053084 Bacteria 848
526 Ga0495619_0083709 3300053085 Bacteria 2152
527 Ga0500618_008810 3300053125 Bacteria 2788
528 Ga0500618_014077 3300053125 Bacteria 2053
529 Ga0500586_000137 3300053145 Bacteria 13327
530 Ga0590074_018157 3300059423 Bacteria 1203
531 Ga0590077_019017 3300059426 Bacteria 1453

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0071958 Ga0495642_0071958_842_1351 169
2 3300047443 Ga0495687_029636 Ga0495687_029636_1765_2274 169
3 3300048905 Ga0496102_0290668 Ga0496102_0290668_1003_1512 169
4 3300048917 Ga0496114_0342034 Ga0496114_0342034_747_1256 169
5 3300049527 Ga0501311_022280 Ga0501311_022280_18_533 170
6 iso_pu_bacteria 2521172590 2521560051 172
7 iso_pu_bacteria 2904439833 2904440915 172
8 iso_pu_bacteria 2904530477 2904535517 172
9 iso_pu_bacteria 2904584206 2904588342 172
10 iso_pu_bacteria 2904589729 2904594770 172
11 iso_pu_bacteria 2904601388 2904606033 172
12 iso_pu_bacteria 2919046199 2919049082 172
13 iso_pu_bacteria 2919079590 2919084691 172
14 iso_pu_bacteria 2923510766 2923513782 172
15 iso_pu_bacteria 2928130867 2928134381 172
16 iso_pu_bacteria 2904424332 2904427924 174
17 3300009551 Ga0105238_10000037 Ga0105238_100000378 176
18 3300010375 Ga0105239_10003694 Ga0105239_100036947 176
19 3300025224 Ga0209784_100021 Ga0209784_100021233 176
20 3300025225 Ga0209566_100039 Ga0209566_100039234 176
21 3300025226 Ga0209674_100036 Ga0209674_100036233 176
22 3300025230 Ga0209563_100040 Ga0209563_100040233 176
23 3300025253 Ga0209677_100023 Ga0209677_100023233 176
24 3300039447 Ga0436361_0704696 Ga0436361_0704696_3420_3950 176
25 3300049127 Ga0501306_035081 Ga0501306_035081_16_549 176
26 3300053125 Ga0500618_008810 Ga0500618_008810_2161_2691 176
27 3300009177 Ga0105248_10051344 Ga0105248_100513443 177
28 3300006028 Ga0070717_10009296 Ga0070717_100092965 179
29 3300035691 Ga0373931_0096810 Ga0373931_0096810_590_1186 179
30 3300035086 Ga0373934_0143239 Ga0373934_0143239_358_960 182
31 3300042435 Ga0439434_0142528 Ga0439434_0142528_41_601 186
32 3300013105 Ga0157369_10653134 Ga0157369_106531341 187
33 3300031727 Ga0316576_10163425 Ga0316576_101634252 187
34 3300033541 Ga0316596_1053168 Ga0316596_10531682 187
35 3300049536 Ga0501320_030631 Ga0501320_030631_22_591 189
36 3300048904 Ga0496101_0323484 Ga0496101_0323484_350_958 190
37 3300006048 Ga0075363_100256117 Ga0075363_1002561172 191
38 iso_pu_bacteria 2932422444 2932424015 194
39 3300031665 Ga0316575_10037334 Ga0316575_100373342 195
40 3300035398 Ga0316574_0044253 Ga0316574_0044253_720_1316 195
41 3300042876 Ga0451577_0073985 Ga0451577_0073985_718_1305 195
42 3300044673 Ga0453683_0041666 Ga0453683_0041666_2054_2641 195
43 3300044673 Ga0453683_0251108 Ga0453683_0251108_138_725 195
44 3300045051 Ga0451576_0042696 Ga0451576_0042696_3802_4389 195
45 iso_pu_bacteria 2643221596 2643991603 195
46 iso_pu_bacteria 2643221654 2644301378 195
47 iso_pu_bacteria 2643221717 2644648512 195
48 3300045051 Ga0451576_0248415 Ga0451576_0248415_800_1390 196
49 3300014326 Ga0157380_10325853 Ga0157380_103258532 197
50 iso_pu_bacteria 2857553236 2857556442 197
51 3300003792 Ga0055540_1011442 Ga0055540_10114422 198
52 3300003794 Ga0055531_10000257 Ga0055531_1000025743 198
53 3300005327 Ga0070658_10190477 Ga0070658_101904772 198
54 3300005327 Ga0070658_10261294 Ga0070658_102612942 198
55 3300005331 Ga0070670_100001787 Ga0070670_1000017877 198
56 3300005338 Ga0068868_100332809 Ga0068868_1003328092 198
57 3300005347 Ga0070668_100893251 Ga0070668_1008932511 198
58 3300005354 Ga0070675_100059035 Ga0070675_1000590353 198
59 3300005355 Ga0070671_100080633 Ga0070671_1000806331 198
60 3300005364 Ga0070673_100143620 Ga0070673_1001436202 198
61 3300005543 Ga0070672_100008932 Ga0070672_1000089326 198
62 3300005618 Ga0068864_100034125 Ga0068864_1000341252 198
63 3300005834 Ga0068851_10092912 Ga0068851_100929122 198
64 3300005842 Ga0068858_100610245 Ga0068858_1006102452 198
65 3300006038 Ga0075365_10051467 Ga0075365_100514673 198
66 3300006038 Ga0075365_10093861 Ga0075365_100938612 198
67 3300006038 Ga0075365_10474755 Ga0075365_104747552 198
68 3300006042 Ga0075368_10086394 Ga0075368_100863942 198
69 3300006178 Ga0075367_10161645 Ga0075367_101616452 198
70 3300006178 Ga0075367_10249889 Ga0075367_102498892 198
71 3300006195 Ga0075366_10276794 Ga0075366_102767942 198
72 3300006237 Ga0097621_100082351 Ga0097621_1000823512 198
73 3300006353 Ga0075370_10237519 Ga0075370_102375192 198
74 3300006358 Ga0068871_100039576 Ga0068871_1000395762 198
75 3300006880 Ga0075429_100396307 Ga0075429_1003963072 198
76 3300009147 Ga0114129_11168625 Ga0114129_111686252 198
77 3300013308 Ga0157375_10260281 Ga0157375_102602812 198
78 3300014968 Ga0157379_10098500 Ga0157379_100985002 198
79 3300014969 Ga0157376_10403153 Ga0157376_104031532 198
80 3300025273 Ga0209673_1005215 Ga0209673_10052155 198
81 3300025303 Ga0209051_1000025 Ga0209051_100002515 198
82 3300025304 Ga0209257_1000039 Ga0209257_1000039593 198
83 3300025909 Ga0207705_10172892 Ga0207705_101728922 198
84 3300025925 Ga0207650_10022106 Ga0207650_100221063 198
85 3300025926 Ga0207659_10039901 Ga0207659_100399012 198
86 3300025931 Ga0207644_10900493 Ga0207644_109004931 198
87 3300025940 Ga0207691_10004404 Ga0207691_100044042 198
88 3300025945 Ga0207679_11014652 Ga0207679_110146522 198
89 3300025960 Ga0207651_10009154 Ga0207651_100091542 198
90 3300026035 Ga0207703_10435705 Ga0207703_104357052 198
91 3300026088 Ga0207641_10314816 Ga0207641_103148162 198
92 3300026095 Ga0207676_10002741 Ga0207676_100027414 198
93 3300026121 Ga0207683_10484206 Ga0207683_104842062 198
94 3300026142 Ga0207698_10987811 Ga0207698_109878111 198
95 3300027866 Ga0209813_10021609 Ga0209813_100216092 198
96 3300028794 Ga0307515_10001484 Ga0307515_1000148429 198
97 3300031239 Ga0265328_10040645 Ga0265328_100406452 198
98 3300031250 Ga0265331_10001643 Ga0265331_1000164317 198
99 3300031251 Ga0265327_10000012 Ga0265327_10000012219 198
100 3300031251 Ga0265327_10038138 Ga0265327_100381383 198
101 3300031649 Ga0307514_10000355 Ga0307514_100003552 198
102 3300031730 Ga0307516_10080487 Ga0307516_100804873 198
103 3300031911 Ga0307412_11053087 Ga0307412_110530871 198
104 3300037312 Ga0395899_0008661 Ga0395899_0008661_2851_3447 198
105 3300037418 Ga0395900_0047478 Ga0395900_0047478_2057_2653 198
106 3300037466 Ga0395898_0018204 Ga0395898_0018204_4918_5514 198
107 3300039447 Ga0436361_0266216 Ga0436361_0266216_63_659 198
108 3300039447 Ga0436361_0548576 Ga0436361_0548576_690_1286 198
109 3300041406 Ga0439439_0080551 Ga0439439_0080551_133_729 198
110 3300041408 Ga0439453_0068146 Ga0439453_0068146_55_651 198
111 3300041496 Ga0451839_0444511 Ga0451839_0444511_163_765 198
112 3300042007 Ga0439449_0001504 Ga0439449_0001504_2326_2922 198
113 3300042014 Ga0439457_029445 Ga0439457_029445_195_791 198
114 3300042015 Ga0439462_0023380 Ga0439462_0023380_774_1370 198
115 3300042116 Ga0450912_004814 Ga0450912_004814_121_717 198
116 3300042118 Ga0450914_005362 Ga0450914_005362_229_918 198
117 3300042127 Ga0450890_004603 Ga0450890_004603_1043_1732 198
118 3300042128 Ga0450897_000220 Ga0450897_000220_1646_2242 198
119 3300042157 Ga0439458_0029326 Ga0439458_0029326_438_1127 198
120 3300042435 Ga0439434_0078516 Ga0439434_0078516_106_795 198
121 3300042437 Ga0439444_0018308 Ga0439444_0018308_405_1001 198
122 3300042461 Ga0439460_0032543 Ga0439460_0032543_563_1159 198
123 3300044673 Ga0453683_0001910 Ga0453683_0001910_721_1317 198
124 3300044712 Ga0453684_0000163 Ga0453684_0000163_268340_268936 198
125 3300044842 Ga0466957_0162753 Ga0466957_0162753_172_768 198
126 3300045051 Ga0451576_0044571 Ga0451576_0044571_277_873 198
127 3300045051 Ga0451576_0056425 Ga0451576_0056425_2949_3545 198
128 3300045051 Ga0451576_0178645 Ga0451576_0178645_454_1050 198
129 3300045051 Ga0451576_0334769 Ga0451576_0334769_776_1372 198
130 3300046459 Ga0495629_0099975 Ga0495629_0099975_1375_1971 198
131 3300046477 Ga0495664_0192042 Ga0495664_0192042_170_766 198
132 3300046543 Ga0495645_0117436 Ga0495645_0117436_1125_1721 198
133 3300046558 Ga0495633_0002867 Ga0495633_0002867_486_1082 198
134 3300046683 Ga0495658_0083861 Ga0495658_0083861_428_1024 198
135 3300048912 Ga0496109_0449827 Ga0496109_0449827_256_852 198
136 3300048925 Ga0496122_0299333 Ga0496122_0299333_262_858 198
137 3300049128 Ga0501308_005171 Ga0501308_005171_74_670 198
138 3300049160 Ga0501304_002699 Ga0501304_002699_585_1181 198
139 3300049530 Ga0501314_002431 Ga0501314_002431_167_763 198
140 3300049570 Ga0501033_0169638 Ga0501033_0169638_86_682 198
141 3300049575 Ga0501039_0335185 Ga0501039_0335185_484_1080 198
142 3300049581 Ga0501047_0417163 Ga0501047_0417163_459_1055 198
143 3300049662 Ga0501222_007245 Ga0501222_007245_311_907 198
144 3300049823 Ga0501044_0094562 Ga0501044_0094562_1702_2298 198
145 3300050492 nmdc:mga0yw44_469383_c1 nmdc:mga0yw44_469383_c1_175_771 198
146 3300050493 nmdc:mga0k408_67391_c1 nmdc:mga0k408_67391_c1_1395_1991 198
147 3300050494 nmdc:mga06z11_304531_c1 nmdc:mga06z11_304531_c1_167_763 198
148 3300050494 nmdc:mga06z11_97419_c1 nmdc:mga06z11_97419_c1_924_1520 198
149 3300053077 Ga0495601_0071486 Ga0495601_0071486_240_836 198
150 3300053084 Ga0495595_0272809 Ga0495595_0272809_54_650 198
151 3300059423 Ga0590074_018157 Ga0590074_018157_466_1062 198
152 3300059426 Ga0590077_019017 Ga0590077_019017_636_1232 198
153 iso_pu_bacteria 2511231003 2511249704 198
154 iso_pu_bacteria 2511231026 2511385595 198
155 iso_pu_bacteria 2551306416 2553008079 198
156 iso_pu_bacteria 2643221603 2644027031 198
157 iso_pu_bacteria 2738541280 2738738266 198
158 iso_pu_bacteria 2738541297 2738826601 198
159 iso_pu_bacteria 2738541357 2739150398 198
160 iso_pu_bacteria 2738543003 2739192317 198
161 iso_pu_bacteria 2738543026 2739318794 198
162 iso_pu_bacteria 2738543029 2739337035 198
163 iso_pu_bacteria 2808606415 2809129570 198
164 iso_pu_bacteria 2808606419 2809149375 198
165 iso_pu_bacteria 2821131069 2821135313 198
166 iso_pu_bacteria 2842711865 2842717377 198
167 iso_pu_bacteria 2857558681 2857562176 198
168 iso_pu_bacteria 2857564685 2857567830 198
169 iso_pu_bacteria 2919476304 2919476788 198
170 3300003187 JGI25151J46595_10000864 JGI25151J46595_100008646 199
171 3300003775 Ga0055524_1000013 Ga0055524_1000013249 199
172 3300003791 Ga0055530_10015172 Ga0055530_100151722 199
173 3300003792 Ga0055540_1000001 Ga0055540_100000112 199
174 3300003794 Ga0055531_10010669 Ga0055531_100106693 199
175 3300005293 Ga0065715_10124382 Ga0065715_101243821 199
176 3300005327 Ga0070658_10352166 Ga0070658_103521662 199
177 3300005328 Ga0070676_10019669 Ga0070676_100196693 199
178 3300005328 Ga0070676_10640135 Ga0070676_106401351 199
179 3300005329 Ga0070683_100302591 Ga0070683_1003025912 199
180 3300005330 Ga0070690_100027294 Ga0070690_1000272943 199
181 3300005331 Ga0070670_100056429 Ga0070670_1000564294 199
182 3300005331 Ga0070670_100082233 Ga0070670_1000822332 199
183 3300005331 Ga0070670_100225003 Ga0070670_1002250032 199
184 3300005331 Ga0070670_100511435 Ga0070670_1005114352 199
185 3300005331 Ga0070670_100575144 Ga0070670_1005751441 199
186 3300005333 Ga0070677_10012687 Ga0070677_100126872 199
187 3300005333 Ga0070677_10019872 Ga0070677_100198722 199
188 3300005333 Ga0070677_10037630 Ga0070677_100376302 199
189 3300005335 Ga0070666_10005194 Ga0070666_100051947 199
190 3300005337 Ga0070682_100414925 Ga0070682_1004149252 199
191 3300005338 Ga0068868_100000966 Ga0068868_10000096622 199
192 3300005338 Ga0068868_100060218 Ga0068868_1000602181 199
193 3300005338 Ga0068868_100251567 Ga0068868_1002515672 199
194 3300005340 Ga0070689_100033031 Ga0070689_1000330312 199
195 3300005343 Ga0070687_100021471 Ga0070687_1000214712 199
196 3300005344 Ga0070661_100007516 Ga0070661_1000075161 199
197 3300005344 Ga0070661_100325800 Ga0070661_1003258002 199
198 3300005344 Ga0070661_100643032 Ga0070661_1006430321 199
199 3300005347 Ga0070668_100101677 Ga0070668_1001016772 199
200 3300005347 Ga0070668_100130279 Ga0070668_1001302793 199
201 3300005347 Ga0070668_100382209 Ga0070668_1003822091 199
202 3300005353 Ga0070669_100101679 Ga0070669_1001016793 199
203 3300005353 Ga0070669_100271417 Ga0070669_1002714172 199
204 3300005354 Ga0070675_100007798 Ga0070675_1000077983 199
205 3300005354 Ga0070675_100071831 Ga0070675_1000718313 199
206 3300005354 Ga0070675_100296186 Ga0070675_1002961862 199
207 3300005355 Ga0070671_100003392 Ga0070671_1000033927 199
208 3300005356 Ga0070674_100101588 Ga0070674_1001015883 199
209 3300005356 Ga0070674_100270579 Ga0070674_1002705792 199
210 3300005356 Ga0070674_100923742 Ga0070674_1009237421 199
211 3300005364 Ga0070673_100040581 Ga0070673_1000405812 199
212 3300005364 Ga0070673_100140074 Ga0070673_1001400742 199
213 3300005364 Ga0070673_100408454 Ga0070673_1004084542 199
214 3300005364 Ga0070673_100824476 Ga0070673_1008244761 199
215 3300005366 Ga0070659_100246959 Ga0070659_1002469592 199
216 3300005366 Ga0070659_100520511 Ga0070659_1005205112 199
217 3300005367 Ga0070667_100031351 Ga0070667_1000313514 199
218 3300005367 Ga0070667_100064801 Ga0070667_1000648014 199
219 3300005367 Ga0070667_100227943 Ga0070667_1002279432 199
220 3300005438 Ga0070701_10322081 Ga0070701_103220812 199
221 3300005441 Ga0070700_100272002 Ga0070700_1002720022 199
222 3300005456 Ga0070678_100005704 Ga0070678_1000057042 199
223 3300005456 Ga0070678_100012914 Ga0070678_1000129143 199
224 3300005456 Ga0070678_100085907 Ga0070678_1000859072 199
225 3300005456 Ga0070678_100099794 Ga0070678_1000997943 199
226 3300005456 Ga0070678_100185099 Ga0070678_1001850992 199
227 3300005456 Ga0070678_100243614 Ga0070678_1002436142 199
228 3300005456 Ga0070678_100498987 Ga0070678_1004989872 199
229 3300005457 Ga0070662_100177439 Ga0070662_1001774392 199
230 3300005457 Ga0070662_100476676 Ga0070662_1004766761 199
231 3300005458 Ga0070681_10533713 Ga0070681_105337132 199
232 3300005459 Ga0068867_100066600 Ga0068867_1000666002 199
233 3300005543 Ga0070672_100118022 Ga0070672_1001180223 199
234 3300005543 Ga0070672_100312456 Ga0070672_1003124562 199
235 3300005543 Ga0070672_100472174 Ga0070672_1004721742 199
236 3300005543 Ga0070672_100480844 Ga0070672_1004808441 199
237 3300005544 Ga0070686_100290146 Ga0070686_1002901462 199
238 3300005563 Ga0068855_100408641 Ga0068855_1004086412 199
239 3300005564 Ga0070664_100116201 Ga0070664_1001162011 199
240 3300005564 Ga0070664_100220335 Ga0070664_1002203352 199
241 3300005564 Ga0070664_100298845 Ga0070664_1002988452 199
242 3300005614 Ga0068856_100007776 Ga0068856_10000777614 199
243 3300005614 Ga0068856_100362132 Ga0068856_1003621322 199
244 3300005615 Ga0070702_100192744 Ga0070702_1001927441 199
245 3300005616 Ga0068852_100060003 Ga0068852_1000600032 199
246 3300005616 Ga0068852_100107340 Ga0068852_1001073402 199
247 3300005616 Ga0068852_100119867 Ga0068852_1001198673 199
248 3300005616 Ga0068852_100311429 Ga0068852_1003114292 199
249 3300005616 Ga0068852_100345451 Ga0068852_1003454512 199
250 3300005616 Ga0068852_100663935 Ga0068852_1006639352 199
251 3300005617 Ga0068859_100023273 Ga0068859_1000232733 199
252 3300005617 Ga0068859_100138540 Ga0068859_1001385403 199
253 3300005618 Ga0068864_100002065 Ga0068864_1000020654 199
254 3300005618 Ga0068864_100117385 Ga0068864_1001173851 199
255 3300005618 Ga0068864_100208549 Ga0068864_1002085492 199
256 3300005718 Ga0068866_10055652 Ga0068866_100556522 199
257 3300005718 Ga0068866_10067821 Ga0068866_100678213 199
258 3300005719 Ga0068861_100043238 Ga0068861_1000432382 199
259 3300005719 Ga0068861_100422040 Ga0068861_1004220402 199
260 3300005719 Ga0068861_100754073 Ga0068861_1007540731 199
261 3300005834 Ga0068851_10031414 Ga0068851_100314141 199
262 3300005834 Ga0068851_10084706 Ga0068851_100847062 199
263 3300005834 Ga0068851_10165438 Ga0068851_101654381 199
264 3300005840 Ga0068870_10143448 Ga0068870_101434482 199
265 3300005841 Ga0068863_100019244 Ga0068863_1000192443 199
266 3300005841 Ga0068863_100058378 Ga0068863_1000583783 199
267 3300005841 Ga0068863_100135245 Ga0068863_1001352452 199
268 3300005841 Ga0068863_100396977 Ga0068863_1003969772 199
269 3300005842 Ga0068858_100008614 Ga0068858_1000086146 199
270 3300005842 Ga0068858_100150332 Ga0068858_1001503323 199
271 3300005843 Ga0068860_100007016 Ga0068860_1000070164 199
272 3300005843 Ga0068860_100151850 Ga0068860_1001518502 199
273 3300005844 Ga0068862_100041306 Ga0068862_1000413063 199
274 3300005844 Ga0068862_100097384 Ga0068862_1000973842 199
275 3300006038 Ga0075365_10004820 Ga0075365_100048205 199
276 3300006195 Ga0075366_10085626 Ga0075366_100856261 199
277 3300006237 Ga0097621_100030577 Ga0097621_1000305774 199
278 3300006358 Ga0068871_100306424 Ga0068871_1003064242 199
279 3300006844 Ga0075428_101073449 Ga0075428_1010734491 199
280 3300006846 Ga0075430_100133848 Ga0075430_1001338482 199
281 3300006880 Ga0075429_100048258 Ga0075429_1000482582 199
282 3300006881 Ga0068865_100543685 Ga0068865_1005436852 199
283 3300006931 Ga0097620_100023272 Ga0097620_1000232723 199
284 3300006931 Ga0097620_100138542 Ga0097620_1001385423 199
285 3300006946 Ga0079104_1000070 Ga0079104_100007047 199
286 3300009098 Ga0105245_10268171 Ga0105245_102681712 199
287 3300009098 Ga0105245_10766541 Ga0105245_107665411 199
288 3300009148 Ga0105243_10096253 Ga0105243_100962533 199
289 3300009177 Ga0105248_10200227 Ga0105248_102002272 199
290 3300009177 Ga0105248_10276432 Ga0105248_102764322 199
291 3300009551 Ga0105238_10005477 Ga0105238_100054773 199
292 3300009553 Ga0105249_10106513 Ga0105249_101065132 199
293 3300013100 Ga0157373_10133902 Ga0157373_101339023 199
294 3300013102 Ga0157371_10063837 Ga0157371_100638373 199
295 3300013102 Ga0157371_10131978 Ga0157371_101319782 199
296 3300013296 Ga0157374_10091075 Ga0157374_100910752 199
297 3300013297 Ga0157378_10700956 Ga0157378_107009562 199
298 3300013307 Ga0157372_10269502 Ga0157372_102695022 199
299 3300013307 Ga0157372_10598551 Ga0157372_105985511 199
300 3300013308 Ga0157375_10134369 Ga0157375_101343693 199
301 3300013308 Ga0157375_10750916 Ga0157375_107509162 199
302 3300014325 Ga0163163_10035273 Ga0163163_100352733 199
303 3300014325 Ga0163163_10102638 Ga0163163_101026382 199
304 3300014326 Ga0157380_10185851 Ga0157380_101858512 199
305 3300014326 Ga0157380_10526215 Ga0157380_105262152 199
306 3300014968 Ga0157379_10055008 Ga0157379_100550082 199
307 3300014969 Ga0157376_10042949 Ga0157376_100429492 199
308 3300017792 Ga0163161_10013100 Ga0163161_100131002 199
309 3300017792 Ga0163161_10177820 Ga0163161_101778202 199
310 3300017792 Ga0163161_10296468 Ga0163161_102964682 199
311 3300025263 Ga0209565_1004707 Ga0209565_10047073 199
312 3300025271 Ga0207666_1002451 Ga0207666_10024512 199
313 3300025291 Ga0209675_1009287 Ga0209675_10092872 199
314 3300025298 Ga0209050_1000730 Ga0209050_100073053 199
315 3300025298 Ga0209050_1023274 Ga0209050_10232741 199
316 3300025299 Ga0209256_1000061 Ga0209256_1000061251 199
317 3300025303 Ga0209051_1000018 Ga0209051_1000018438 199
318 3300025304 Ga0209257_1000461 Ga0209257_100046113 199
319 3300025321 Ga0207656_10080050 Ga0207656_100800502 199
320 3300025893 Ga0207682_10029330 Ga0207682_100293303 199
321 3300025899 Ga0207642_10007097 Ga0207642_100070972 199
322 3300025901 Ga0207688_10033176 Ga0207688_100331763 199
323 3300025903 Ga0207680_10002711 Ga0207680_100027113 199
324 3300025903 Ga0207680_10045424 Ga0207680_100454243 199
325 3300025905 Ga0207685_10139029 Ga0207685_101390291 199
326 3300025907 Ga0207645_10067098 Ga0207645_100670983 199
327 3300025907 Ga0207645_10590918 Ga0207645_105909181 199
328 3300025909 Ga0207705_10045619 Ga0207705_100456193 199
329 3300025918 Ga0207662_10005846 Ga0207662_100058466 199
330 3300025919 Ga0207657_10164635 Ga0207657_101646352 199
331 3300025920 Ga0207649_10014780 Ga0207649_100147806 199
332 3300025920 Ga0207649_10218481 Ga0207649_102184811 199
333 3300025923 Ga0207681_10119486 Ga0207681_101194862 199
334 3300025923 Ga0207681_10289422 Ga0207681_102894222 199
335 3300025923 Ga0207681_10355075 Ga0207681_103550752 199
336 3300025924 Ga0207694_10029099 Ga0207694_100290994 199
337 3300025925 Ga0207650_10010685 Ga0207650_100106855 199
338 3300025925 Ga0207650_10118137 Ga0207650_101181373 199
339 3300025925 Ga0207650_10483410 Ga0207650_104834102 199
340 3300025926 Ga0207659_10002170 Ga0207659_100021706 199
341 3300025926 Ga0207659_10100788 Ga0207659_101007882 199
342 3300025926 Ga0207659_10679410 Ga0207659_106794101 199
343 3300025931 Ga0207644_10002319 Ga0207644_100023197 199
344 3300025931 Ga0207644_10178867 Ga0207644_101788672 199
345 3300025931 Ga0207644_10200133 Ga0207644_102001332 199
346 3300025933 Ga0207706_10442293 Ga0207706_104422931 199
347 3300025934 Ga0207686_10062692 Ga0207686_100626923 199
348 3300025934 Ga0207686_10471043 Ga0207686_104710431 199
349 3300025936 Ga0207670_10033210 Ga0207670_100332103 199
350 3300025938 Ga0207704_10037758 Ga0207704_100377582 199
351 3300025938 Ga0207704_10518695 Ga0207704_105186951 199
352 3300025939 Ga0207665_10604735 Ga0207665_106047351 199
353 3300025940 Ga0207691_10078833 Ga0207691_100788333 199
354 3300025940 Ga0207691_10152235 Ga0207691_101522352 199
355 3300025940 Ga0207691_10440089 Ga0207691_104400892 199
356 3300025940 Ga0207691_10449364 Ga0207691_104493642 199
357 3300025940 Ga0207691_10745921 Ga0207691_107459212 199
358 3300025941 Ga0207711_10019236 Ga0207711_100192363 199
359 3300025941 Ga0207711_10117888 Ga0207711_101178883 199
360 3300025942 Ga0207689_10030687 Ga0207689_100306873 199
361 3300025945 Ga0207679_10062453 Ga0207679_100624532 199
362 3300025960 Ga0207651_10059158 Ga0207651_100591582 199
363 3300025960 Ga0207651_10174777 Ga0207651_101747771 199
364 3300025960 Ga0207651_10489629 Ga0207651_104896292 199
365 3300025961 Ga0207712_10029229 Ga0207712_100292293 199
366 3300025961 Ga0207712_10726267 Ga0207712_107262671 199
367 3300025972 Ga0207668_10124497 Ga0207668_101244972 199
368 3300025972 Ga0207668_10188242 Ga0207668_101882422 199
369 3300025972 Ga0207668_10472824 Ga0207668_104728242 199
370 3300025972 Ga0207668_11209192 Ga0207668_112091921 199
371 3300025981 Ga0207640_10216146 Ga0207640_102161462 199
372 3300025981 Ga0207640_10828040 Ga0207640_108280401 199
373 3300025986 Ga0207658_10004072 Ga0207658_100040727 199
374 3300025986 Ga0207658_10138894 Ga0207658_101388942 199
375 3300026023 Ga0207677_10001522 Ga0207677_1000152215 199
376 3300026023 Ga0207677_10739198 Ga0207677_107391981 199
377 3300026023 Ga0207677_10800620 Ga0207677_108006201 199
378 3300026035 Ga0207703_10006064 Ga0207703_100060644 199
379 3300026035 Ga0207703_10025831 Ga0207703_100258314 199
380 3300026041 Ga0207639_10409656 Ga0207639_104096561 199
381 3300026041 Ga0207639_10699521 Ga0207639_106995211 199
382 3300026075 Ga0207708_10060894 Ga0207708_100608943 199
383 3300026075 Ga0207708_10307812 Ga0207708_103078122 199
384 3300026078 Ga0207702_10004429 Ga0207702_1000442917 199
385 3300026088 Ga0207641_10019502 Ga0207641_100195022 199
386 3300026088 Ga0207641_10034241 Ga0207641_100342412 199
387 3300026089 Ga0207648_10147355 Ga0207648_101473552 199
388 3300026089 Ga0207648_10793028 Ga0207648_107930281 199
389 3300026095 Ga0207676_10018678 Ga0207676_100186784 199
390 3300026095 Ga0207676_10397318 Ga0207676_103973182 199
391 3300026095 Ga0207676_10560034 Ga0207676_105600342 199
392 3300026118 Ga0207675_100044476 Ga0207675_1000444763 199
393 3300026118 Ga0207675_100152755 Ga0207675_1001527552 199
394 3300026118 Ga0207675_100926177 Ga0207675_1009261771 199
395 3300026121 Ga0207683_10489057 Ga0207683_104890572 199
396 3300026121 Ga0207683_10633657 Ga0207683_106336571 199
397 3300026142 Ga0207698_10063349 Ga0207698_100633493 199
398 3300026142 Ga0207698_10090270 Ga0207698_100902703 199
399 3300026142 Ga0207698_10266650 Ga0207698_102666502 199
400 3300027111 Ga0209281_1000103 Ga0209281_100010347 199
401 3300028380 Ga0268265_10062030 Ga0268265_100620302 199
402 3300028381 Ga0268264_10013629 Ga0268264_100136293 199
403 3300028381 Ga0268264_10112004 Ga0268264_101120043 199
404 3300031456 Ga0307513_10065124 Ga0307513_100651242 199
405 3300031456 Ga0307513_10343040 Ga0307513_103430402 199
406 3300031730 Ga0307516_10196609 Ga0307516_101966092 199
407 3300031852 Ga0307410_10372995 Ga0307410_103729952 199
408 3300031901 Ga0307406_10772657 Ga0307406_107726572 199
409 3300031903 Ga0307407_10207438 Ga0307407_102074382 199
410 3300032004 Ga0307414_10277038 Ga0307414_102770382 199
411 3300035089 Ga0373944_0032880 Ga0373944_0032880_875_1474 199
412 3300035089 Ga0373944_0067501 Ga0373944_0067501_439_1038 199
413 3300035116 Ga0373945_0114625 Ga0373945_0114625_173_784 199
414 3300035118 Ga0373954_0080714 Ga0373954_0080714_372_971 199
415 3300035170 Ga0373943_0063600 Ga0373943_0063600_496_1095 199
416 3300035171 Ga0373946_0195126 Ga0373946_0195126_327_926 199
417 3300035410 Ga0373924_0157818 Ga0373924_0157818_189_788 199
418 3300035695 Ga0373927_0448846 Ga0373927_0448846_118_717 199
419 3300035724 Ga0373933_0196148 Ga0373933_0196148_390_989 199
420 3300035725 Ga0373947_0380754 Ga0373947_0380754_296_895 199
421 3300037068 Ga0373925_0124979 Ga0373925_0124979_925_1524 199
422 3300037068 Ga0373925_0867582 Ga0373925_0867582_106_705 199
423 3300037471 Ga0395905_0009245 Ga0395905_0009245_1594_2193 199
424 3300037471 Ga0395905_0019544 Ga0395905_0019544_3880_4479 199
425 3300037471 Ga0395905_0367100 Ga0395905_0367100_373_972 199
426 3300037471 Ga0395905_0454049 Ga0395905_0454049_219_818 199
427 3300037471 Ga0395905_0499223 Ga0395905_0499223_494_1093 199
428 3300039437 Ga0436365_0515661 Ga0436365_0515661_58_720 199
429 3300041512 Ga0451853_2548672 Ga0451853_2548672_123_752 199
430 3300042008 Ga0439450_012902 Ga0439450_012902_921_1520 199
431 3300042016 Ga0439463_098707 Ga0439463_098707_141_740 199
432 3300042115 Ga0450911_001247 Ga0450911_001247_4944_5543 199
433 3300042133 Ga0450896_026009 Ga0450896_026009_12_611 199
434 3300042436 Ga0439435_0139308 Ga0439435_0139308_89_688 199
435 3300042461 Ga0439460_0011243 Ga0439460_0011243_434_1033 199
436 3300044712 Ga0453684_0489944 Ga0453684_0489944_540_1157 199
437 3300046457 Ga0495590_0036502 Ga0495590_0036502_178_777 199
438 3300046473 Ga0495582_0166867 Ga0495582_0166867_156_755 199
439 3300046537 Ga0495598_0027295 Ga0495598_0027295_716_1315 199
440 3300046537 Ga0495598_0036180 Ga0495598_0036180_510_1121 199
441 3300046539 Ga0495621_0139529 Ga0495621_0139529_72_671 199
442 3300046543 Ga0495645_0286886 Ga0495645_0286886_26_625 199
443 3300046681 Ga0495647_0135825 Ga0495647_0135825_366_965 199
444 3300046683 Ga0495658_0050051 Ga0495658_0050051_1001_1600 199
445 3300046691 Ga0495670_0300473 Ga0495670_0300473_151_750 199
446 3300046810 Ga0495660_0046622 Ga0495660_0046622_291_890 199
447 3300047471 Ga0495684_0101242 Ga0495684_0101242_1128_1727 199
448 3300047472 Ga0495686_0094377 Ga0495686_0094377_308_907 199
449 3300048907 Ga0496104_0580980 Ga0496104_0580980_266_877 199
450 3300048908 Ga0496105_0042187 Ga0496105_0042187_1288_1887 199
451 3300048911 Ga0496108_0057861 Ga0496108_0057861_638_1237 199
452 3300048912 Ga0496109_0086496 Ga0496109_0086496_1955_2554 199
453 3300048912 Ga0496109_0776738 Ga0496109_0776738_142_741 199
454 3300048913 Ga0496110_0456924 Ga0496110_0456924_27_626 199
455 3300048913 Ga0496110_0816026 Ga0496110_0816026_195_794 199
456 3300048917 Ga0496114_0125363 Ga0496114_0125363_1455_2054 199
457 3300048924 Ga0496121_0021941 Ga0496121_0021941_5502_6101 199
458 3300048927 Ga0496124_0191264 Ga0496124_0191264_684_1283 199
459 3300048928 Ga0496125_0017398 Ga0496125_0017398_328_927 199
460 3300048928 Ga0496125_0024393 Ga0496125_0024393_4521_5120 199
461 3300048928 Ga0496125_0068323 Ga0496125_0068323_34_633 199
462 3300048929 Ga0496126_0087264 Ga0496126_0087264_1987_2586 199
463 3300049128 Ga0501308_042688 Ga0501308_042688_15_614 199
464 3300049536 Ga0501320_011426 Ga0501320_011426_300_899 199
465 3300050493 nmdc:mga0k408_242904_c1 nmdc:mga0k408_242904_c1_227_826 199
466 3300050508 nmdc:mga09592_16520_c1 nmdc:mga09592_16520_c1_936_1535 199
467 3300050509 nmdc:mga0qj67_21804_c1 nmdc:mga0qj67_21804_c1_1026_1625 199
468 3300050511 nmdc:mga08y16_629389_c1 nmdc:mga08y16_629389_c1_279_878 199
469 3300053077 Ga0495601_0211127 Ga0495601_0211127_153_752 199
470 3300053085 Ga0495619_0083709 Ga0495619_0083709_702_1301 199
471 iso_pu_bacteria 2842747753 2842748899 199
472 iso_pu_bacteria 2904541872 2904547948 199
473 iso_pu_bacteria 2929160207 2929161673 199
474 3300005328 Ga0070676_10526572 Ga0070676_105265722 200
475 3300005331 Ga0070670_100175075 Ga0070670_1001750753 200
476 3300005548 Ga0070665_100023730 Ga0070665_1000237304 200
477 3300005616 Ga0068852_100914048 Ga0068852_1009140481 200
478 3300026023 Ga0207677_10059377 Ga0207677_100593772 200
479 3300026078 Ga0207702_10652496 Ga0207702_106524962 200
480 3300026116 Ga0207674_10337827 Ga0207674_103378272 200
481 3300028786 Ga0307517_10003685 Ga0307517_100036858 200
482 3300031507 Ga0307509_10407590 Ga0307509_104075902 200
483 3300031730 Ga0307516_10002915 Ga0307516_1000291510 200
484 3300033180 Ga0307510_10003212 Ga0307510_1000321223 200
485 3300041459 Ga0451800_1666127 Ga0451800_1666127_255_857 200
486 3300041460 Ga0451802_1504526 Ga0451802_1504526_499_1101 200
487 3300046514 Ga0495618_0501969 Ga0495618_0501969_24_629 200
488 3300005337 Ga0070682_100332138 Ga0070682_1003321381 201
489 3300046453 Ga0495627_000004 Ga0495627_000004_561986_562591 201
490 3300046530 Ga0495654_0089042 Ga0495654_0089042_224_829 201
491 3300046538 Ga0495609_0006051 Ga0495609_0006051_2338_2943 201
492 3300046810 Ga0495660_0005482 Ga0495660_0005482_4743_5348 201
493 3300048927 Ga0496124_0249867 Ga0496124_0249867_536_1141 201
494 3300049459 Ga0495678_000149 Ga0495678_000149_6876_7481 201
495 3300002705 JGI25156J39149_1001185 JGI25156J39149_100118514 202
496 3300003751 Ga0055538_1000038 Ga0055538_1000038133 202
497 3300003752 Ga0055539_1000049 Ga0055539_1000049133 202
498 3300003756 Ga0055533_1000060 Ga0055533_1000060133 202
499 3300003759 Ga0055525_1000068 Ga0055525_100006862 202
500 3300003841 Ga0055541_1000036 Ga0055541_100003662 202
501 3300005563 Ga0068855_100004108 Ga0068855_10000410811 202
502 3300006946 Ga0079104_1006956 Ga0079104_10069563 202
503 3300006946 Ga0079104_1007690 Ga0079104_10076902 202
504 3300009093 Ga0105240_10360767 Ga0105240_103607671 202
505 3300009093 Ga0105240_10475490 Ga0105240_104754902 202
506 3300009545 Ga0105237_10273494 Ga0105237_102734942 202
507 3300009545 Ga0105237_10314487 Ga0105237_103144872 202
508 3300014969 Ga0157376_10147904 Ga0157376_101479042 202
509 3300015261 Ga0182006_1000102 Ga0182006_100010213 202
510 3300015265 Ga0182005_1000006 Ga0182005_1000006380 202
511 3300017792 Ga0163161_10060133 Ga0163161_100601332 202
512 3300021361 Ga0213872_10002128 Ga0213872_100021287 202
513 3300025728 Ga0207655_1002585 Ga0207655_10025857 202
514 3300025913 Ga0207695_10014674 Ga0207695_1001467412 202
515 3300025949 Ga0207667_10000043 Ga0207667_100000435 202
516 3300027111 Ga0209281_1003429 Ga0209281_10034296 202
517 3300027111 Ga0209281_1005531 Ga0209281_10055312 202
518 3300030744 Ga0316181_1248234 Ga0316181_12482342 202
519 3300037418 Ga0395900_0592541 Ga0395900_0592541_277_909 202
520 3300037466 Ga0395898_0100918 Ga0395898_0100918_112_720 202
521 3300042156 Ga0439446_0103067 Ga0439446_0103067_187_798 202
522 3300046452 Ga0495617_000128 Ga0495617_000128_42298_42906 202
523 3300046453 Ga0495627_064516 Ga0495627_064516_19_627 202
524 3300046463 Ga0495653_0000056 Ga0495653_0000056_91495_92103 202
525 3300046471 Ga0495650_0008661 Ga0495650_0008661_319_927 202
526 3300046492 Ga0495585_0051090 Ga0495585_0051090_1194_1802 202
527 3300046501 Ga0495607_0007679 Ga0495607_0007679_197_805 202
528 3300046507 Ga0495606_0000400 Ga0495606_0000400_66470_67078 202
529 3300046507 Ga0495606_0000589 Ga0495606_0000589_45009_45617 202
530 3300046512 Ga0495610_0000027 Ga0495610_0000027_186944_187552 202
531 3300046512 Ga0495610_0044528 Ga0495610_0044528_411_1019 202
532 3300046524 Ga0495648_0130404 Ga0495648_0130404_43_651 202
533 3300046528 Ga0495642_0026987 Ga0495642_0026987_1483_2091 202
534 3300046530 Ga0495654_0023598 Ga0495654_0023598_893_1501 202
535 3300046537 Ga0495598_0094554 Ga0495598_0094554_260_868 202
536 3300046542 Ga0495597_0050595 Ga0495597_0050595_47_655 202
537 3300046558 Ga0495633_0149228 Ga0495633_0149228_408_1016 202
538 3300046616 Ga0495668_0004543 Ga0495668_0004543_185_793 202
539 3300046660 Ga0495625_0036581 Ga0495625_0036581_205_813 202
540 3300046660 Ga0495625_0094169 Ga0495625_0094169_186_794 202
541 3300046665 Ga0495661_0085594 Ga0495661_0085594_442_1050 202
542 3300046692 Ga0495671_0001731 Ga0495671_0001731_8742_9350 202
543 3300046810 Ga0495660_0044458 Ga0495660_0044458_1366_1974 202
544 3300047323 Ga0495683_0143448 Ga0495683_0143448_286_990 202
545 3300047446 Ga0495679_009980 Ga0495679_009980_2650_3258 202
546 3300047469 Ga0495673_0000009 Ga0495673_0000009_87813_88421 202
547 3300047469 Ga0495673_0000185 Ga0495673_0000185_94812_95420 202
548 3300048906 Ga0496103_0005520 Ga0496103_0005520_4223_4831 202
549 3300048906 Ga0496103_0017788 Ga0496103_0017788_2421_3029 202
550 3300048908 Ga0496105_0295884 Ga0496105_0295884_449_1057 202
551 3300048909 Ga0496106_0235042 Ga0496106_0235042_438_1046 202
552 3300048910 Ga0496107_0075669 Ga0496107_0075669_1606_2214 202
553 3300048911 Ga0496108_0016861 Ga0496108_0016861_2958_3566 202
554 3300048912 Ga0496109_0119507 Ga0496109_0119507_571_1179 202
555 3300048913 Ga0496110_0053981 Ga0496110_0053981_2672_3280 202
556 3300048914 Ga0496111_0315368 Ga0496111_0315368_450_1058 202
557 3300048917 Ga0496114_0019796 Ga0496114_0019796_183_791 202
558 3300048924 Ga0496121_0096110 Ga0496121_0096110_174_782 202
559 3300048924 Ga0496121_0290383 Ga0496121_0290383_335_943 202
560 3300048925 Ga0496122_0110331 Ga0496122_0110331_269_877 202
561 3300048926 Ga0496123_0023826 Ga0496123_0023826_3006_3614 202
562 3300048927 Ga0496124_0521464 Ga0496124_0521464_138_746 202
563 3300048929 Ga0496126_0003538 Ga0496126_0003538_1302_1910 202
564 3300049679 Ga0501249_002886 Ga0501249_002886_1065_1673 202
565 3300049766 Ga0501269_000242 Ga0501269_000242_4965_5573 202
566 3300053125 Ga0500618_014077 Ga0500618_014077_360_968 202
567 3300053145 Ga0500586_000137 Ga0500586_000137_9898_10506 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10399

UCR_Fe-S_N

Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal

32

70

0.92

PF00355

Rieske

Rieske [2Fe-2S] domain

128

212

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yra-assembly1.cif.gz_B crystal structure of [2fe-2s]-ttpeta 0.9643 50 198
7yra-assembly1.cif.gz_B crystal structure of [2fe-2s]-ttpeta 0.9514 50 198
8smr-assembly1.cif.gz_C cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.9 33 197
6fo2-assembly1.cif.gz_R cryoem structure of bovine cytochrome bc1 with no ligand bound 0.8834 67 195
6fo2-assembly1.cif.gz_E cryoem structure of bovine cytochrome bc1 with no ligand bound 0.8834 67 195
ID Description Score Start End Superfamily
3l71E02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8279 49 195 2.102.10.10
1l0nE02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.801 50 195 2.102.10.10
2yiuC02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7986 46 195 2.102.10.10
af_Q4DS82_165_295_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7891 49 195 2.102.10.10
3l71E02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7749 49 195 2.102.10.10
ID Description Score Start End GO Terms
AF-H0BYK6-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9808 50 200 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-A0A4R3V318-F1-model_v4 deleted 0.9765 62 202
AF-H0BYK6-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9744 50 200 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-A0A4R3V318-F1-model_v4 deleted 0.9697 62 202
AF-A0A536Y491-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9696 47 199 GO:0008121
GO:0016020
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
83.36 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map