F464518

General Info

Members Datasets Scaffolds Average Seq Length
567 231 567 259

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10071800|Ga0207646_100718002
Length 308
Sequence LAGIQSTRPERRQPNRGSDGTLLPCRVTAAAPPWASAGPGDGGARTPGAQSPLAWVAFALTLIRPAFAAAQNPPPQPQGDYAPADIAYGARLYDAQCTTCHGANGDAVGGVNLRSGIFRNAITDQDLARVITNGIQGTGMQAFKFDAAELAGIIAYIRNMNSFDRGSAKLGDAGRGETLFTGKGGCTRCHRVGAQGSRVAPDLSDIGATRSAGSLLRSLTDPTSQMMPINRPVRAVLRDGKVVNGRRLNEDTYTVQLIDDQEKLVSLTKSELREYTILTASPMPAFKGTLGPDELADVVAYLLSLKGR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
147 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.76
Rhizosphere 97.88
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000213 3300003203 Bacteria 25628
2 JGI25406J46586_10015184 3300003203 Unclassified 3253
3 Ga0065712_10085559 3300005290 Bacteria 2690
4 Ga0065715_10113521 3300005293 Bacteria 2486
5 Ga0065707_10001222 3300005295 Bacteria 9734
6 Ga0070676_10038479 3300005328 Bacteria 2763
7 Ga0070676_10066716 3300005328 Bacteria 2150
8 Ga0070676_10179290 3300005328 Unclassified 1376
9 Ga0070690_100002407 3300005330 Bacteria 10050
10 Ga0070690_100019539 3300005330 Bacteria 4114
11 Ga0070690_100027737 3300005330 Unclassified 3502
12 Ga0070670_100026806 3300005331 Unclassified 4957
13 Ga0070677_10012269 3300005333 Bacteria 2974
14 Ga0068869_100044333 3300005334 Unclassified 3198
15 Ga0070666_10008205 3300005335 Bacteria 6472
16 Ga0070666_10026271 3300005335 Bacteria 3802
17 Ga0070666_10086914 3300005335 Bacteria 2143
18 Ga0070666_10111010 3300005335 Bacteria 1896
19 Ga0068868_100116352 3300005338 Bacteria 2177
20 Ga0068868_100270102 3300005338 Unclassified 1436
21 Ga0070689_100011352 3300005340 Bacteria 6378
22 Ga0070689_100013955 3300005340 Bacteria 5828
23 Ga0070689_100077095 3300005340 Unclassified 2612
24 Ga0070689_100744448 3300005340 Bacteria 859
25 Ga0070691_10014870 3300005341 Bacteria 3573
26 Ga0070687_100048916 3300005343 Bacteria 2176
27 Ga0070668_100169588 3300005347 Bacteria 1776
28 Ga0070669_100010525 3300005353 Bacteria 6569
29 Ga0070669_100034405 3300005353 Bacteria 3668
30 Ga0070669_100147542 3300005353 Bacteria 1818
31 Ga0070669_100177705 3300005353 Bacteria 1663
32 Ga0070669_100435648 3300005353 Unclassified 1078
33 Ga0070675_100000928 3300005354 Bacteria 20847
34 Ga0070675_100015575 3300005354 Bacteria 6014
35 Ga0070675_100021857 3300005354 Bacteria 5111
36 Ga0070675_100029726 3300005354 Bacteria 4409
37 Ga0070675_100063896 3300005354 Bacteria 3043
38 Ga0070675_100073836 3300005354 Bacteria 2832
39 Ga0070675_100093835 3300005354 Unclassified 2517
40 Ga0070675_100296410 3300005354 Bacteria 1424
41 Ga0070671_100006676 3300005355 Bacteria 9228
42 Ga0070671_100018780 3300005355 Bacteria 5619
43 Ga0070671_100027861 3300005355 Bacteria 4651
44 Ga0070671_100275387 3300005355 Bacteria 1430
45 Ga0070674_100004335 3300005356 Bacteria 8087
46 Ga0070674_100037580 3300005356 Unclassified 3257
47 Ga0070674_100116205 3300005356 Bacteria 1974
48 Ga0070674_100377939 3300005356 Bacteria 1152
49 Ga0070673_100036889 3300005364 Bacteria 3721
50 Ga0070673_100049430 3300005364 Bacteria 3284
51 Ga0070673_100092060 3300005364 Bacteria 2479
52 Ga0070673_100097744 3300005364 Bacteria 2411
53 Ga0070673_100235993 3300005364 Bacteria 1588
54 Ga0070688_100037082 3300005365 Bacteria 2969
55 Ga0070659_100193545 3300005366 Unclassified 1672
56 Ga0070667_100043545 3300005367 Bacteria 3768
57 Ga0070667_100051619 3300005367 Bacteria 3468
58 Ga0070703_10087903 3300005406 Bacteria 1072
59 Ga0070701_10003349 3300005438 Bacteria 6329
60 Ga0070701_10029230 3300005438 Bacteria 2716
61 Ga0070701_10032273 3300005438 Bacteria 2607
62 Ga0070705_100014630 3300005440 Bacteria 4042
63 Ga0070705_100020338 3300005440 Unclassified 3511
64 Ga0070705_100133940 3300005440 Unclassified 1620
65 Ga0070700_100043078 3300005441 Bacteria 2775
66 Ga0070700_100257022 3300005441 Bacteria 1256
67 Ga0070694_100100102 3300005444 Bacteria 2049
68 Ga0070694_100169011 3300005444 Bacteria 1609
69 Ga0070694_100394216 3300005444 Bacteria 1082
70 Ga0070708_100355708 3300005445 Bacteria 1380
71 Ga0070708_100432648 3300005445 Unclassified 1241
72 Ga0070678_100066375 3300005456 Bacteria 2682
73 Ga0070678_100073928 3300005456 Unclassified 2560
74 Ga0070678_100702921 3300005456 Unclassified 911
75 Ga0070662_100053997 3300005457 Bacteria 2911
76 Ga0070662_100307115 3300005457 Unclassified 1290
77 Ga0068867_100001682 3300005459 Bacteria 15425
78 Ga0068867_100003832 3300005459 Bacteria 10568
79 Ga0068867_100087080 3300005459 Unclassified 2364
80 Ga0070685_10238633 3300005466 Bacteria 1199
81 Ga0070706_100180286 3300005467 Unclassified 1972
82 Ga0070706_100261578 3300005467 Bacteria 1615
83 Ga0070706_100281127 3300005467 Bacteria 1553
84 Ga0070707_100129730 3300005468 Unclassified 2451
85 Ga0070707_100360716 3300005468 Bacteria 1412
86 Ga0070699_100001131 3300005518 Bacteria 24837
87 Ga0070699_100018143 3300005518 Bacteria 6046
88 Ga0070699_100222846 3300005518 Bacteria 1681
89 Ga0070684_100106298 3300005535 Bacteria 2512
90 Ga0070697_100066354 3300005536 Bacteria 2951
91 Ga0070697_100078630 3300005536 Bacteria 2714
92 Ga0070697_100400679 3300005536 Bacteria 1190
93 Ga0068853_100492213 3300005539 Bacteria 1157
94 Ga0070672_100003783 3300005543 Bacteria 9850
95 Ga0070672_100012052 3300005543 Bacteria 6051
96 Ga0070672_100175733 3300005543 Bacteria 1783
97 Ga0070672_100263379 3300005543 Unclassified 1454
98 Ga0070672_100485134 3300005543 Bacteria 1068
99 Ga0070686_100008654 3300005544 Bacteria 5703
100 Ga0070686_100163434 3300005544 Unclassified 1569
101 Ga0070686_100311432 3300005544 Bacteria 1171
102 Ga0070695_100127863 3300005545 Bacteria 1747
103 Ga0070695_100308859 3300005545 Bacteria 1172
104 Ga0070696_100074709 3300005546 Bacteria 2390
105 Ga0070696_100099591 3300005546 Bacteria 2080
106 Ga0070696_100448886 3300005546 Bacteria 1017
107 Ga0070693_100348245 3300005547 Unclassified 1013
108 Ga0070665_100001968 3300005548 Bacteria 23101
109 Ga0070665_100058920 3300005548 Bacteria 3849
110 Ga0070665_100227428 3300005548 Bacteria 1865
111 Ga0070704_100009477 3300005549 Bacteria 5885
112 Ga0070704_100063190 3300005549 Bacteria 2657
113 Ga0070704_100235676 3300005549 Unclassified 1495
114 Ga0068854_100001377 3300005578 Bacteria 14634
115 Ga0068854_100032562 3300005578 Bacteria 3628
116 Ga0068854_100266103 3300005578 Unclassified 1374
117 Ga0070702_100002450 3300005615 Bacteria 8013
118 Ga0070702_100063218 3300005615 Bacteria 2160
119 Ga0070702_100124859 3300005615 Bacteria 1617
120 Ga0068859_100076502 3300005617 Bacteria 3388
121 Ga0068859_100212581 3300005617 Unclassified 2021
122 Ga0068859_100256560 3300005617 Bacteria 1839
123 Ga0068859_100992900 3300005617 Bacteria 922
124 Ga0068864_100059159 3300005618 Bacteria 3315
125 Ga0068864_100186898 3300005618 Bacteria 1897
126 Ga0068864_100219742 3300005618 Bacteria 1753
127 Ga0068864_100262937 3300005618 Bacteria 1606
128 Ga0068866_10019886 3300005718 Bacteria 3066
129 Ga0068861_100008276 3300005719 Bacteria 7154
130 Ga0068861_100011523 3300005719 Bacteria 6150
131 Ga0068861_100014123 3300005719 Bacteria 5600
132 Ga0068861_100058810 3300005719 Bacteria 2941
133 Ga0068861_100649201 3300005719 Bacteria 974
134 Ga0068851_10005077 3300005834 Bacteria 5971
135 Ga0068851_10039262 3300005834 Bacteria 2377
136 Ga0068870_10028887 3300005840 Bacteria 2789
137 Ga0068870_10246758 3300005840 Bacteria 1105
138 Ga0068870_10304229 3300005840 Bacteria 1007
139 Ga0068863_100000867 3300005841 Bacteria 30266
140 Ga0068863_100441012 3300005841 Bacteria 1277
141 Ga0068863_100461825 3300005841 Unclassified 1247
142 Ga0068858_100013632 3300005842 Bacteria 7672
143 Ga0068858_100122908 3300005842 Bacteria 2429
144 Ga0068858_100175905 3300005842 Bacteria 2019
145 Ga0068858_100301332 3300005842 Bacteria 1529
146 Ga0068858_100521938 3300005842 Unclassified 1148
147 Ga0068860_100044254 3300005843 Bacteria 4243
148 Ga0068860_100207219 3300005843 Bacteria 1902
149 Ga0068860_100359842 3300005843 Bacteria 1433
150 Ga0068860_100388217 3300005843 Unclassified 1379
151 Ga0068860_100841820 3300005843 Bacteria 932
152 Ga0068862_100001070 3300005844 Bacteria 26230
153 Ga0068862_100151342 3300005844 Unclassified 2065
154 Ga0068862_100165554 3300005844 Bacteria 1976
155 Ga0068862_100170403 3300005844 Bacteria 1949
156 Ga0081455_10097859 3300005937 Bacteria 2363
157 Ga0081539_10000010 3300005985 Bacteria 484386
158 Ga0081539_10000065 3300005985 Bacteria 246571
159 Ga0097621_100000475 3300006237 Bacteria 28177
160 Ga0097621_100005930 3300006237 Bacteria 8634
161 Ga0097621_100018545 3300006237 Bacteria 5319
162 Ga0068871_100001753 3300006358 Bacteria 14628
163 Ga0068871_100012166 3300006358 Bacteria 6335
164 Ga0068871_100088804 3300006358 Bacteria 2572
165 Ga0068871_100271425 3300006358 Bacteria 1482
166 Ga0068871_100707117 3300006358 Bacteria 923
167 Ga0075428_100000005 3300006844 Bacteria 326130
168 Ga0075428_100042849 3300006844 Bacteria 4976
169 Ga0075428_100218826 3300006844 Bacteria 2057
170 Ga0075428_100490806 3300006844 Bacteria 1314
171 Ga0075430_100035081 3300006846 Bacteria 4258
172 Ga0075430_100093913 3300006846 Bacteria 2508
173 Ga0075430_100135853 3300006846 Bacteria 2049
174 Ga0075431_100131220 3300006847 Bacteria 2584
175 Ga0075431_100350291 3300006847 Bacteria 1485
176 Ga0075433_10048481 3300006852 Bacteria 3693
177 Ga0075433_10086852 3300006852 Bacteria 2762
178 Ga0075433_10230609 3300006852 Bacteria 1644
179 Ga0075433_10239715 3300006852 Bacteria 1610
180 Ga0075433_10420771 3300006852 Unclassified 1178
181 Ga0075434_100000085 3300006871 Bacteria 50753
182 Ga0075434_100016194 3300006871 Bacteria 7166
183 Ga0075434_100019913 3300006871 Bacteria 6498
184 Ga0075434_100032572 3300006871 Bacteria 5140
185 Ga0075434_100171390 3300006871 Bacteria 2190
186 Ga0075434_100339766 3300006871 Bacteria 1522
187 Ga0075434_100380624 3300006871 Unclassified 1432
188 Ga0075434_100674854 3300006871 Bacteria 1051
189 Ga0075429_100302313 3300006880 Bacteria 1401
190 Ga0068865_100015637 3300006881 Bacteria 4841
191 Ga0068865_100026477 3300006881 Bacteria 3824
192 Ga0068865_100172754 3300006881 Bacteria 1658
193 Ga0068865_100268246 3300006881 Bacteria 1354
194 Ga0075436_100005853 3300006914 Bacteria 8446
195 Ga0075436_100021104 3300006914 Bacteria 4469
196 Ga0075436_100036287 3300006914 Unclassified 3402
197 Ga0075436_100036357 3300006914 Bacteria 3399
198 Ga0075436_100039597 3300006914 Unclassified 3252
199 Ga0075436_100042599 3300006914 Bacteria 3131
200 Ga0097620_100063951 3300006931 Bacteria 3711
201 Ga0097620_100076504 3300006931 Bacteria 3388
202 Ga0097620_100212580 3300006931 Unclassified 2021
203 Ga0097620_100256533 3300006931 Bacteria 1839
204 Ga0097620_100992745 3300006931 Bacteria 922
205 Ga0075435_100000001 3300007076 Bacteria 207579
206 Ga0075435_100040282 3300007076 Bacteria 3730
207 Ga0075435_100045091 3300007076 Bacteria 3533
208 Ga0075435_100061492 3300007076 Bacteria 3047
209 Ga0075435_100071040 3300007076 Bacteria 2842
210 Ga0075435_100094246 3300007076 Bacteria 2474
211 Ga0075435_100104168 3300007076 Unclassified 2354
212 Ga0075435_100122881 3300007076 Unclassified 2167
213 Ga0075435_100150628 3300007076 Bacteria 1955
214 Ga0075435_100406432 3300007076 Bacteria 1171
215 Ga0099794_10168529 3300007265 Unclassified 1116
216 Ga0105240_10222535 3300009093 Bacteria 2198
217 Ga0105240_10603487 3300009093 Bacteria 1208
218 Ga0111539_10000008 3300009094 Bacteria 382609
219 Ga0111539_10004048 3300009094 Bacteria 19245
220 Ga0111539_10019249 3300009094 Bacteria 8431
221 Ga0111539_10051342 3300009094 Bacteria 4912
222 Ga0111539_10071142 3300009094 Bacteria 4105
223 Ga0111539_10395503 3300009094 Bacteria 1610
224 Ga0105245_10092208 3300009098 Bacteria 2789
225 Ga0105247_10084315 3300009101 Bacteria 2008
226 Ga0114129_10002348 3300009147 Bacteria 26266
227 Ga0114129_10007398 3300009147 Bacteria 15628
228 Ga0114129_10011978 3300009147 Bacteria 12336
229 Ga0114129_10019700 3300009147 Bacteria 9603
230 Ga0114129_10052703 3300009147 Bacteria 5710
231 Ga0114129_10132868 3300009147 Bacteria 3417
232 Ga0105243_10021764 3300009148 Bacteria 4869
233 Ga0105243_10040800 3300009148 Bacteria 3627
234 Ga0105243_10127454 3300009148 Unclassified 2155
235 Ga0105243_10310716 3300009148 Bacteria 1432
236 Ga0105243_10689806 3300009148 Bacteria 994
237 Ga0105242_10000986 3300009176 Bacteria 22256
238 Ga0105242_10012935 3300009176 Bacteria 6434
239 Ga0105242_10456614 3300009176 Bacteria 1205
240 Ga0105248_10007883 3300009177 Bacteria 11699
241 Ga0105248_10022182 3300009177 Bacteria 7039
242 Ga0105248_10115466 3300009177 Bacteria 3028
243 Ga0105248_10116465 3300009177 Unclassified 3014
244 Ga0105248_10257685 3300009177 Bacteria 1964
245 Ga0105248_10286025 3300009177 Bacteria 1856
246 Ga0105248_10323759 3300009177 Bacteria 1736
247 Ga0105248_10420341 3300009177 Bacteria 1505
248 Ga0105238_10002032 3300009551 Bacteria 20437
249 Ga0105249_10712546 3300009553 Unclassified 1064
250 Ga0105249_10855527 3300009553 Unclassified 975
251 Ga0105246_10023457 3300011119 Unclassified 3993
252 Ga0157374_10042160 3300013296 Bacteria 4209
253 Ga0157378_10256047 3300013297 Bacteria 1677
254 Ga0157378_10536534 3300013297 Bacteria 1173
255 Ga0157378_10572837 3300013297 Unclassified 1137
256 Ga0163162_10017597 3300013306 Bacteria 6993
257 Ga0163162_10269957 3300013306 Bacteria 1833
258 Ga0163162_10606165 3300013306 Bacteria 1221
259 Ga0163162_10949323 3300013306 Bacteria 971
260 Ga0157375_10028027 3300013308 Bacteria 5273
261 Ga0157375_10077978 3300013308 Bacteria 3345
262 Ga0157375_10427417 3300013308 Bacteria 1491
263 Ga0157375_10551139 3300013308 Bacteria 1315
264 Ga0157375_11004894 3300013308 Bacteria 974
265 Ga0163163_10020292 3300014325 Bacteria 6255
266 Ga0157380_10125208 3300014326 Bacteria 2183
267 Ga0157380_10179839 3300014326 Bacteria 1857
268 Ga0157380_10261357 3300014326 Bacteria 1573
269 Ga0157380_10434437 3300014326 Bacteria 1256
270 Ga0157380_10515722 3300014326 Unclassified 1165
271 Ga0157377_10049442 3300014745 Bacteria 2364
272 Ga0157377_10306215 3300014745 Unclassified 1050
273 Ga0157379_10053522 3300014968 Bacteria 3605
274 Ga0157379_10277280 3300014968 Bacteria 1525
275 Ga0157379_10308079 3300014968 Bacteria 1444
276 Ga0157376_10008351 3300014969 Bacteria 7469
277 Ga0157376_10080276 3300014969 Bacteria 2798
278 Ga0157376_10150414 3300014969 Bacteria 2099
279 Ga0157376_10491350 3300014969 Bacteria 1204
280 Ga0207656_10001898 3300025321 Bacteria 6955
281 Ga0207656_10076848 3300025321 Bacteria 1494
282 Ga0207682_10000468 3300025893 Bacteria 18679
283 Ga0207642_10006960 3300025899 Bacteria 3791
284 Ga0207642_10011739 3300025899 Bacteria 3137
285 Ga0207680_10024860 3300025903 Bacteria 3294
286 Ga0207680_10101708 3300025903 Bacteria 1848
287 Ga0207645_10001597 3300025907 Bacteria 18466
288 Ga0207645_10013540 3300025907 Bacteria 5492
289 Ga0207645_10014603 3300025907 Bacteria 5250
290 Ga0207645_10263596 3300025907 Bacteria 1142
291 Ga0207643_10078198 3300025908 Bacteria 1913
292 Ga0207643_10140511 3300025908 Bacteria 1442
293 Ga0207643_10271738 3300025908 Bacteria 1049
294 Ga0207695_10140791 3300025913 Bacteria 2361
295 Ga0207662_10012962 3300025918 Bacteria 4655
296 Ga0207662_10131375 3300025918 Bacteria 1579
297 Ga0207646_10071800 3300025922 Bacteria 3092
298 Ga0207646_10086101 3300025922 Bacteria 2811
299 Ga0207646_10087011 3300025922 Bacteria 2796
300 Ga0207646_10113341 3300025922 Bacteria 2434
301 Ga0207646_10183657 3300025922 Bacteria 1889
302 Ga0207646_10246550 3300025922 Archaea 1613
303 Ga0207681_10053851 3300025923 Bacteria 2733
304 Ga0207681_10055979 3300025923 Unclassified 2689
305 Ga0207681_10213913 3300025923 Bacteria 1487
306 Ga0207694_10002253 3300025924 Bacteria 15805
307 Ga0207650_10065493 3300025925 Unclassified 2723
308 Ga0207659_10014470 3300025926 Bacteria 5090
309 Ga0207659_10016387 3300025926 Bacteria 4822
310 Ga0207659_10023509 3300025926 Unclassified 4114
311 Ga0207659_10063154 3300025926 Bacteria 2676
312 Ga0207659_10210474 3300025926 Unclassified 1558
313 Ga0207659_10480657 3300025926 Bacteria 1049
314 Ga0207687_10064114 3300025927 Bacteria 2604
315 Ga0207687_10284713 3300025927 Unclassified 1326
316 Ga0207644_10061497 3300025931 Bacteria 2720
317 Ga0207644_10067088 3300025931 Bacteria 2614
318 Ga0207644_10131038 3300025931 Unclassified 1919
319 Ga0207644_10182044 3300025931 Unclassified 1647
320 Ga0207690_10121107 3300025932 Bacteria 1901
321 Ga0207706_10229385 3300025933 Bacteria 1625
322 Ga0207686_10001689 3300025934 Bacteria 12298
323 Ga0207686_10006510 3300025934 Bacteria 6289
324 Ga0207686_10026131 3300025934 Bacteria 3404
325 Ga0207686_10469938 3300025934 Unclassified 971
326 Ga0207709_10009230 3300025935 Bacteria 5433
327 Ga0207709_10010571 3300025935 Bacteria 5084
328 Ga0207670_10024523 3300025936 Bacteria 3771
329 Ga0207670_10085678 3300025936 Unclassified 2215
330 Ga0207670_10401438 3300025936 Unclassified 1096
331 Ga0207669_10039454 3300025937 Unclassified 2729
332 Ga0207669_10290740 3300025937 Unclassified 1237
333 Ga0207669_10572623 3300025937 Unclassified 914
334 Ga0207691_10011531 3300025940 Bacteria 8484
335 Ga0207691_10031406 3300025940 Bacteria 4958
336 Ga0207691_10062686 3300025940 Bacteria 3373
337 Ga0207691_10290352 3300025940 Bacteria 1406
338 Ga0207711_10043696 3300025941 Bacteria 3824
339 Ga0207711_10049104 3300025941 Bacteria 3612
340 Ga0207711_10068125 3300025941 Bacteria 3082
341 Ga0207711_10189450 3300025941 Bacteria 1874
342 Ga0207711_10205047 3300025941 Bacteria 1800
343 Ga0207711_10791833 3300025941 Unclassified 883
344 Ga0207689_10003136 3300025942 Bacteria 15170
345 Ga0207689_10064077 3300025942 Bacteria 3024
346 Ga0207689_10074071 3300025942 Unclassified 2798
347 Ga0207689_10092739 3300025942 Bacteria 2481
348 Ga0207661_10210869 3300025944 Bacteria 1712
349 Ga0207679_10286820 3300025945 Bacteria 1414
350 Ga0207651_10012622 3300025960 Bacteria 4791
351 Ga0207651_10121378 3300025960 Bacteria 1982
352 Ga0207651_10200089 3300025960 Bacteria 1600
353 Ga0207668_10208049 3300025972 Bacteria 1563
354 Ga0207640_10014442 3300025981 Bacteria 4548
355 Ga0207640_10023201 3300025981 Bacteria 3726
356 Ga0207640_10225664 3300025981 Bacteria 1437
357 Ga0207658_10149490 3300025986 Bacteria 1901
358 Ga0207658_10445248 3300025986 Bacteria 1146
359 Ga0207677_10051137 3300026023 Bacteria 2800
360 Ga0207677_10276395 3300026023 Bacteria 1376
361 Ga0207703_10008855 3300026035 Bacteria 7934
362 Ga0207703_10020141 3300026035 Bacteria 5214
363 Ga0207703_10068133 3300026035 Bacteria 2932
364 Ga0207703_10101954 3300026035 Bacteria 2434
365 Ga0207703_10326714 3300026035 Bacteria 1406
366 Ga0207703_10402979 3300026035 Bacteria 1270
367 Ga0207708_10031922 3300026075 Bacteria 4000
368 Ga0207708_10032985 3300026075 Bacteria 3932
369 Ga0207708_10052750 3300026075 Bacteria 3097
370 Ga0207708_10119059 3300026075 Bacteria 2057
371 Ga0207641_10002035 3300026088 Bacteria 19257
372 Ga0207641_10066190 3300026088 Bacteria 3093
373 Ga0207641_10117888 3300026088 Bacteria 2364
374 Ga0207641_10308336 3300026088 Bacteria 1497
375 Ga0207648_10004718 3300026089 Bacteria 13934
376 Ga0207648_10012593 3300026089 Bacteria 7915
377 Ga0207648_10018114 3300026089 Bacteria 6378
378 Ga0207676_10041156 3300026095 Bacteria 3545
379 Ga0207676_10089526 3300026095 Unclassified 2522
380 Ga0207676_10219259 3300026095 Bacteria 1693
381 Ga0207676_10380154 3300026095 Bacteria 1314
382 Ga0207674_10609485 3300026116 Bacteria 1055
383 Ga0207674_10686559 3300026116 Unclassified 988
384 Ga0207675_100009168 3300026118 Bacteria 9283
385 Ga0207675_100022494 3300026118 Bacteria 5870
386 Ga0207675_100024873 3300026118 Bacteria 5571
387 Ga0207675_100028975 3300026118 Bacteria 5159
388 Ga0207675_100080636 3300026118 Bacteria 3051
389 Ga0207675_100175434 3300026118 Bacteria 2050
390 Ga0207675_100240454 3300026118 Unclassified 1749
391 Ga0207683_10008172 3300026121 Bacteria 8954
392 Ga0207683_10010505 3300026121 Bacteria 7899
393 Ga0207683_10122309 3300026121 Bacteria 2337
394 Ga0207428_10000019 3300027907 Bacteria 276945
395 Ga0207428_10015801 3300027907 Bacteria 6514
396 Ga0207428_10050273 3300027907 Bacteria 3336
397 Ga0207428_10100278 3300027907 Bacteria 2238
398 Ga0207428_10119766 3300027907 Bacteria 2019
399 Ga0268266_10051966 3300028379 Bacteria 3518
400 Ga0268266_10119971 3300028379 Bacteria 2339
401 Ga0268265_10030759 3300028380 Bacteria 3870
402 Ga0268265_10048738 3300028380 Unclassified 3182
403 Ga0265318_10001209 3300028577 Bacteria 15697
404 Ga0265332_10075584 3300031238 Unclassified 1432
405 Ga0265325_10031983 3300031241 Unclassified 2813
406 Ga0265329_10000489 3300031242 Bacteria 20589
407 Ga0265340_10019643 3300031247 Bacteria 3479
408 Ga0265339_10014153 3300031249 Bacteria 4814
409 Ga0265331_10000522 3300031250 Bacteria 35513
410 Ga0265316_10033624 3300031344 Bacteria 4173
411 Ga0265313_10019809 3300031595 Unclassified 3732
412 Ga0265342_10002357 3300031712 Bacteria 16383
413 Ga0373930_0004662 3300034816 Bacteria 2244
414 Ga0373950_0001607 3300034818 Bacteria 2978
415 Ga0373958_0004340 3300034819 Bacteria 2095
416 Ga0373959_0003020 3300034820 Bacteria 2678
417 Ga0373938_0003112 3300034957 Bacteria 2694
418 Ga0373926_0039525 3300035083 Bacteria 1682
419 Ga0373929_0002131 3300035085 Bacteria 3682
420 Ga0373934_0005316 3300035086 Bacteria 4765
421 Ga0373949_0002401 3300035090 Bacteria 4831
422 Ga0373923_0012713 3300035111 Bacteria 3121
423 Ga0373932_0002174 3300035112 Bacteria 5069
424 Ga0373939_0000840 3300035114 Bacteria 7609
425 Ga0373939_0035392 3300035114 Bacteria 1471
426 Ga0373941_0001203 3300035115 Bacteria 5410
427 Ga0373945_0087693 3300035116 Bacteria 1201
428 Ga0373954_0012560 3300035118 Bacteria 3767
429 Ga0373954_0059633 3300035118 Bacteria 1799
430 Ga0373957_0042000 3300035120 Bacteria 1724
431 Ga0373957_0089680 3300035120 Unclassified 1221
432 Ga0373960_0002260 3300035121 Bacteria 4332
433 Ga0373943_0311196 3300035170 Unclassified 896
434 Ga0373946_0141447 3300035171 Unclassified 1116
435 Ga0373955_0063050 3300035172 Bacteria 2052
436 Ga0373942_0001622 3300035207 Bacteria 5750
437 Ga0373961_0001759 3300035241 Bacteria 6004
438 Ga0373962_0000256 3300035242 Bacteria 11349
439 Ga0373962_0025766 3300035242 Bacteria 1581
440 Ga0373931_0007020 3300035691 Bacteria 5298
441 Ga0373935_0003466 3300035692 Bacteria 9169
442 Ga0373935_0045892 3300035692 Bacteria 2758
443 Ga0373935_0086901 3300035692 Bacteria 2041
444 Ga0373927_0000770 3300035695 Bacteria 24549
445 Ga0373927_0032145 3300035695 Bacteria 3417
446 Ga0373927_0147002 3300035695 Bacteria 1543
447 Ga0373925_0058974 3300037068 Bacteria 2878
448 Ga0373925_0383181 3300037068 Bacteria 1145
449 Ga0436364_0941405 3300037853 Unclassified 4978
450 Ga0439450_004631 3300042008 Bacteria 2363
451 Ga0439435_0007124 3300042436 Bacteria 2544
452 Ga0451576_0013097 3300045051 Bacteria 9287
453 Ga0495592_0184270 3300046454 Bacteria 1419
454 Ga0495580_0204813 3300046472 Bacteria 1358
455 Ga0495608_0005522 3300046511 Bacteria 9031
456 Ga0495628_0010614 3300046516 Bacteria 7813
457 Ga0495630_0005592 3300046517 Bacteria 8876
458 Ga0495665_0025286 3300046531 Bacteria 3190
459 Ga0495640_0059994 3300046533 Bacteria 2589
460 Ga0495587_0039003 3300046536 Bacteria 2846
461 Ga0495621_0029173 3300046539 Bacteria 1880
462 Ga0495645_0014207 3300046543 Bacteria 5646
463 Ga0495645_0241936 3300046543 Bacteria 1204
464 Ga0495656_0222394 3300046615 Unclassified 944
465 Ga0495634_0063809 3300046642 Unclassified 2444
466 Ga0495635_0034820 3300046663 Bacteria 3493
467 Ga0495599_0199045 3300046678 Bacteria 1231
468 Ga0495658_0048013 3300046683 Bacteria 2406
469 Ga0495658_0056250 3300046683 Bacteria 2243
470 Ga0495613_0004627 3300046689 Bacteria 10329
471 Ga0495613_0091764 3300046689 Bacteria 2200
472 Ga0495613_0239952 3300046689 Bacteria 1268
473 Ga0495604_0175640 3300047317 Bacteria 1502
474 Ga0495674_0114131 3300047319 Bacteria 2287
475 Ga0495675_0008103 3300047444 Bacteria 6502
476 Ga0495675_0202959 3300047444 Bacteria 1206
477 Ga0495684_0001776 3300047471 Bacteria 17286
478 Ga0495684_0338121 3300047471 Bacteria 1072
479 Ga0496102_0455096 3300048905 Bacteria 1201
480 Ga0496108_0184527 3300048911 Bacteria 1807
481 Ga0496108_0388448 3300048911 Bacteria 1219
482 Ga0496109_0114833 3300048912 Bacteria 2505
483 Ga0496109_0252203 3300048912 Bacteria 1662
484 Ga0496109_0365767 3300048912 Unclassified 1362
485 Ga0496110_0368231 3300048913 Bacteria 1309
486 Ga0496112_0131595 3300048915 Bacteria 2473
487 Ga0496114_0200945 3300048917 Bacteria 1746
488 Ga0496114_0207229 3300048917 Unclassified 1719
489 Ga0501037_0177773 3300049573 Bacteria 1511
490 Ga0501039_0138801 3300049575 Bacteria 1909
491 Ga0501040_0114382 3300049576 Bacteria 1889
492 Ga0501042_0028518 3300049578 Bacteria 3934
493 Ga0501042_0056961 3300049578 Bacteria 2789
494 Ga0501042_0118857 3300049578 Bacteria 1903
495 Ga0501046_0344936 3300049580 Bacteria 1082
496 Ga0501048_0037652 3300049582 Bacteria 3474
497 Ga0501071_0052844 3300049587 Unclassified 2930
498 Ga0501071_0149900 3300049587 Bacteria 1739
499 Ga0501072_0184639 3300049588 Bacteria 1664
500 Ga0501075_0009220 3300049591 Bacteria 6899
501 Ga0501075_0018080 3300049591 Bacteria 5097
502 Ga0501075_0196842 3300049591 Unclassified 1537
503 Ga0501075_0209946 3300049591 Bacteria 1485
504 Ga0501076_0053107 3300049592 Bacteria 3211
505 Ga0501076_0122593 3300049592 Unclassified 2105
506 Ga0501081_0115606 3300049743 Bacteria 1907
507 Ga0501045_0022749 3300049824 Bacteria 4489
508 Ga0501045_0149199 3300049824 Bacteria 1739
509 Ga0501045_0291076 3300049824 Bacteria 1215
510 nmdc:mga07m45_384433_c1 3300050496 Bacteria 815
511 nmdc:mga05p37_14243_c1 3300050507 Bacteria 9550
512 nmdc:mga05p37_144698_c1 3300050507 Bacteria 2911
513 nmdc:mga05p37_18799_c1 3300050507 Bacteria 8352
514 nmdc:mga05p37_19457_c1 3300050507 Bacteria 8213
515 nmdc:mga05p37_453410_c1 3300050507 Bacteria 1484
516 nmdc:mga05p37_555784_c1 3300050507 Unclassified 1305
517 nmdc:mga05p37_695947_c1 3300050507 Bacteria 1130
518 nmdc:mga05p37_86835_c1 3300050507 Bacteria 3856
519 nmdc:mga09592_504124_c1 3300050508 Bacteria 1042
520 nmdc:mga0qj67_107485_c1 3300050509 Bacteria 2251
521 nmdc:mga0qj67_66758_c1 3300050509 Bacteria 2865
522 nmdc:mga0qj67_86422_c2 3300050509 Bacteria 2070
523 nmdc:mga06r32_137930_c1 3300050510 Bacteria 2414
524 nmdc:mga08y16_179020_c1 3300050511 Bacteria 2202
525 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
526 nmdc:mga08y16_233334_c1 3300050511 Bacteria 1903
527 nmdc:mga08y16_38502_c1 3300050511 Bacteria 5021
528 nmdc:mga08y16_618090_c1 3300050511 Bacteria 1091
529 nmdc:mga0n895_142520_c1 3300050512 Bacteria 2425
530 nmdc:mga0n895_14572_c1 3300050512 Bacteria 7145
531 nmdc:mga0n895_185630_c1 3300050512 Unclassified 2110
532 nmdc:mga0n895_240094_c1 3300050512 Bacteria 1839
533 nmdc:mga0n895_49_c1 3300050512 Bacteria 73512
534 nmdc:mga0n895_62004_c1 3300050512 Bacteria 3694
535 nmdc:mga0n895_8388_c1 3300050512 Bacteria 8946
536 nmdc:mga0n895_98840_c1 3300050512 Bacteria 2926
537 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
538 nmdc:mga0rr50_133677_c1 3300050513 Bacteria 1989
539 nmdc:mga0rr50_21355_c1 3300050513 Bacteria 4418
540 nmdc:mga0rr50_269824_c1 3300050513 Bacteria 1418
541 nmdc:mga0rr50_31602_c1 3300050513 Bacteria 3763
542 nmdc:mga0rr50_419204_c1 3300050513 Bacteria 1132
543 nmdc:mga0rr50_4194_c1 3300050513 Bacteria 8432
544 nmdc:mga0rr50_51729_c1 3300050513 Bacteria 3050
545 nmdc:mga0rr50_97846_c1 3300050513 Bacteria 2299
546 nmdc:mga08x19_1194_c1 3300050514 Bacteria 16237
547 nmdc:mga08x19_168493_c1 3300050514 Bacteria 1491
548 nmdc:mga08x19_30094_c1 3300050514 Bacteria 3409
549 nmdc:mga08x19_42468_c1 3300050514 Unclassified 2899
550 nmdc:mga08x19_42545_c1 3300050514 Bacteria 2897
551 nmdc:mga08x19_435_c1 3300050514 Bacteria 28614
552 nmdc:mga0a205_129284_c1 3300050515 Bacteria 2426
553 nmdc:mga0a205_17651_c1 3300050515 Bacteria 6698
554 nmdc:mga0a205_456473_c1 3300050515 Unclassified 1137
555 nmdc:mga0a205_569718_c1 3300050515 Bacteria 987
556 nmdc:mga0a205_62856_c1 3300050515 Bacteria 3587
557 nmdc:mga0a205_64119_c1 3300050515 Unclassified 3549
558 Ga0495601_0004666 3300053077 Bacteria 7932
559 Ga0495612_0003287 3300053078 Bacteria 6704
560 Ga0495595_0032994 3300053084 Bacteria 2334
561 Ga0495619_0001563 3300053085 Bacteria 15064
562 Ga0495619_0199518 3300053085 Bacteria 1385
563 Ga0501084_0069665 3300054114 Unclassified 2945
564 Ga0501082_0041535 3300060353 Bacteria 3966
565 Ga0501082_0555223 3300060353 Bacteria 1004
566 Ga0530510_0120741 3300061734 Bacteria 1924
567 Ga0530510_0156055 3300061734 Bacteria 1687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_555784_c1 nmdc:mga05p37_555784_c1_31_699 221
2 3300054114 Ga0501084_0069665 Ga0501084_0069665_875_1642 235
3 3300006931 Ga0097620_100992745 Ga0097620_1009927452 238
4 3300009177 Ga0105248_10115466 Ga0105248_101154662 238
5 3300025941 Ga0207711_10043696 Ga0207711_100436962 238
6 3300005356 Ga0070674_100377939 Ga0070674_1003779392 239
7 3300005719 Ga0068861_100011523 Ga0068861_1000115238 239
8 3300005844 Ga0068862_100165554 Ga0068862_1001655542 239
9 3300009553 Ga0105249_10712546 Ga0105249_107125462 239
10 3300025899 Ga0207642_10006960 Ga0207642_100069603 239
11 3300026118 Ga0207675_100009168 Ga0207675_1000091688 239
12 3300009148 Ga0105243_10040800 Ga0105243_100408003 240
13 3300014745 Ga0157377_10049442 Ga0157377_100494422 240
14 3300005841 Ga0068863_100441012 Ga0068863_1004410122 241
15 3300026088 Ga0207641_10308336 Ga0207641_103083362 241
16 3300026023 Ga0207677_10276395 Ga0207677_102763952 243
17 3300005440 Ga0070705_100020338 Ga0070705_1000203382 244
18 3300005545 Ga0070695_100308859 Ga0070695_1003088591 244
19 3300005549 Ga0070704_100063190 Ga0070704_1000631902 244
20 3300046454 Ga0495592_0184270 Ga0495592_0184270_657_1403 244
21 3300046543 Ga0495645_0241936 Ga0495645_0241936_399_1145 244
22 3300050496 nmdc:mga07m45_384433_c1 nmdc:mga07m45_384433_c1_26_769 244
23 3300005328 Ga0070676_10066716 Ga0070676_100667162 245
24 3300005330 Ga0070690_100002407 Ga0070690_1000024075 245
25 3300005333 Ga0070677_10012269 Ga0070677_100122692 245
26 3300005354 Ga0070675_100015575 Ga0070675_1000155753 245
27 3300005438 Ga0070701_10032273 Ga0070701_100322732 245
28 3300005459 Ga0068867_100003832 Ga0068867_1000038324 245
29 3300005543 Ga0070672_100003783 Ga0070672_1000037839 245
30 3300005718 Ga0068866_10019886 Ga0068866_100198862 245
31 3300005719 Ga0068861_100649201 Ga0068861_1006492012 245
32 3300005842 Ga0068858_100175905 Ga0068858_1001759052 245
33 3300005843 Ga0068860_100044254 Ga0068860_1000442542 245
34 3300006871 Ga0075434_100000085 Ga0075434_10000008521 245
35 3300006881 Ga0068865_100026477 Ga0068865_1000264773 245
36 3300006914 Ga0075436_100036357 Ga0075436_1000363573 245
37 3300007076 Ga0075435_100000001 Ga0075435_10000000112 245
38 3300025899 Ga0207642_10011739 Ga0207642_100117393 245
39 3300025907 Ga0207645_10013540 Ga0207645_100135406 245
40 3300025927 Ga0207687_10064114 Ga0207687_100641142 245
41 3300025934 Ga0207686_10026131 Ga0207686_100261312 245
42 3300025935 Ga0207709_10010571 Ga0207709_100105713 245
43 3300025942 Ga0207689_10003136 Ga0207689_1000313612 245
44 3300025981 Ga0207640_10014442 Ga0207640_100144423 245
45 3300025986 Ga0207658_10445248 Ga0207658_104452482 245
46 3300026035 Ga0207703_10068133 Ga0207703_100681332 245
47 3300026088 Ga0207641_10066190 Ga0207641_100661902 245
48 3300026089 Ga0207648_10004718 Ga0207648_100047186 245
49 3300037853 Ga0436364_0941405 Ga0436364_0941405_1885_2631 245
50 3300050512 nmdc:mga0n895_142520_c1 nmdc:mga0n895_142520_c1_559_1350 245
51 3300050512 nmdc:mga0n895_49_c1 nmdc:mga0n895_49_c1_65740_66513 245
52 3300050513 nmdc:mga0rr50_11_c1 nmdc:mga0rr50_11_c1_200707_201480 245
53 3300050513 nmdc:mga0rr50_21355_c1 nmdc:mga0rr50_21355_c1_3070_3882 245
54 3300050513 nmdc:mga0rr50_419204_c1 nmdc:mga0rr50_419204_c1_58_849 245
55 3300050514 nmdc:mga08x19_435_c1 nmdc:mga08x19_435_c1_22030_22803 245
56 3300050515 nmdc:mga0a205_17651_c1 nmdc:mga0a205_17651_c1_29_820 245
57 3300050515 nmdc:mga0a205_456473_c1 nmdc:mga0a205_456473_c1_92_841 245
58 3300005340 Ga0070689_100744448 Ga0070689_1007444481 246
59 3300005467 Ga0070706_100180286 Ga0070706_1001802863 246
60 3300005841 Ga0068863_100000867 Ga0068863_10000086732 246
61 3300006358 Ga0068871_100271425 Ga0068871_1002714252 246
62 3300006871 Ga0075434_100032572 Ga0075434_1000325724 246
63 3300026088 Ga0207641_10002035 Ga0207641_1000203518 246
64 3300035086 Ga0373934_0005316 Ga0373934_0005316_2583_3329 246
65 3300035111 Ga0373923_0012713 Ga0373923_0012713_1675_2421 246
66 3300035118 Ga0373954_0012560 Ga0373954_0012560_1988_2734 246
67 3300035120 Ga0373957_0089680 Ga0373957_0089680_95_841 246
68 3300035170 Ga0373943_0311196 Ga0373943_0311196_92_838 246
69 3300035172 Ga0373955_0063050 Ga0373955_0063050_22_768 246
70 3300035242 Ga0373962_0025766 Ga0373962_0025766_495_1298 246
71 3300035692 Ga0373935_0086901 Ga0373935_0086901_603_1349 246
72 3300035695 Ga0373927_0032145 Ga0373927_0032145_2487_3233 246
73 3300037068 Ga0373925_0058974 Ga0373925_0058974_1948_2694 246
74 3300046472 Ga0495580_0204813 Ga0495580_0204813_272_1018 246
75 3300046531 Ga0495665_0025286 Ga0495665_0025286_191_937 246
76 3300047444 Ga0495675_0202959 Ga0495675_0202959_177_923 246
77 3300048905 Ga0496102_0455096 Ga0496102_0455096_15_755 246
78 3300050512 nmdc:mga0n895_8388_c1 nmdc:mga0n895_8388_c1_6891_7694 246
79 3300005354 Ga0070675_100021857 Ga0070675_1000218572 247
80 3300005546 Ga0070696_100448886 Ga0070696_1004488862 247
81 3300005937 Ga0081455_10097859 Ga0081455_100978592 247
82 3300006844 Ga0075428_100000005 Ga0075428_100000005163 247
83 3300006846 Ga0075430_100135853 Ga0075430_1001358532 247
84 3300006847 Ga0075431_100131220 Ga0075431_1001312202 247
85 3300009094 Ga0111539_10000008 Ga0111539_10000008148 247
86 3300009147 Ga0114129_10019700 Ga0114129_100197004 247
87 3300009177 Ga0105248_10323759 Ga0105248_103237592 247
88 3300013297 Ga0157378_10572837 Ga0157378_105728371 247
89 3300014326 Ga0157380_10434437 Ga0157380_104344372 247
90 3300014969 Ga0157376_10491350 Ga0157376_104913501 247
91 3300025923 Ga0207681_10055979 Ga0207681_100559793 247
92 3300027907 Ga0207428_10000019 Ga0207428_10000019146 247
93 3300035120 Ga0373957_0042000 Ga0373957_0042000_192_980 247
94 3300046539 Ga0495621_0029173 Ga0495621_0029173_948_1694 247
95 3300046543 Ga0495645_0014207 Ga0495645_0014207_991_1779 247
96 3300046678 Ga0495599_0199045 Ga0495599_0199045_350_1138 247
97 3300046689 Ga0495613_0239952 Ga0495613_0239952_424_1212 247
98 3300047319 Ga0495674_0114131 Ga0495674_0114131_1313_2101 247
99 3300047471 Ga0495684_0338121 Ga0495684_0338121_115_903 247
100 3300048915 Ga0496112_0131595 Ga0496112_0131595_935_1690 247
101 3300050507 nmdc:mga05p37_18799_c1 nmdc:mga05p37_18799_c1_5230_6003 247
102 3300050509 nmdc:mga0qj67_86422_c2 nmdc:mga0qj67_86422_c2_118_888 247
103 3300050511 nmdc:mga08y16_17_c1 nmdc:mga08y16_17_c1_173070_173840 247
104 3300005719 Ga0068861_100058810 Ga0068861_1000588102 248
105 3300006237 Ga0097621_100005930 Ga0097621_1000059302 248
106 3300006880 Ga0075429_100302313 Ga0075429_1003023132 248
107 3300009094 Ga0111539_10395503 Ga0111539_103955033 248
108 3300014969 Ga0157376_10080276 Ga0157376_100802762 248
109 3300026118 Ga0207675_100080636 Ga0207675_1000806362 248
110 3300027907 Ga0207428_10119766 Ga0207428_101197662 248
111 3300035083 Ga0373926_0039525 Ga0373926_0039525_884_1651 248
112 3300035114 Ga0373939_0035392 Ga0373939_0035392_38_787 248
113 3300035116 Ga0373945_0087693 Ga0373945_0087693_339_1106 248
114 3300035118 Ga0373954_0059633 Ga0373954_0059633_389_1156 248
115 3300035692 Ga0373935_0003466 Ga0373935_0003466_6162_6929 248
116 3300035695 Ga0373927_0147002 Ga0373927_0147002_410_1177 248
117 3300037068 Ga0373925_0383181 Ga0373925_0383181_346_1113 248
118 3300046689 Ga0495613_0091764 Ga0495613_0091764_828_1595 248
119 3300005843 Ga0068860_100388217 Ga0068860_1003882172 249
120 3300006852 Ga0075433_10048481 Ga0075433_100484814 249
121 3300006852 Ga0075433_10230609 Ga0075433_102306092 249
122 3300006852 Ga0075433_10420771 Ga0075433_104207712 249
123 3300006871 Ga0075434_100016194 Ga0075434_1000161944 249
124 3300007076 Ga0075435_100071040 Ga0075435_1000710402 249
125 3300013306 Ga0163162_10269957 Ga0163162_102699572 249
126 3300013308 Ga0157375_10077978 Ga0157375_100779783 249
127 3300014326 Ga0157380_10179839 Ga0157380_101798392 249
128 3300014968 Ga0157379_10308079 Ga0157379_103080792 249
129 3300026075 Ga0207708_10032985 Ga0207708_100329852 249
130 3300046511 Ga0495608_0005522 Ga0495608_0005522_1035_1802 249
131 3300046516 Ga0495628_0010614 Ga0495628_0010614_2884_3651 249
132 3300046517 Ga0495630_0005592 Ga0495630_0005592_6598_7365 249
133 3300046536 Ga0495587_0039003 Ga0495587_0039003_377_1144 249
134 3300046642 Ga0495634_0063809 Ga0495634_0063809_1016_1783 249
135 3300046683 Ga0495658_0048013 Ga0495658_0048013_1397_2164 249
136 3300046689 Ga0495613_0004627 Ga0495613_0004627_1675_2442 249
137 3300047317 Ga0495604_0175640 Ga0495604_0175640_525_1292 249
138 3300047471 Ga0495684_0001776 Ga0495684_0001776_2353_3120 249
139 3300048911 Ga0496108_0184527 Ga0496108_0184527_359_1132 249
140 3300050512 nmdc:mga0n895_14572_c1 nmdc:mga0n895_14572_c1_5921_6688 249
141 3300050515 nmdc:mga0a205_62856_c1 nmdc:mga0a205_62856_c1_1370_2137 249
142 3300053077 Ga0495601_0004666 Ga0495601_0004666_3227_3994 249
143 3300053084 Ga0495595_0032994 Ga0495595_0032994_1076_1843 249
144 3300053085 Ga0495619_0001563 Ga0495619_0001563_14114_14881 249
145 3300005328 Ga0070676_10179290 Ga0070676_101792902 250
146 3300005539 Ga0068853_100492213 Ga0068853_1004922132 250
147 3300005719 Ga0068861_100008276 Ga0068861_1000082766 250
148 3300005843 Ga0068860_100359842 Ga0068860_1003598422 250
149 3300005844 Ga0068862_100170403 Ga0068862_1001704032 250
150 3300006871 Ga0075434_100171390 Ga0075434_1001713902 250
151 3300006914 Ga0075436_100036287 Ga0075436_1000362873 250
152 3300007076 Ga0075435_100045091 Ga0075435_1000450914 250
153 3300007265 Ga0099794_10168529 Ga0099794_101685291 250
154 3300009093 Ga0105240_10222535 Ga0105240_102225352 250
155 3300009098 Ga0105245_10092208 Ga0105245_100922082 250
156 3300009148 Ga0105243_10127454 Ga0105243_101274542 250
157 3300009176 Ga0105242_10456614 Ga0105242_104566142 250
158 3300009177 Ga0105248_10022182 Ga0105248_100221823 250
159 3300013297 Ga0157378_10256047 Ga0157378_102560472 250
160 3300025913 Ga0207695_10140791 Ga0207695_101407912 250
161 3300025941 Ga0207711_10068125 Ga0207711_100681253 250
162 3300026118 Ga0207675_100022494 Ga0207675_1000224944 250
163 3300034816 Ga0373930_0004662 Ga0373930_0004662_170_955 250
164 3300034818 Ga0373950_0001607 Ga0373950_0001607_2096_2881 250
165 3300034819 Ga0373958_0004340 Ga0373958_0004340_835_1620 250
166 3300034820 Ga0373959_0003020 Ga0373959_0003020_1724_2509 250
167 3300034957 Ga0373938_0003112 Ga0373938_0003112_255_1040 250
168 3300035085 Ga0373929_0002131 Ga0373929_0002131_42_827 250
169 3300035090 Ga0373949_0002401 Ga0373949_0002401_2616_3401 250
170 3300035112 Ga0373932_0002174 Ga0373932_0002174_2597_3382 250
171 3300035114 Ga0373939_0000840 Ga0373939_0000840_4210_4995 250
172 3300035115 Ga0373941_0001203 Ga0373941_0001203_4426_5211 250
173 3300035121 Ga0373960_0002260 Ga0373960_0002260_61_846 250
174 3300035207 Ga0373942_0001622 Ga0373942_0001622_697_1482 250
175 3300035241 Ga0373961_0001759 Ga0373961_0001759_2364_3149 250
176 3300035242 Ga0373962_0000256 Ga0373962_0000256_4060_4845 250
177 3300035691 Ga0373931_0007020 Ga0373931_0007020_2727_3512 250
178 3300045051 Ga0451576_0013097 Ga0451576_0013097_7674_8459 250
179 3300048912 Ga0496109_0252203 Ga0496109_0252203_339_1091 250
180 3300050507 nmdc:mga05p37_19457_c1 nmdc:mga05p37_19457_c1_3116_3868 250
181 3300050512 nmdc:mga0n895_240094_c1 nmdc:mga0n895_240094_c1_726_1478 250
182 3300050513 nmdc:mga0rr50_51729_c1 nmdc:mga0rr50_51729_c1_606_1358 250
183 3300050514 nmdc:mga08x19_42545_c1 nmdc:mga08x19_42545_c1_60_812 250
184 3300005330 Ga0070690_100019539 Ga0070690_1000195392 251
185 3300005335 Ga0070666_10008205 Ga0070666_100082054 251
186 3300005343 Ga0070687_100048916 Ga0070687_1000489162 251
187 3300005366 Ga0070659_100193545 Ga0070659_1001935452 251
188 3300005535 Ga0070684_100106298 Ga0070684_1001062981 251
189 3300005544 Ga0070686_100008654 Ga0070686_1000086543 251
190 3300005547 Ga0070693_100348245 Ga0070693_1003482451 251
191 3300005578 Ga0068854_100001377 Ga0068854_1000013773 251
192 3300006871 Ga0075434_100380624 Ga0075434_1003806242 251
193 3300007076 Ga0075435_100104168 Ga0075435_1001041682 251
194 3300007076 Ga0075435_100406432 Ga0075435_1004064322 251
195 3300009094 Ga0111539_10051342 Ga0111539_100513423 251
196 3300009147 Ga0114129_10002348 Ga0114129_100023489 251
197 3300025903 Ga0207680_10024860 Ga0207680_100248602 251
198 3300025907 Ga0207645_10263596 Ga0207645_102635961 251
199 3300025918 Ga0207662_10012962 Ga0207662_100129622 251
200 3300025932 Ga0207690_10121107 Ga0207690_101211072 251
201 3300025944 Ga0207661_10210869 Ga0207661_102108692 251
202 3300025981 Ga0207640_10023201 Ga0207640_100232012 251
203 3300049578 Ga0501042_0056961 Ga0501042_0056961_938_1738 251
204 3300049587 Ga0501071_0149900 Ga0501071_0149900_217_1017 251
205 3300049591 Ga0501075_0196842 Ga0501075_0196842_112_912 251
206 3300049824 Ga0501045_0291076 Ga0501045_0291076_168_968 251
207 3300050507 nmdc:mga05p37_14243_c1 nmdc:mga05p37_14243_c1_2356_3126 251
208 3300050507 nmdc:mga05p37_695947_c1 nmdc:mga05p37_695947_c1_220_978 251
209 3300050511 nmdc:mga08y16_38502_c1 nmdc:mga08y16_38502_c1_1743_2498 251
210 3300050515 nmdc:mga0a205_129284_c1 nmdc:mga0a205_129284_c1_782_1537 251
211 3300050515 nmdc:mga0a205_569718_c1 nmdc:mga0a205_569718_c1_161_931 251
212 3300061734 Ga0530510_0120741 Ga0530510_0120741_870_1670 251
213 3300005355 Ga0070671_100018780 Ga0070671_1000187802 252
214 3300005467 Ga0070706_100261578 Ga0070706_1002615782 252
215 3300005468 Ga0070707_100360716 Ga0070707_1003607161 252
216 3300005518 Ga0070699_100001131 Ga0070699_10000113118 252
217 3300005543 Ga0070672_100485134 Ga0070672_1004851342 252
218 3300006871 Ga0075434_100674854 Ga0075434_1006748541 252
219 3300006914 Ga0075436_100005853 Ga0075436_1000058533 252
220 3300007076 Ga0075435_100061492 Ga0075435_1000614922 252
221 3300009094 Ga0111539_10071142 Ga0111539_100711424 252
222 3300009147 Ga0114129_10052703 Ga0114129_100527031 252
223 3300009177 Ga0105248_10286025 Ga0105248_102860251 252
224 3300025922 Ga0207646_10113341 Ga0207646_101133412 252
225 3300025931 Ga0207644_10182044 Ga0207644_101820442 252
226 3300025940 Ga0207691_10290352 Ga0207691_102903522 252
227 3300025960 Ga0207651_10012622 Ga0207651_100126221 252
228 3300026118 Ga0207675_100028975 Ga0207675_1000289755 252
229 3300027907 Ga0207428_10100278 Ga0207428_101002782 252
230 3300028577 Ga0265318_10001209 Ga0265318_100012092 252
231 3300031241 Ga0265325_10031983 Ga0265325_100319832 252
232 3300031242 Ga0265329_10000489 Ga0265329_1000048911 252
233 3300031247 Ga0265340_10019643 Ga0265340_100196432 252
234 3300031249 Ga0265339_10014153 Ga0265339_100141533 252
235 3300031250 Ga0265331_10000522 Ga0265331_1000052218 252
236 3300031344 Ga0265316_10033624 Ga0265316_100336242 252
237 3300031595 Ga0265313_10019809 Ga0265313_100198094 252
238 3300031712 Ga0265342_10002357 Ga0265342_100023572 252
239 3300050511 nmdc:mga08y16_233334_c1 nmdc:mga08y16_233334_c1_554_1312 252
240 3300050513 nmdc:mga0rr50_269824_c1 nmdc:mga0rr50_269824_c1_269_1048 252
241 3300050514 nmdc:mga08x19_30094_c1 nmdc:mga08x19_30094_c1_911_1690 252
242 3300005328 Ga0070676_10038479 Ga0070676_100384792 253
243 3300005341 Ga0070691_10014870 Ga0070691_100148701 253
244 3300005353 Ga0070669_100177705 Ga0070669_1001777051 253
245 3300005364 Ga0070673_100097744 Ga0070673_1000977442 253
246 3300005406 Ga0070703_10087903 Ga0070703_100879031 253
247 3300005438 Ga0070701_10003349 Ga0070701_100033492 253
248 3300005440 Ga0070705_100014630 Ga0070705_1000146302 253
249 3300005444 Ga0070694_100100102 Ga0070694_1001001022 253
250 3300005444 Ga0070694_100394216 Ga0070694_1003942161 253
251 3300005459 Ga0068867_100001682 Ga0068867_1000016826 253
252 3300005536 Ga0070697_100400679 Ga0070697_1004006791 253
253 3300005543 Ga0070672_100012052 Ga0070672_1000120522 253
254 3300005544 Ga0070686_100311432 Ga0070686_1003114322 253
255 3300005545 Ga0070695_100127863 Ga0070695_1001278632 253
256 3300005546 Ga0070696_100099591 Ga0070696_1000995911 253
257 3300005549 Ga0070704_100009477 Ga0070704_1000094771 253
258 3300005578 Ga0068854_100032562 Ga0068854_1000325626 253
259 3300005615 Ga0070702_100002450 Ga0070702_1000024508 253
260 3300005617 Ga0068859_100992900 Ga0068859_1009929001 253
261 3300005719 Ga0068861_100014123 Ga0068861_1000141232 253
262 3300005843 Ga0068860_100841820 Ga0068860_1008418201 253
263 3300006881 Ga0068865_100268246 Ga0068865_1002682462 253
264 3300009101 Ga0105247_10084315 Ga0105247_100843152 253
265 3300014326 Ga0157380_10515722 Ga0157380_105157222 253
266 3300025907 Ga0207645_10001597 Ga0207645_1000159719 253
267 3300025922 Ga0207646_10087011 Ga0207646_100870114 253
268 3300025931 Ga0207644_10067088 Ga0207644_100670882 253
269 3300025941 Ga0207711_10049104 Ga0207711_100491042 253
270 3300025942 Ga0207689_10064077 Ga0207689_100640771 253
271 3300025981 Ga0207640_10225664 Ga0207640_102256641 253
272 3300026075 Ga0207708_10052750 Ga0207708_100527504 253
273 3300026088 Ga0207641_10117888 Ga0207641_101178882 253
274 3300026089 Ga0207648_10018114 Ga0207648_100181142 253
275 3300026118 Ga0207675_100024873 Ga0207675_1000248733 253
276 3300031238 Ga0265332_10075584 Ga0265332_100755842 253
277 3300042008 Ga0439450_004631 Ga0439450_004631_166_957 253
278 3300050512 nmdc:mga0n895_62004_c1 nmdc:mga0n895_62004_c1_1936_2697 253
279 3300050513 nmdc:mga0rr50_31602_c1 nmdc:mga0rr50_31602_c1_1067_1828 253
280 3300050514 nmdc:mga08x19_1194_c1 nmdc:mga08x19_1194_c1_2237_2998 253
281 3300005290 Ga0065712_10085559 Ga0065712_100855592 254
282 3300005331 Ga0070670_100026806 Ga0070670_1000268063 254
283 3300005340 Ga0070689_100013955 Ga0070689_1000139553 254
284 3300005354 Ga0070675_100000928 Ga0070675_10000092812 254
285 3300005354 Ga0070675_100296410 Ga0070675_1002964101 254
286 3300005355 Ga0070671_100006676 Ga0070671_1000066762 254
287 3300005355 Ga0070671_100275387 Ga0070671_1002753872 254
288 3300005356 Ga0070674_100004335 Ga0070674_1000043353 254
289 3300005356 Ga0070674_100037580 Ga0070674_1000375803 254
290 3300005365 Ga0070688_100037082 Ga0070688_1000370824 254
291 3300005457 Ga0070662_100307115 Ga0070662_1003071152 254
292 3300005536 Ga0070697_100066354 Ga0070697_1000663542 254
293 3300005617 Ga0068859_100256560 Ga0068859_1002565602 254
294 3300005618 Ga0068864_100262937 Ga0068864_1002629371 254
295 3300005841 Ga0068863_100461825 Ga0068863_1004618251 254
296 3300005842 Ga0068858_100301332 Ga0068858_1003013322 254
297 3300006871 Ga0075434_100339766 Ga0075434_1003397662 254
298 3300006914 Ga0075436_100021104 Ga0075436_1000211043 254
299 3300006914 Ga0075436_100039597 Ga0075436_1000395973 254
300 3300006931 Ga0097620_100256533 Ga0097620_1002565332 254
301 3300007076 Ga0075435_100094246 Ga0075435_1000942461 254
302 3300007076 Ga0075435_100122881 Ga0075435_1001228812 254
303 3300009177 Ga0105248_10116465 Ga0105248_101164652 254
304 3300013306 Ga0163162_10949323 Ga0163162_109493232 254
305 3300013308 Ga0157375_11004894 Ga0157375_110048942 254
306 3300025922 Ga0207646_10246550 Ga0207646_102465502 254
307 3300025925 Ga0207650_10065493 Ga0207650_100654933 254
308 3300025931 Ga0207644_10131038 Ga0207644_101310382 254
309 3300025933 Ga0207706_10229385 Ga0207706_102293853 254
310 3300025936 Ga0207670_10401438 Ga0207670_104014381 254
311 3300025937 Ga0207669_10039454 Ga0207669_100394542 254
312 3300025941 Ga0207711_10791833 Ga0207711_107918331 254
313 3300026035 Ga0207703_10326714 Ga0207703_103267142 254
314 3300026095 Ga0207676_10089526 Ga0207676_100895262 254
315 3300035692 Ga0373935_0045892 Ga0373935_0045892_847_1650 254
316 3300035695 Ga0373927_0000770 Ga0373927_0000770_6440_7243 254
317 3300047444 Ga0495675_0008103 Ga0495675_0008103_4855_5658 254
318 3300048911 Ga0496108_0388448 Ga0496108_0388448_286_1068 254
319 3300048913 Ga0496110_0368231 Ga0496110_0368231_183_965 254
320 3300050512 nmdc:mga0n895_98840_c1 nmdc:mga0n895_98840_c1_606_1388 254
321 3300050513 nmdc:mga0rr50_133677_c1 nmdc:mga0rr50_133677_c1_1142_1924 254
322 3300050513 nmdc:mga0rr50_97846_c1 nmdc:mga0rr50_97846_c1_963_1745 254
323 3300050514 nmdc:mga08x19_168493_c1 nmdc:mga08x19_168493_c1_595_1377 254
324 3300050514 nmdc:mga08x19_42468_c1 nmdc:mga08x19_42468_c1_241_1023 254
325 3300053078 Ga0495612_0003287 Ga0495612_0003287_5051_5854 254
326 3300005293 Ga0065715_10113521 Ga0065715_101135211 255
327 3300005347 Ga0070668_100169588 Ga0070668_1001695882 255
328 3300005353 Ga0070669_100010525 Ga0070669_1000105252 255
329 3300005445 Ga0070708_100432648 Ga0070708_1004326482 255
330 3300005457 Ga0070662_100053997 Ga0070662_1000539972 255
331 3300005844 Ga0068862_100001070 Ga0068862_10000107022 255
332 3300006358 Ga0068871_100707117 Ga0068871_1007071172 255
333 3300006844 Ga0075428_100042849 Ga0075428_1000428492 255
334 3300006871 Ga0075434_100019913 Ga0075434_1000199134 255
335 3300007076 Ga0075435_100150628 Ga0075435_1001506282 255
336 3300009094 Ga0111539_10019249 Ga0111539_100192497 255
337 3300009147 Ga0114129_10011978 Ga0114129_1001197812 255
338 3300014326 Ga0157380_10261357 Ga0157380_102613571 255
339 3300014968 Ga0157379_10277280 Ga0157379_102772801 255
340 3300014969 Ga0157376_10150414 Ga0157376_101504142 255
341 3300025942 Ga0207689_10092739 Ga0207689_100927392 255
342 3300025972 Ga0207668_10208049 Ga0207668_102080492 255
343 3300028380 Ga0268265_10030759 Ga0268265_100307594 255
344 3300050507 nmdc:mga05p37_453410_c1 nmdc:mga05p37_453410_c1_384_1214 255
345 3300050513 nmdc:mga0rr50_4194_c1 nmdc:mga0rr50_4194_c1_5834_6619 255
346 3300050515 nmdc:mga0a205_64119_c1 nmdc:mga0a205_64119_c1_1197_1973 255
347 3300005335 Ga0070666_10026271 Ga0070666_100262714 256
348 3300005518 Ga0070699_100222846 Ga0070699_1002228462 256
349 3300005548 Ga0070665_100001968 Ga0070665_10000196811 256
350 3300005548 Ga0070665_100058920 Ga0070665_1000589204 256
351 3300005618 Ga0068864_100219742 Ga0068864_1002197422 256
352 3300005834 Ga0068851_10039262 Ga0068851_100392622 256
353 3300005842 Ga0068858_100122908 Ga0068858_1001229082 256
354 3300006358 Ga0068871_100088804 Ga0068871_1000888043 256
355 3300006881 Ga0068865_100172754 Ga0068865_1001727542 256
356 3300009093 Ga0105240_10603487 Ga0105240_106034872 256
357 3300009148 Ga0105243_10310716 Ga0105243_103107162 256
358 3300009176 Ga0105242_10012935 Ga0105242_100129354 256
359 3300013296 Ga0157374_10042160 Ga0157374_100421604 256
360 3300013306 Ga0163162_10606165 Ga0163162_106061651 256
361 3300013308 Ga0157375_10427417 Ga0157375_104274171 256
362 3300014325 Ga0163163_10020292 Ga0163163_100202923 256
363 3300014968 Ga0157379_10053522 Ga0157379_100535224 256
364 3300014969 Ga0157376_10008351 Ga0157376_100083515 256
365 3300025321 Ga0207656_10076848 Ga0207656_100768482 256
366 3300025934 Ga0207686_10006510 Ga0207686_100065103 256
367 3300025941 Ga0207711_10205047 Ga0207711_102050471 256
368 3300026035 Ga0207703_10020141 Ga0207703_100201412 256
369 3300026035 Ga0207703_10402979 Ga0207703_104029791 256
370 3300026095 Ga0207676_10380154 Ga0207676_103801542 256
371 3300028379 Ga0268266_10051966 Ga0268266_100519663 256
372 3300028379 Ga0268266_10119971 Ga0268266_101199712 256
373 3300035171 Ga0373946_0141447 Ga0373946_0141447_264_1052 256
374 3300046533 Ga0495640_0059994 Ga0495640_0059994_1678_2466 256
375 3300046663 Ga0495635_0034820 Ga0495635_0034820_1881_2669 256
376 3300046683 Ga0495658_0056250 Ga0495658_0056250_834_1622 256
377 3300049573 Ga0501037_0177773 Ga0501037_0177773_311_1111 256
378 3300049576 Ga0501040_0114382 Ga0501040_0114382_214_1014 256
379 3300049578 Ga0501042_0118857 Ga0501042_0118857_566_1366 256
380 3300049591 Ga0501075_0018080 Ga0501075_0018080_4253_5053 256
381 3300049743 Ga0501081_0115606 Ga0501081_0115606_996_1796 256
382 3300049824 Ga0501045_0149199 Ga0501045_0149199_812_1612 256
383 3300053085 Ga0495619_0199518 Ga0495619_0199518_445_1233 256
384 3300060353 Ga0501082_0041535 Ga0501082_0041535_679_1479 256
385 3300060353 Ga0501082_0555223 Ga0501082_0555223_73_876 256
386 3300061734 Ga0530510_0156055 Ga0530510_0156055_552_1352 256
387 3300005335 Ga0070666_10086914 Ga0070666_100869142 257
388 3300005445 Ga0070708_100355708 Ga0070708_1003557082 257
389 3300005467 Ga0070706_100281127 Ga0070706_1002811272 257
390 3300005468 Ga0070707_100129730 Ga0070707_1001297301 257
391 3300006237 Ga0097621_100000475 Ga0097621_1000004758 257
392 3300006358 Ga0068871_100001753 Ga0068871_10000175315 257
393 3300006881 Ga0068865_100015637 Ga0068865_1000156372 257
394 3300009176 Ga0105242_10000986 Ga0105242_1000098617 257
395 3300009177 Ga0105248_10420341 Ga0105248_104203412 257
396 3300013297 Ga0157378_10536534 Ga0157378_105365341 257
397 3300013308 Ga0157375_10551139 Ga0157375_105511392 257
398 3300025922 Ga0207646_10086101 Ga0207646_100861012 257
399 3300025934 Ga0207686_10001689 Ga0207686_100016897 257
400 3300050507 nmdc:mga05p37_144698_c1 nmdc:mga05p37_144698_c1_1654_2460 257
401 3300005295 Ga0065707_10001222 Ga0065707_100012226 258
402 3300005335 Ga0070666_10111010 Ga0070666_101110102 258
403 3300005338 Ga0068868_100116352 Ga0068868_1001163522 258
404 3300005353 Ga0070669_100147542 Ga0070669_1001475422 258
405 3300005353 Ga0070669_100435648 Ga0070669_1004356482 258
406 3300005354 Ga0070675_100073836 Ga0070675_1000738363 258
407 3300005364 Ga0070673_100036889 Ga0070673_1000368894 258
408 3300005364 Ga0070673_100235993 Ga0070673_1002359932 258
409 3300005367 Ga0070667_100051619 Ga0070667_1000516192 258
410 3300005441 Ga0070700_100043078 Ga0070700_1000430782 258
411 3300005618 Ga0068864_100186898 Ga0068864_1001868982 258
412 3300005840 Ga0068870_10246758 Ga0068870_102467582 258
413 3300005844 Ga0068862_100151342 Ga0068862_1001513423 258
414 3300006237 Ga0097621_100018545 Ga0097621_1000185452 258
415 3300006358 Ga0068871_100012166 Ga0068871_1000121663 258
416 3300025903 Ga0207680_10101708 Ga0207680_101017082 258
417 3300025923 Ga0207681_10053851 Ga0207681_100538512 258
418 3300025926 Ga0207659_10014470 Ga0207659_100144702 258
419 3300025926 Ga0207659_10063154 Ga0207659_100631541 258
420 3300025940 Ga0207691_10031406 Ga0207691_100314064 258
421 3300025941 Ga0207711_10189450 Ga0207711_101894502 258
422 3300025960 Ga0207651_10200089 Ga0207651_102000892 258
423 3300026023 Ga0207677_10051137 Ga0207677_100511372 258
424 3300026095 Ga0207676_10219259 Ga0207676_102192592 258
425 3300026118 Ga0207675_100175434 Ga0207675_1001754342 258
426 3300028380 Ga0268265_10048738 Ga0268265_100487383 258
427 3300042436 Ga0439435_0007124 Ga0439435_0007124_957_1736 258
428 3300048917 Ga0496114_0200945 Ga0496114_0200945_224_1003 258
429 3300005330 Ga0070690_100027737 Ga0070690_1000277374 259
430 3300005334 Ga0068869_100044333 Ga0068869_1000443334 259
431 3300005340 Ga0070689_100077095 Ga0070689_1000770953 259
432 3300005353 Ga0070669_100034405 Ga0070669_1000344054 259
433 3300005354 Ga0070675_100063896 Ga0070675_1000638963 259
434 3300005354 Ga0070675_100093835 Ga0070675_1000938353 259
435 3300005356 Ga0070674_100116205 Ga0070674_1001162051 259
436 3300005364 Ga0070673_100092060 Ga0070673_1000920602 259
437 3300005456 Ga0070678_100066375 Ga0070678_1000663752 259
438 3300005459 Ga0068867_100087080 Ga0068867_1000870801 259
439 3300005543 Ga0070672_100175733 Ga0070672_1001757332 259
440 3300005543 Ga0070672_100263379 Ga0070672_1002633792 259
441 3300005544 Ga0070686_100163434 Ga0070686_1001634341 259
442 3300005615 Ga0070702_100124859 Ga0070702_1001248592 259
443 3300005617 Ga0068859_100076502 Ga0068859_1000765022 259
444 3300005617 Ga0068859_100212581 Ga0068859_1002125812 259
445 3300005618 Ga0068864_100059159 Ga0068864_1000591593 259
446 3300005834 Ga0068851_10005077 Ga0068851_100050772 259
447 3300005840 Ga0068870_10028887 Ga0068870_100288874 259
448 3300005842 Ga0068858_100013632 Ga0068858_1000136326 259
449 3300006844 Ga0075428_100218826 Ga0075428_1002188262 259
450 3300006931 Ga0097620_100076504 Ga0097620_1000765042 259
451 3300006931 Ga0097620_100212580 Ga0097620_1002125802 259
452 3300009148 Ga0105243_10021764 Ga0105243_100217643 259
453 3300009551 Ga0105238_10002032 Ga0105238_100020328 259
454 3300009553 Ga0105249_10855527 Ga0105249_108555271 259
455 3300011119 Ga0105246_10023457 Ga0105246_100234575 259
456 3300014326 Ga0157380_10125208 Ga0157380_101252082 259
457 3300014745 Ga0157377_10306215 Ga0157377_103062151 259
458 3300025321 Ga0207656_10001898 Ga0207656_100018985 259
459 3300025893 Ga0207682_10000468 Ga0207682_1000046813 259
460 3300025907 Ga0207645_10014603 Ga0207645_100146033 259
461 3300025908 Ga0207643_10078198 Ga0207643_100781982 259
462 3300025908 Ga0207643_10271738 Ga0207643_102717381 259
463 3300025918 Ga0207662_10131375 Ga0207662_101313752 259
464 3300025923 Ga0207681_10213913 Ga0207681_102139132 259
465 3300025924 Ga0207694_10002253 Ga0207694_100022538 259
466 3300025926 Ga0207659_10023509 Ga0207659_100235094 259
467 3300025926 Ga0207659_10210474 Ga0207659_102104742 259
468 3300025926 Ga0207659_10480657 Ga0207659_104806572 259
469 3300025931 Ga0207644_10061497 Ga0207644_100614971 259
470 3300025934 Ga0207686_10469938 Ga0207686_104699381 259
471 3300025935 Ga0207709_10009230 Ga0207709_100092304 259
472 3300025936 Ga0207670_10085678 Ga0207670_100856782 259
473 3300025937 Ga0207669_10290740 Ga0207669_102907402 259
474 3300025937 Ga0207669_10572623 Ga0207669_105726232 259
475 3300025940 Ga0207691_10011531 Ga0207691_100115313 259
476 3300025940 Ga0207691_10062686 Ga0207691_100626861 259
477 3300025942 Ga0207689_10074071 Ga0207689_100740712 259
478 3300025945 Ga0207679_10286820 Ga0207679_102868202 259
479 3300025960 Ga0207651_10121378 Ga0207651_101213781 259
480 3300025986 Ga0207658_10149490 Ga0207658_101494901 259
481 3300026035 Ga0207703_10008855 Ga0207703_100088556 259
482 3300026075 Ga0207708_10031922 Ga0207708_100319222 259
483 3300026089 Ga0207648_10012593 Ga0207648_100125932 259
484 3300026095 Ga0207676_10041156 Ga0207676_100411563 259
485 3300026116 Ga0207674_10686559 Ga0207674_106865591 259
486 3300026118 Ga0207675_100240454 Ga0207675_1002404542 259
487 3300026121 Ga0207683_10008172 Ga0207683_100081721 259
488 3300026121 Ga0207683_10122309 Ga0207683_101223092 259
489 3300046615 Ga0495656_0222394 Ga0495656_0222394_129_920 259
490 3300049575 Ga0501039_0138801 Ga0501039_0138801_777_1565 259
491 3300049578 Ga0501042_0028518 Ga0501042_0028518_2728_3516 259
492 3300049582 Ga0501048_0037652 Ga0501048_0037652_2674_3462 259
493 3300049591 Ga0501075_0009220 Ga0501075_0009220_5807_6595 259
494 3300049592 Ga0501076_0053107 Ga0501076_0053107_1313_2101 259
495 3300003203 JGI25406J46586_10015184 JGI25406J46586_100151843 260
496 3300005338 Ga0068868_100270102 Ga0068868_1002701022 260
497 3300005340 Ga0070689_100011352 Ga0070689_1000113523 260
498 3300005354 Ga0070675_100029726 Ga0070675_1000297262 260
499 3300005364 Ga0070673_100049430 Ga0070673_1000494304 260
500 3300005367 Ga0070667_100043545 Ga0070667_1000435453 260
501 3300005438 Ga0070701_10029230 Ga0070701_100292302 260
502 3300005440 Ga0070705_100133940 Ga0070705_1001339402 260
503 3300005441 Ga0070700_100257022 Ga0070700_1002570221 260
504 3300005444 Ga0070694_100169011 Ga0070694_1001690112 260
505 3300005456 Ga0070678_100702921 Ga0070678_1007029211 260
506 3300005466 Ga0070685_10238633 Ga0070685_102386332 260
507 3300005518 Ga0070699_100018143 Ga0070699_1000181432 260
508 3300005536 Ga0070697_100078630 Ga0070697_1000786302 260
509 3300005546 Ga0070696_100074709 Ga0070696_1000747092 260
510 3300005548 Ga0070665_100227428 Ga0070665_1002274282 260
511 3300005549 Ga0070704_100235676 Ga0070704_1002356762 260
512 3300005578 Ga0068854_100266103 Ga0068854_1002661032 260
513 3300005615 Ga0070702_100063218 Ga0070702_1000632182 260
514 3300005840 Ga0068870_10304229 Ga0068870_103042291 260
515 3300005842 Ga0068858_100521938 Ga0068858_1005219382 260
516 3300005843 Ga0068860_100207219 Ga0068860_1002072193 260
517 3300005985 Ga0081539_10000010 Ga0081539_10000010300 260
518 3300006844 Ga0075428_100490806 Ga0075428_1004908062 260
519 3300006846 Ga0075430_100035081 Ga0075430_1000350812 260
520 3300006846 Ga0075430_100093913 Ga0075430_1000939132 260
521 3300006847 Ga0075431_100350291 Ga0075431_1003502912 260
522 3300006852 Ga0075433_10239715 Ga0075433_102397152 260
523 3300006914 Ga0075436_100042599 Ga0075436_1000425994 260
524 3300006931 Ga0097620_100063951 Ga0097620_1000639512 260
525 3300007076 Ga0075435_100040282 Ga0075435_1000402822 260
526 3300009094 Ga0111539_10004048 Ga0111539_100040486 260
527 3300009147 Ga0114129_10007398 Ga0114129_100073984 260
528 3300009147 Ga0114129_10132868 Ga0114129_101328682 260
529 3300009148 Ga0105243_10689806 Ga0105243_106898061 260
530 3300009177 Ga0105248_10007883 Ga0105248_100078837 260
531 3300009177 Ga0105248_10257685 Ga0105248_102576852 260
532 3300013306 Ga0163162_10017597 Ga0163162_100175972 260
533 3300013308 Ga0157375_10028027 Ga0157375_100280273 260
534 3300025908 Ga0207643_10140511 Ga0207643_101405112 260
535 3300025922 Ga0207646_10071800 Ga0207646_100718002 260
536 3300025922 Ga0207646_10183657 Ga0207646_101836572 260
537 3300025926 Ga0207659_10016387 Ga0207659_100163872 260
538 3300025927 Ga0207687_10284713 Ga0207687_102847132 260
539 3300025936 Ga0207670_10024523 Ga0207670_100245232 260
540 3300026035 Ga0207703_10101954 Ga0207703_101019542 260
541 3300026075 Ga0207708_10119059 Ga0207708_101190593 260
542 3300026116 Ga0207674_10609485 Ga0207674_106094851 260
543 3300027907 Ga0207428_10015801 Ga0207428_100158013 260
544 3300048912 Ga0496109_0114833 Ga0496109_0114833_143_961 260
545 3300048912 Ga0496109_0365767 Ga0496109_0365767_545_1336 260
546 3300048917 Ga0496114_0207229 Ga0496114_0207229_605_1396 260
547 3300049580 Ga0501046_0344936 Ga0501046_0344936_134_952 260
548 3300049587 Ga0501071_0052844 Ga0501071_0052844_2092_2910 260
549 3300049588 Ga0501072_0184639 Ga0501072_0184639_625_1443 260
550 3300049591 Ga0501075_0209946 Ga0501075_0209946_641_1459 260
551 3300049592 Ga0501076_0122593 Ga0501076_0122593_786_1604 260
552 3300049824 Ga0501045_0022749 Ga0501045_0022749_1920_2738 260
553 3300050507 nmdc:mga05p37_86835_c1 nmdc:mga05p37_86835_c1_1808_2623 260
554 3300050508 nmdc:mga09592_504124_c1 nmdc:mga09592_504124_c1_37_852 260
555 3300050509 nmdc:mga0qj67_107485_c1 nmdc:mga0qj67_107485_c1_83_901 260
556 3300050509 nmdc:mga0qj67_66758_c1 nmdc:mga0qj67_66758_c1_884_1699 260
557 3300050510 nmdc:mga06r32_137930_c1 nmdc:mga06r32_137930_c1_1202_2020 260
558 3300050511 nmdc:mga08y16_179020_c1 nmdc:mga08y16_179020_c1_229_1044 260
559 3300050511 nmdc:mga08y16_618090_c1 nmdc:mga08y16_618090_c1_57_872 260
560 3300050512 nmdc:mga0n895_185630_c1 nmdc:mga0n895_185630_c1_877_1761 260
561 3300005355 Ga0070671_100027861 Ga0070671_1000278611 262
562 3300005456 Ga0070678_100073928 Ga0070678_1000739281 264
563 3300026121 Ga0207683_10010505 Ga0207683_100105051 264
564 3300006852 Ga0075433_10086852 Ga0075433_100868522 267
565 3300027907 Ga0207428_10050273 Ga0207428_100502733 267
566 3300003203 JGI25406J46586_10000213 JGI25406J46586_1000021311 269
567 3300005985 Ga0081539_10000065 Ga0081539_1000006597 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

84

157

0.84

PF00034

Cytochrom_C

Cytochrome c

86

161

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.9036 193 236
7c90-assembly1.cif.gz_D crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) 0.8779 45 120
2d0w-assembly2.cif.gz_B crystal structure of cytochrome cl from hyphomicrobium denitrificans 0.8686 46 119
3qsu-assembly1.cif.gz_A structure of staphylococcus aureus hfq in complex with a7 rna 0.8445 191 237
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.8421 190 236
ID Description Score Start End Superfamily
4x9dF00 Mainly Beta;Roll;SH3 type barrels.; 0.87 189 236 2.30.30.100
2d0wB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8686 46 119 1.10.760.10
af_Q556K7_74_139_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8364 191 242 2.30.30.100
af_A4HX97_33_135_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8362 191 218 2.30.30.100
af_O05781_146_201_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8284 187 238 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A2V8KFY7-F1-model_v4 Uncharacterized protein 0.9489 161 269 GO:0009055
GO:0020037
AF-A0A357TIY4-F1-model_v4 Cytochrome c domain-containing protein 0.9435 132 266 GO:0009055
GO:0020037
GO:0046872
AF-A0A3D4CYE3-F1-model_v4 Cytochrome c domain-containing protein 0.9428 132 267 GO:0009055
GO:0020037
GO:0046872
AF-A0A317HZZ0-F1-model_v4 deleted 0.9271 131 269
AF-A0A2V8KFY7-F1-model_v4 Uncharacterized protein 0.9246 161 269 GO:0009055
GO:0020037

Feature Viewer

pLDDT pTM Quality
84.98 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map