F464520
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 241 | 567 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300025960|Ga0207651_11882977|Ga0207651_118829771 |
| Length | 92 |
| Sequence | MGVRWRPVTTKRGPVAKRTKSALKANRQNIKRREANRQIRASLDDNDVDGAKTALSQTVSIVDKMATKGIIHRNTAGRYKSRLASRLTKASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 95 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 182 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 183 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 184 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 185 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 186 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 187 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 188 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 189 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 190 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 191 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 192 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 193 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 194 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 216 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 227 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 228 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 229 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 230 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 98.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11812573 | 2162886012 | Unclassified | 836 |
| 2 | Ga0058860_12175475 | 3300004801 | Bacteria | 515 |
| 3 | Ga0065714_10292723 | 3300005288 | Bacteria | 705 |
| 4 | Ga0065704_10450404 | 3300005289 | Bacteria | 706 |
| 5 | Ga0065704_10658794 | 3300005289 | Bacteria | 568 |
| 6 | Ga0065712_10000157 | 3300005290 | Bacteria | 58547 |
| 7 | Ga0065712_10099250 | 3300005290 | Unclassified | 2090 |
| 8 | Ga0065712_10796277 | 3300005290 | Unclassified | 506 |
| 9 | Ga0065715_10449556 | 3300005293 | Unclassified | 827 |
| 10 | Ga0065707_10100639 | 3300005295 | Unclassified | 2916 |
| 11 | Ga0065707_10118375 | 3300005295 | Bacteria | 2187 |
| 12 | Ga0065707_10401373 | 3300005295 | Bacteria | 852 |
| 13 | Ga0070676_10002732 | 3300005328 | Bacteria | 9099 |
| 14 | Ga0070690_100138128 | 3300005330 | Unclassified | 1652 |
| 15 | Ga0070690_100178879 | 3300005330 | Bacteria | 1465 |
| 16 | Ga0070690_100266220 | 3300005330 | Unclassified | 1217 |
| 17 | Ga0070690_100321250 | 3300005330 | Bacteria | 1115 |
| 18 | Ga0070690_100663726 | 3300005330 | Bacteria | 797 |
| 19 | Ga0070670_100095821 | 3300005331 | Bacteria | 2553 |
| 20 | Ga0070670_100435054 | 3300005331 | Bacteria | 1161 |
| 21 | Ga0070670_101739731 | 3300005331 | Bacteria | 574 |
| 22 | Ga0070677_10003227 | 3300005333 | Bacteria | 5248 |
| 23 | Ga0070677_10049033 | 3300005333 | Bacteria | 1699 |
| 24 | Ga0068869_100581096 | 3300005334 | Bacteria | 944 |
| 25 | Ga0068869_100822610 | 3300005334 | Bacteria | 800 |
| 26 | Ga0070666_10002058 | 3300005335 | Bacteria | 12205 |
| 27 | Ga0070666_11110198 | 3300005335 | Unclassified | 588 |
| 28 | Ga0070666_11325561 | 3300005335 | Unclassified | 537 |
| 29 | Ga0070680_100215371 | 3300005336 | Bacteria | 1621 |
| 30 | Ga0070680_100724390 | 3300005336 | Bacteria | 856 |
| 31 | Ga0070682_100347562 | 3300005337 | Bacteria | 1104 |
| 32 | Ga0070682_100925485 | 3300005337 | Bacteria | 718 |
| 33 | Ga0068868_100420654 | 3300005338 | Bacteria | 1157 |
| 34 | Ga0068868_101342716 | 3300005338 | Bacteria | 665 |
| 35 | Ga0070660_101541518 | 3300005339 | Bacteria | 565 |
| 36 | Ga0070689_100037709 | 3300005340 | Bacteria | 3696 |
| 37 | Ga0070689_100098826 | 3300005340 | Bacteria | 2309 |
| 38 | Ga0070689_100219776 | 3300005340 | Unclassified | 1558 |
| 39 | Ga0070689_100421749 | 3300005340 | Unclassified | 1131 |
| 40 | Ga0070691_10289425 | 3300005341 | Bacteria | 891 |
| 41 | Ga0070687_100010126 | 3300005343 | Bacteria | 4062 |
| 42 | Ga0070687_100600785 | 3300005343 | Unclassified | 756 |
| 43 | Ga0070661_100018283 | 3300005344 | Bacteria | 4982 |
| 44 | Ga0070661_100285848 | 3300005344 | Unclassified | 1280 |
| 45 | Ga0070692_10046272 | 3300005345 | Bacteria | 2248 |
| 46 | Ga0070692_11339184 | 3300005345 | Unclassified | 515 |
| 47 | Ga0070668_100077184 | 3300005347 | Bacteria | 2604 |
| 48 | Ga0070668_100090405 | 3300005347 | Unclassified | 2412 |
| 49 | Ga0070668_100338528 | 3300005347 | Bacteria | 1270 |
| 50 | Ga0070669_100004330 | 3300005353 | Bacteria | 10253 |
| 51 | Ga0070669_100317993 | 3300005353 | Bacteria | 1256 |
| 52 | Ga0070669_100466161 | 3300005353 | Bacteria | 1043 |
| 53 | Ga0070669_100714246 | 3300005353 | Bacteria | 847 |
| 54 | Ga0070669_101400909 | 3300005353 | Unclassified | 607 |
| 55 | Ga0070669_101886647 | 3300005353 | Bacteria | 522 |
| 56 | Ga0070675_100015380 | 3300005354 | Bacteria | 6048 |
| 57 | Ga0070675_100020507 | 3300005354 | Bacteria | 5273 |
| 58 | Ga0070675_100065654 | 3300005354 | Bacteria | 3001 |
| 59 | Ga0070675_100069390 | 3300005354 | Bacteria | 2920 |
| 60 | Ga0070675_100828104 | 3300005354 | Bacteria | 846 |
| 61 | Ga0070671_101243697 | 3300005355 | Unclassified | 656 |
| 62 | Ga0070674_100233167 | 3300005356 | Unclassified | 1437 |
| 63 | Ga0070673_100017267 | 3300005364 | Bacteria | 5125 |
| 64 | Ga0070673_100153102 | 3300005364 | Bacteria | 1954 |
| 65 | Ga0070673_100721151 | 3300005364 | Bacteria | 917 |
| 66 | Ga0070673_100810870 | 3300005364 | Bacteria | 865 |
| 67 | Ga0070688_100062307 | 3300005365 | Bacteria | 2361 |
| 68 | Ga0070688_100083133 | 3300005365 | Unclassified | 2077 |
| 69 | Ga0070688_100118734 | 3300005365 | Bacteria | 1768 |
| 70 | Ga0070688_100345739 | 3300005365 | Unclassified | 1087 |
| 71 | Ga0070688_100786295 | 3300005365 | Bacteria | 743 |
| 72 | Ga0070659_100154135 | 3300005366 | Unclassified | 1875 |
| 73 | Ga0070659_100945344 | 3300005366 | Unclassified | 755 |
| 74 | Ga0070667_100099133 | 3300005367 | Unclassified | 2515 |
| 75 | Ga0070667_100634342 | 3300005367 | Bacteria | 986 |
| 76 | Ga0070701_10041587 | 3300005438 | Bacteria | 2343 |
| 77 | Ga0070701_10316566 | 3300005438 | Unclassified | 964 |
| 78 | Ga0070711_100321012 | 3300005439 | Unclassified | 1237 |
| 79 | Ga0070705_100549046 | 3300005440 | Bacteria | 885 |
| 80 | Ga0070705_100992109 | 3300005440 | Unclassified | 681 |
| 81 | Ga0070700_100043287 | 3300005441 | Bacteria | 2769 |
| 82 | Ga0070700_100576587 | 3300005441 | Bacteria | 878 |
| 83 | Ga0070700_101146552 | 3300005441 | Bacteria | 647 |
| 84 | Ga0070694_100776216 | 3300005444 | Unclassified | 784 |
| 85 | Ga0070694_100941101 | 3300005444 | Unclassified | 715 |
| 86 | Ga0070694_100947348 | 3300005444 | Bacteria | 713 |
| 87 | Ga0070708_101925431 | 3300005445 | Bacteria | 548 |
| 88 | Ga0070663_100996421 | 3300005455 | Bacteria | 728 |
| 89 | Ga0070678_100061768 | 3300005456 | Bacteria | 2763 |
| 90 | Ga0070678_100126106 | 3300005456 | Bacteria | 2027 |
| 91 | Ga0070678_100608849 | 3300005456 | Unclassified | 976 |
| 92 | Ga0070678_101160205 | 3300005456 | Unclassified | 715 |
| 93 | Ga0070678_101275804 | 3300005456 | Unclassified | 683 |
| 94 | Ga0070678_102081309 | 3300005456 | Bacteria | 537 |
| 95 | Ga0070662_100015586 | 3300005457 | Bacteria | 5093 |
| 96 | Ga0070662_100585745 | 3300005457 | Unclassified | 937 |
| 97 | Ga0070681_10047573 | 3300005458 | Bacteria | 4288 |
| 98 | Ga0068867_100011383 | 3300005459 | Bacteria | 6277 |
| 99 | Ga0068867_100312007 | 3300005459 | Bacteria | 1300 |
| 100 | Ga0070685_10002152 | 3300005466 | Bacteria | 10148 |
| 101 | Ga0070706_100071653 | 3300005467 | Bacteria | 3205 |
| 102 | Ga0070707_100075015 | 3300005468 | Bacteria | 3262 |
| 103 | Ga0070707_100350536 | 3300005468 | Unclassified | 1434 |
| 104 | Ga0070698_100069962 | 3300005471 | Bacteria | 3522 |
| 105 | Ga0070698_100992958 | 3300005471 | Unclassified | 786 |
| 106 | Ga0070699_100283005 | 3300005518 | Bacteria | 1485 |
| 107 | Ga0070699_100760290 | 3300005518 | Bacteria | 886 |
| 108 | Ga0070679_100091085 | 3300005530 | Unclassified | 3037 |
| 109 | Ga0070684_100403721 | 3300005535 | Unclassified | 1260 |
| 110 | Ga0070697_100173734 | 3300005536 | Unclassified | 1824 |
| 111 | Ga0070672_100048249 | 3300005543 | Unclassified | 3308 |
| 112 | Ga0070672_100090003 | 3300005543 | Unclassified | 2474 |
| 113 | Ga0070672_100409230 | 3300005543 | Unclassified | 1164 |
| 114 | Ga0070672_101243029 | 3300005543 | Unclassified | 664 |
| 115 | Ga0070672_101322209 | 3300005543 | Unclassified | 644 |
| 116 | Ga0070672_101363096 | 3300005543 | Bacteria | 634 |
| 117 | Ga0070686_100030006 | 3300005544 | Bacteria | 3313 |
| 118 | Ga0070686_100332548 | 3300005544 | Bacteria | 1136 |
| 119 | Ga0070686_100411412 | 3300005544 | Unclassified | 1031 |
| 120 | Ga0070686_100541762 | 3300005544 | Unclassified | 909 |
| 121 | Ga0070686_101206284 | 3300005544 | Unclassified | 629 |
| 122 | Ga0070695_100321726 | 3300005545 | Bacteria | 1150 |
| 123 | Ga0070696_100223184 | 3300005546 | Bacteria | 1415 |
| 124 | Ga0070693_100740435 | 3300005547 | Unclassified | 723 |
| 125 | Ga0070665_100083489 | 3300005548 | Bacteria | 3199 |
| 126 | Ga0070665_100491356 | 3300005548 | Bacteria | 1238 |
| 127 | Ga0070665_100610085 | 3300005548 | Unclassified | 1104 |
| 128 | Ga0070704_100063426 | 3300005549 | Bacteria | 2652 |
| 129 | Ga0070704_100114053 | 3300005549 | Bacteria | 2062 |
| 130 | Ga0070704_100215805 | 3300005549 | Unclassified | 1557 |
| 131 | Ga0070704_100296862 | 3300005549 | Bacteria | 1345 |
| 132 | Ga0070704_100902106 | 3300005549 | Bacteria | 795 |
| 133 | Ga0070704_101826326 | 3300005549 | Bacteria | 563 |
| 134 | Ga0070664_100006238 | 3300005564 | Bacteria | 9630 |
| 135 | Ga0070664_100059268 | 3300005564 | Bacteria | 3256 |
| 136 | Ga0070664_100106703 | 3300005564 | Unclassified | 2441 |
| 137 | Ga0070664_100943615 | 3300005564 | Bacteria | 810 |
| 138 | Ga0068857_100215386 | 3300005577 | Unclassified | 1753 |
| 139 | Ga0068857_100671882 | 3300005577 | Bacteria | 983 |
| 140 | Ga0068854_100882347 | 3300005578 | Bacteria | 785 |
| 141 | Ga0070702_100774808 | 3300005615 | Bacteria | 739 |
| 142 | Ga0070702_100939524 | 3300005615 | Bacteria | 680 |
| 143 | Ga0070702_101649028 | 3300005615 | Bacteria | 532 |
| 144 | Ga0068852_100050124 | 3300005616 | Bacteria | 3576 |
| 145 | Ga0068859_100048797 | 3300005617 | Unclassified | 4253 |
| 146 | Ga0068859_100188780 | 3300005617 | Bacteria | 2145 |
| 147 | Ga0068859_100243264 | 3300005617 | Bacteria | 1889 |
| 148 | Ga0068859_100274759 | 3300005617 | Unclassified | 1777 |
| 149 | Ga0068859_100787437 | 3300005617 | Unclassified | 1039 |
| 150 | Ga0068859_101175476 | 3300005617 | Unclassified | 845 |
| 151 | Ga0068859_101444286 | 3300005617 | Unclassified | 759 |
| 152 | Ga0068859_102013246 | 3300005617 | Bacteria | 638 |
| 153 | Ga0068864_100111047 | 3300005618 | Bacteria | 2442 |
| 154 | Ga0068864_100261602 | 3300005618 | Unclassified | 1610 |
| 155 | Ga0068864_100310920 | 3300005618 | Unclassified | 1477 |
| 156 | Ga0068864_100603003 | 3300005618 | Bacteria | 1066 |
| 157 | Ga0068864_101133557 | 3300005618 | Unclassified | 779 |
| 158 | Ga0068861_100003257 | 3300005719 | Bacteria | 10742 |
| 159 | Ga0068861_100294418 | 3300005719 | Bacteria | 1403 |
| 160 | Ga0068861_100411480 | 3300005719 | Unclassified | 1203 |
| 161 | Ga0068861_101027323 | 3300005719 | Unclassified | 788 |
| 162 | Ga0068870_10000409 | 3300005840 | Bacteria | 16148 |
| 163 | Ga0068870_10135116 | 3300005840 | Unclassified | 1437 |
| 164 | Ga0068870_10621507 | 3300005840 | Bacteria | 736 |
| 165 | Ga0068863_100042106 | 3300005841 | Bacteria | 4340 |
| 166 | Ga0068863_100609731 | 3300005841 | Unclassified | 1081 |
| 167 | Ga0068858_100210597 | 3300005842 | Unclassified | 1839 |
| 168 | Ga0068860_100054699 | 3300005843 | Bacteria | 3794 |
| 169 | Ga0068860_100257794 | 3300005843 | Unclassified | 1699 |
| 170 | Ga0068860_100550420 | 3300005843 | Bacteria | 1156 |
| 171 | Ga0068860_101588018 | 3300005843 | Unclassified | 676 |
| 172 | Ga0068862_100006569 | 3300005844 | Bacteria | 9648 |
| 173 | Ga0068862_100037927 | 3300005844 | Bacteria | 4086 |
| 174 | Ga0068862_100291411 | 3300005844 | Bacteria | 1499 |
| 175 | Ga0068862_100909470 | 3300005844 | Bacteria | 866 |
| 176 | Ga0068862_101598092 | 3300005844 | Unclassified | 659 |
| 177 | Ga0068862_102071741 | 3300005844 | Bacteria | 580 |
| 178 | Ga0075432_10115023 | 3300006058 | Bacteria | 1006 |
| 179 | Ga0097621_100502328 | 3300006237 | Bacteria | 1098 |
| 180 | Ga0097621_101688942 | 3300006237 | Unclassified | 603 |
| 181 | Ga0068871_100100507 | 3300006358 | Unclassified | 2423 |
| 182 | Ga0068871_100401166 | 3300006358 | Unclassified | 1221 |
| 183 | Ga0068871_100848087 | 3300006358 | Bacteria | 844 |
| 184 | Ga0075428_100001700 | 3300006844 | Bacteria | 23477 |
| 185 | Ga0075428_100002416 | 3300006844 | Bacteria | 20297 |
| 186 | Ga0075428_100005624 | 3300006844 | Bacteria | 13924 |
| 187 | Ga0075428_100024130 | 3300006844 | Bacteria | 6728 |
| 188 | Ga0075428_100044304 | 3300006844 | Bacteria | 4890 |
| 189 | Ga0075428_100543122 | 3300006844 | Bacteria | 1242 |
| 190 | Ga0075428_100544505 | 3300006844 | Bacteria | 1241 |
| 191 | Ga0075428_100607190 | 3300006844 | Unclassified | 1168 |
| 192 | Ga0075428_102200606 | 3300006844 | Unclassified | 569 |
| 193 | Ga0075430_100006849 | 3300006846 | Bacteria | 9607 |
| 194 | Ga0075430_100021061 | 3300006846 | Bacteria | 5543 |
| 195 | Ga0075430_100087556 | 3300006846 | Bacteria | 2606 |
| 196 | Ga0075430_100300438 | 3300006846 | Unclassified | 1328 |
| 197 | Ga0075430_100506955 | 3300006846 | Bacteria | 996 |
| 198 | Ga0075430_100698472 | 3300006846 | Bacteria | 836 |
| 199 | Ga0075431_100090492 | 3300006847 | Bacteria | 3158 |
| 200 | Ga0075431_100126365 | 3300006847 | Bacteria | 2638 |
| 201 | Ga0075431_100218140 | 3300006847 | Unclassified | 1946 |
| 202 | Ga0075431_100845498 | 3300006847 | Bacteria | 887 |
| 203 | Ga0075433_10060674 | 3300006852 | Bacteria | 3312 |
| 204 | Ga0075433_10061911 | 3300006852 | Unclassified | 3278 |
| 205 | Ga0075433_10232638 | 3300006852 | Bacteria | 1636 |
| 206 | Ga0075433_10432161 | 3300006852 | Bacteria | 1161 |
| 207 | Ga0075433_10434379 | 3300006852 | Bacteria | 1158 |
| 208 | Ga0075434_100062600 | 3300006871 | Unclassified | 3704 |
| 209 | Ga0075434_100085172 | 3300006871 | Bacteria | 3160 |
| 210 | Ga0075434_101373994 | 3300006871 | Unclassified | 716 |
| 211 | Ga0075429_100001299 | 3300006880 | Bacteria | 20353 |
| 212 | Ga0075429_100021693 | 3300006880 | Bacteria | 5567 |
| 213 | Ga0075429_100022229 | 3300006880 | Bacteria | 5502 |
| 214 | Ga0075429_100057628 | 3300006880 | Bacteria | 3382 |
| 215 | Ga0075429_100220346 | 3300006880 | Bacteria | 1662 |
| 216 | Ga0075429_100481740 | 3300006880 | Unclassified | 1087 |
| 217 | Ga0075429_101259609 | 3300006880 | Unclassified | 645 |
| 218 | Ga0068865_100335187 | 3300006881 | Bacteria | 1221 |
| 219 | Ga0068865_101627352 | 3300006881 | Unclassified | 581 |
| 220 | Ga0097620_100048797 | 3300006931 | Unclassified | 4253 |
| 221 | Ga0097620_100188781 | 3300006931 | Bacteria | 2145 |
| 222 | Ga0097620_100243271 | 3300006931 | Bacteria | 1889 |
| 223 | Ga0097620_100274767 | 3300006931 | Unclassified | 1777 |
| 224 | Ga0097620_100787229 | 3300006931 | Unclassified | 1039 |
| 225 | Ga0097620_101175609 | 3300006931 | Unclassified | 845 |
| 226 | Ga0097620_101443996 | 3300006931 | Unclassified | 759 |
| 227 | Ga0097620_102013397 | 3300006931 | Bacteria | 638 |
| 228 | Ga0075435_100024200 | 3300007076 | Bacteria | 4708 |
| 229 | Ga0075435_101357130 | 3300007076 | Unclassified | 623 |
| 230 | Ga0075435_101746759 | 3300007076 | Unclassified | 546 |
| 231 | Ga0105240_10015432 | 3300009093 | Bacteria | 10387 |
| 232 | Ga0111539_10001176 | 3300009094 | Bacteria | 34725 |
| 233 | Ga0111539_10007015 | 3300009094 | Bacteria | 14452 |
| 234 | Ga0111539_10011819 | 3300009094 | Bacteria | 10944 |
| 235 | Ga0111539_10014042 | 3300009094 | Bacteria | 10007 |
| 236 | Ga0111539_10085748 | 3300009094 | Bacteria | 3701 |
| 237 | Ga0111539_10330824 | 3300009094 | Bacteria | 1773 |
| 238 | Ga0111539_10588410 | 3300009094 | Bacteria | 1296 |
| 239 | Ga0111539_10742466 | 3300009094 | Bacteria | 1142 |
| 240 | Ga0111539_12448957 | 3300009094 | Bacteria | 605 |
| 241 | Ga0105245_10430399 | 3300009098 | Bacteria | 1324 |
| 242 | Ga0105245_11409355 | 3300009098 | Unclassified | 747 |
| 243 | Ga0105247_10551484 | 3300009101 | Unclassified | 848 |
| 244 | Ga0114129_10025293 | 3300009147 | Bacteria | 8411 |
| 245 | Ga0114129_10108629 | 3300009147 | Bacteria | 3830 |
| 246 | Ga0114129_10253277 | 3300009147 | Bacteria | 2362 |
| 247 | Ga0114129_10446193 | 3300009147 | Unclassified | 1697 |
| 248 | Ga0114129_10456680 | 3300009147 | Bacteria | 1675 |
| 249 | Ga0114129_10555270 | 3300009147 | Unclassified | 1493 |
| 250 | Ga0114129_10579030 | 3300009147 | Unclassified | 1457 |
| 251 | Ga0114129_12620998 | 3300009147 | Bacteria | 601 |
| 252 | Ga0105243_11762624 | 3300009148 | Bacteria | 649 |
| 253 | Ga0105242_10556744 | 3300009176 | Unclassified | 1100 |
| 254 | Ga0105242_12241914 | 3300009176 | Unclassified | 592 |
| 255 | Ga0105248_10027232 | 3300009177 | Bacteria | 6360 |
| 256 | Ga0105248_10630074 | 3300009177 | Bacteria | 1210 |
| 257 | Ga0105248_10974505 | 3300009177 | Bacteria | 958 |
| 258 | Ga0105248_11032901 | 3300009177 | Unclassified | 929 |
| 259 | Ga0105249_10005440 | 3300009553 | Bacteria | 10995 |
| 260 | Ga0105249_10940168 | 3300009553 | Bacteria | 932 |
| 261 | Ga0105249_12263548 | 3300009553 | Unclassified | 616 |
| 262 | Ga0105249_12362118 | 3300009553 | Bacteria | 604 |
| 263 | Ga0099796_10241392 | 3300010159 | Bacteria | 747 |
| 264 | Ga0105246_10041172 | 3300011119 | Bacteria | 3121 |
| 265 | Ga0105246_10995656 | 3300011119 | Bacteria | 758 |
| 266 | Ga0157321_1015243 | 3300012487 | Unclassified | 647 |
| 267 | Ga0157314_1009787 | 3300012500 | Unclassified | 817 |
| 268 | Ga0157371_10417344 | 3300013102 | Unclassified | 983 |
| 269 | Ga0157371_11190791 | 3300013102 | Bacteria | 587 |
| 270 | Ga0157374_10362810 | 3300013296 | Bacteria | 1441 |
| 271 | Ga0163162_10264816 | 3300013306 | Bacteria | 1850 |
| 272 | Ga0163162_11219367 | 3300013306 | Bacteria | 854 |
| 273 | Ga0163162_11488664 | 3300013306 | Bacteria | 771 |
| 274 | Ga0157372_10428061 | 3300013307 | Unclassified | 1543 |
| 275 | Ga0157372_12128408 | 3300013307 | Bacteria | 645 |
| 276 | Ga0157375_10017399 | 3300013308 | Bacteria | 6486 |
| 277 | Ga0157375_10363735 | 3300013308 | Unclassified | 1613 |
| 278 | Ga0157375_10771455 | 3300013308 | Bacteria | 1112 |
| 279 | Ga0157375_11218114 | 3300013308 | Unclassified | 883 |
| 280 | Ga0157375_12298425 | 3300013308 | Unclassified | 643 |
| 281 | Ga0163163_13068646 | 3300014325 | Bacteria | 521 |
| 282 | Ga0157380_10094819 | 3300014326 | Unclassified | 2471 |
| 283 | Ga0157380_10195247 | 3300014326 | Bacteria | 1791 |
| 284 | Ga0157380_10199689 | 3300014326 | Bacteria | 1773 |
| 285 | Ga0157380_10204076 | 3300014326 | Unclassified | 1756 |
| 286 | Ga0157377_10001579 | 3300014745 | Bacteria | 9911 |
| 287 | Ga0157377_10012641 | 3300014745 | Bacteria | 4249 |
| 288 | Ga0157377_10420179 | 3300014745 | Bacteria | 915 |
| 289 | Ga0157377_10606549 | 3300014745 | Bacteria | 782 |
| 290 | Ga0157379_10018661 | 3300014968 | Bacteria | 6114 |
| 291 | Ga0157376_10354060 | 3300014969 | Bacteria | 1406 |
| 292 | Ga0157376_10376103 | 3300014969 | Bacteria | 1367 |
| 293 | Ga0157376_11475922 | 3300014969 | Unclassified | 713 |
| 294 | Ga0163161_10018958 | 3300017792 | Bacteria | 4823 |
| 295 | Ga0207673_1039471 | 3300025290 | Bacteria | 662 |
| 296 | Ga0207697_10000483 | 3300025315 | Bacteria | 22534 |
| 297 | Ga0207697_10488256 | 3300025315 | Bacteria | 544 |
| 298 | Ga0207682_10005531 | 3300025893 | Bacteria | 5143 |
| 299 | Ga0207682_10150156 | 3300025893 | Bacteria | 1050 |
| 300 | Ga0207688_10002562 | 3300025901 | Bacteria | 9831 |
| 301 | Ga0207688_10479087 | 3300025901 | Bacteria | 778 |
| 302 | Ga0207680_10062643 | 3300025903 | Unclassified | 2273 |
| 303 | Ga0207645_10003430 | 3300025907 | Bacteria | 12048 |
| 304 | Ga0207643_10002454 | 3300025908 | Bacteria | 10012 |
| 305 | Ga0207643_10428439 | 3300025908 | Bacteria | 839 |
| 306 | Ga0207684_10074921 | 3300025910 | Bacteria | 2876 |
| 307 | Ga0207684_10308322 | 3300025910 | Bacteria | 1365 |
| 308 | Ga0207663_11117817 | 3300025916 | Unclassified | 634 |
| 309 | Ga0207660_10656011 | 3300025917 | Bacteria | 856 |
| 310 | Ga0207662_10010573 | 3300025918 | Bacteria | 5101 |
| 311 | Ga0207662_10078343 | 3300025918 | Bacteria | 2011 |
| 312 | Ga0207657_10306820 | 3300025919 | Bacteria | 1257 |
| 313 | Ga0207657_10988618 | 3300025919 | Bacteria | 646 |
| 314 | Ga0207649_10019427 | 3300025920 | Bacteria | 3883 |
| 315 | Ga0207649_10219423 | 3300025920 | Unclassified | 1353 |
| 316 | Ga0207652_10104459 | 3300025921 | Unclassified | 2506 |
| 317 | Ga0207646_10047830 | 3300025922 | Bacteria | 3836 |
| 318 | Ga0207646_10543525 | 3300025922 | Unclassified | 1045 |
| 319 | Ga0207681_10011928 | 3300025923 | Bacteria | 5352 |
| 320 | Ga0207681_10161591 | 3300025923 | Bacteria | 1689 |
| 321 | Ga0207681_10344577 | 3300025923 | Bacteria | 1191 |
| 322 | Ga0207681_10438607 | 3300025923 | Bacteria | 1061 |
| 323 | Ga0207681_10669713 | 3300025923 | Bacteria | 861 |
| 324 | Ga0207681_11602501 | 3300025923 | Unclassified | 545 |
| 325 | Ga0207681_11671005 | 3300025923 | Bacteria | 532 |
| 326 | Ga0207650_10071762 | 3300025925 | Unclassified | 2605 |
| 327 | Ga0207650_10411594 | 3300025925 | Bacteria | 1121 |
| 328 | Ga0207650_11085101 | 3300025925 | Unclassified | 681 |
| 329 | Ga0207659_10009325 | 3300025926 | Bacteria | 6128 |
| 330 | Ga0207659_10011060 | 3300025926 | Bacteria | 5689 |
| 331 | Ga0207659_10065358 | 3300025926 | Unclassified | 2636 |
| 332 | Ga0207659_10147021 | 3300025926 | Unclassified | 1836 |
| 333 | Ga0207687_11669833 | 3300025927 | Unclassified | 546 |
| 334 | Ga0207644_11827978 | 3300025931 | Bacteria | 508 |
| 335 | Ga0207690_10058404 | 3300025932 | Unclassified | 2609 |
| 336 | Ga0207706_10018937 | 3300025933 | Bacteria | 6191 |
| 337 | Ga0207706_10127436 | 3300025933 | Bacteria | 2238 |
| 338 | Ga0207706_10624306 | 3300025933 | Unclassified | 924 |
| 339 | Ga0207670_10210737 | 3300025936 | Unclassified | 1482 |
| 340 | Ga0207670_11072962 | 3300025936 | Unclassified | 679 |
| 341 | Ga0207669_10026677 | 3300025937 | Unclassified | 3148 |
| 342 | Ga0207669_10859175 | 3300025937 | Bacteria | 756 |
| 343 | Ga0207669_11585612 | 3300025937 | Unclassified | 559 |
| 344 | Ga0207704_10519042 | 3300025938 | Bacteria | 963 |
| 345 | Ga0207704_10859357 | 3300025938 | Bacteria | 761 |
| 346 | Ga0207704_11257604 | 3300025938 | Unclassified | 632 |
| 347 | Ga0207704_11906644 | 3300025938 | Unclassified | 511 |
| 348 | Ga0207691_10003015 | 3300025940 | Bacteria | 16440 |
| 349 | Ga0207691_10033543 | 3300025940 | Bacteria | 4779 |
| 350 | Ga0207691_10036150 | 3300025940 | Bacteria | 4577 |
| 351 | Ga0207691_10745213 | 3300025940 | Unclassified | 825 |
| 352 | Ga0207691_11632382 | 3300025940 | Unclassified | 523 |
| 353 | Ga0207711_10088205 | 3300025941 | Unclassified | 2723 |
| 354 | Ga0207711_10621459 | 3300025941 | Unclassified | 1008 |
| 355 | Ga0207689_10005330 | 3300025942 | Bacteria | 11529 |
| 356 | Ga0207689_10146139 | 3300025942 | Bacteria | 1948 |
| 357 | Ga0207651_10043416 | 3300025960 | Unclassified | 3000 |
| 358 | Ga0207651_10585964 | 3300025960 | Bacteria | 973 |
| 359 | Ga0207651_11882977 | 3300025960 | Unclassified | 538 |
| 360 | Ga0207712_10169778 | 3300025961 | Unclassified | 1704 |
| 361 | Ga0207712_10590385 | 3300025961 | Unclassified | 960 |
| 362 | Ga0207712_11625460 | 3300025961 | Bacteria | 579 |
| 363 | Ga0207668_10066538 | 3300025972 | Unclassified | 2555 |
| 364 | Ga0207658_10315696 | 3300025986 | Bacteria | 1351 |
| 365 | Ga0207677_10243954 | 3300026023 | Unclassified | 1455 |
| 366 | Ga0207677_11100082 | 3300026023 | Bacteria | 724 |
| 367 | Ga0207703_10256353 | 3300026035 | Unclassified | 1579 |
| 368 | Ga0207678_10332542 | 3300026067 | Bacteria | 1308 |
| 369 | Ga0207678_11585048 | 3300026067 | Unclassified | 577 |
| 370 | Ga0207708_10318851 | 3300026075 | Bacteria | 1268 |
| 371 | Ga0207708_10320950 | 3300026075 | Bacteria | 1264 |
| 372 | Ga0207708_10789170 | 3300026075 | Bacteria | 817 |
| 373 | Ga0207702_11969302 | 3300026078 | Unclassified | 575 |
| 374 | Ga0207641_10028662 | 3300026088 | Bacteria | 4601 |
| 375 | Ga0207641_10128653 | 3300026088 | Bacteria | 2271 |
| 376 | Ga0207648_10008442 | 3300026089 | Bacteria | 9976 |
| 377 | Ga0207648_10172182 | 3300026089 | Bacteria | 1914 |
| 378 | Ga0207648_10260051 | 3300026089 | Bacteria | 1549 |
| 379 | Ga0207648_10360139 | 3300026089 | Bacteria | 1312 |
| 380 | Ga0207676_10092442 | 3300026095 | Bacteria | 2488 |
| 381 | Ga0207676_10281520 | 3300026095 | Unclassified | 1510 |
| 382 | Ga0207676_10299317 | 3300026095 | Unclassified | 1468 |
| 383 | Ga0207676_10596798 | 3300026095 | Unclassified | 1060 |
| 384 | Ga0207676_11092619 | 3300026095 | Bacteria | 788 |
| 385 | Ga0207676_11238122 | 3300026095 | Unclassified | 740 |
| 386 | Ga0207674_10068664 | 3300026116 | Bacteria | 3566 |
| 387 | Ga0207675_100001490 | 3300026118 | Bacteria | 23487 |
| 388 | Ga0207675_100119983 | 3300026118 | Bacteria | 2487 |
| 389 | Ga0207675_100574183 | 3300026118 | Unclassified | 1129 |
| 390 | Ga0207675_100676349 | 3300026118 | Unclassified | 1040 |
| 391 | Ga0207675_101388030 | 3300026118 | Bacteria | 723 |
| 392 | Ga0207683_10005514 | 3300026121 | Bacteria | 10845 |
| 393 | Ga0207683_10380646 | 3300026121 | Bacteria | 1297 |
| 394 | Ga0207683_10643931 | 3300026121 | Unclassified | 982 |
| 395 | Ga0207683_11319020 | 3300026121 | Unclassified | 668 |
| 396 | Ga0207698_10480637 | 3300026142 | Bacteria | 1205 |
| 397 | Ga0207698_12050030 | 3300026142 | Unclassified | 586 |
| 398 | Ga0209973_1035219 | 3300027252 | Bacteria | 719 |
| 399 | Ga0209995_1033233 | 3300027471 | Unclassified | 866 |
| 400 | Ga0209970_1094118 | 3300027614 | Unclassified | 570 |
| 401 | Ga0209966_1051884 | 3300027695 | Unclassified | 874 |
| 402 | Ga0209998_10207626 | 3300027717 | Unclassified | 513 |
| 403 | Ga0209974_10419149 | 3300027876 | Bacteria | 528 |
| 404 | Ga0207428_10000236 | 3300027907 | Bacteria | 75764 |
| 405 | Ga0207428_10018461 | 3300027907 | Bacteria | 5956 |
| 406 | Ga0207428_10039349 | 3300027907 | Bacteria | 3840 |
| 407 | Ga0207428_10071417 | 3300027907 | Bacteria | 2726 |
| 408 | Ga0207428_10199899 | 3300027907 | Bacteria | 1504 |
| 409 | Ga0207428_10427500 | 3300027907 | Bacteria | 967 |
| 410 | Ga0207428_10830411 | 3300027907 | Unclassified | 655 |
| 411 | Ga0268266_10206222 | 3300028379 | Unclassified | 1801 |
| 412 | Ga0268265_10062056 | 3300028380 | Unclassified | 2870 |
| 413 | Ga0268265_10569019 | 3300028380 | Bacteria | 1078 |
| 414 | Ga0268265_11015422 | 3300028380 | Bacteria | 820 |
| 415 | Ga0268265_11041903 | 3300028380 | Unclassified | 810 |
| 416 | Ga0268265_11101254 | 3300028380 | Bacteria | 788 |
| 417 | Ga0268265_11937260 | 3300028380 | Bacteria | 596 |
| 418 | Ga0268265_12690850 | 3300028380 | Bacteria | 503 |
| 419 | Ga0268264_10051047 | 3300028381 | Unclassified | 3445 |
| 420 | Ga0268264_10203658 | 3300028381 | Unclassified | 1812 |
| 421 | Ga0268264_11969699 | 3300028381 | Unclassified | 593 |
| 422 | Ga0316182_1112002 | 3300030745 | Bacteria | 786 |
| 423 | Ga0307408_100050590 | 3300031548 | Bacteria | 2989 |
| 424 | Ga0307408_101156895 | 3300031548 | Bacteria | 720 |
| 425 | Ga0307408_101629401 | 3300031548 | Bacteria | 613 |
| 426 | Ga0307405_10089035 | 3300031731 | Unclassified | 2038 |
| 427 | Ga0307413_10245672 | 3300031824 | Unclassified | 1324 |
| 428 | Ga0307413_10686555 | 3300031824 | Bacteria | 849 |
| 429 | Ga0307413_10874059 | 3300031824 | Unclassified | 761 |
| 430 | Ga0307410_10001474 | 3300031852 | Bacteria | 10647 |
| 431 | Ga0307410_10042158 | 3300031852 | Bacteria | 3015 |
| 432 | Ga0307406_10014930 | 3300031901 | Bacteria | 4481 |
| 433 | Ga0307406_10411474 | 3300031901 | Bacteria | 1075 |
| 434 | Ga0307406_11866609 | 3300031901 | Unclassified | 535 |
| 435 | Ga0307407_10003122 | 3300031903 | Bacteria | 6703 |
| 436 | Ga0307407_10364498 | 3300031903 | Bacteria | 1027 |
| 437 | Ga0307412_10026807 | 3300031911 | Bacteria | 3587 |
| 438 | Ga0307412_10043594 | 3300031911 | Bacteria | 2922 |
| 439 | Ga0307412_10406306 | 3300031911 | Bacteria | 1110 |
| 440 | Ga0307409_100138426 | 3300031995 | Bacteria | 2093 |
| 441 | Ga0307409_100514974 | 3300031995 | Bacteria | 1168 |
| 442 | Ga0307409_100572616 | 3300031995 | Unclassified | 1112 |
| 443 | Ga0307409_101169846 | 3300031995 | Bacteria | 792 |
| 444 | Ga0307416_100012197 | 3300032002 | Bacteria | 5775 |
| 445 | Ga0307416_100050094 | 3300032002 | Bacteria | 3326 |
| 446 | Ga0307416_100053309 | 3300032002 | Unclassified | 3244 |
| 447 | Ga0307416_100806477 | 3300032002 | Unclassified | 1035 |
| 448 | Ga0307416_101219836 | 3300032002 | Unclassified | 858 |
| 449 | Ga0307416_101366798 | 3300032002 | Unclassified | 814 |
| 450 | Ga0307416_102579622 | 3300032002 | Unclassified | 606 |
| 451 | Ga0307411_10004021 | 3300032005 | Bacteria | 6954 |
| 452 | Ga0307411_10756651 | 3300032005 | Bacteria | 852 |
| 453 | Ga0307415_100031497 | 3300032126 | Bacteria | 3417 |
| 454 | Ga0307415_100082865 | 3300032126 | Bacteria | 2296 |
| 455 | Ga0307415_100887134 | 3300032126 | Bacteria | 821 |
| 456 | Ga0373950_0052900 | 3300034818 | Unclassified | 801 |
| 457 | Ga0373938_0247345 | 3300034957 | Unclassified | 509 |
| 458 | Ga0373940_0025660 | 3300035088 | Unclassified | 1536 |
| 459 | Ga0373932_0026007 | 3300035112 | Unclassified | 1589 |
| 460 | Ga0373962_0174023 | 3300035242 | Unclassified | 716 |
| 461 | Ga0373931_0573605 | 3300035691 | Unclassified | 735 |
| 462 | Ga0373933_0340623 | 3300035724 | Unclassified | 973 |
| 463 | Ga0395901_1213230 | 3300038443 | Bacteria | 720 |
| 464 | Ga0439453_0077842 | 3300041408 | Unclassified | 711 |
| 465 | Ga0439443_018376 | 3300042003 | Unclassified | 1082 |
| 466 | Ga0450920_039213 | 3300042122 | Bacteria | 943 |
| 467 | Ga0450923_100863 | 3300042125 | Bacteria | 666 |
| 468 | Ga0450890_033880 | 3300042127 | Bacteria | 736 |
| 469 | Ga0439446_0320156 | 3300042156 | Unclassified | 548 |
| 470 | Ga0450908_018712 | 3300042184 | Bacteria | 1222 |
| 471 | Ga0450908_030068 | 3300042184 | Bacteria | 944 |
| 472 | Ga0439435_0107464 | 3300042436 | Bacteria | 863 |
| 473 | Ga0439435_0185199 | 3300042436 | Unclassified | 681 |
| 474 | Ga0439444_0071978 | 3300042437 | Unclassified | 742 |
| 475 | Ga0439459_0012378 | 3300042438 | Bacteria | 1519 |
| 476 | Ga0439464_0130179 | 3300042439 | Unclassified | 779 |
| 477 | Ga0439460_0286741 | 3300042461 | Unclassified | 574 |
| 478 | Ga0439460_0318293 | 3300042461 | Unclassified | 546 |
| 479 | Ga0439440_0044918 | 3300042993 | Unclassified | 1088 |
| 480 | Ga0453683_0152923 | 3300044673 | Bacteria | 1458 |
| 481 | Ga0451576_1477861 | 3300045051 | Unclassified | 706 |
| 482 | Ga0451576_1833955 | 3300045051 | Unclassified | 626 |
| 483 | Ga0495592_0786021 | 3300046454 | Unclassified | 566 |
| 484 | Ga0495603_0555086 | 3300046455 | Unclassified | 658 |
| 485 | Ga0495651_0841472 | 3300046462 | Unclassified | 564 |
| 486 | Ga0495594_0301321 | 3300046499 | Unclassified | 913 |
| 487 | Ga0495587_0396249 | 3300046536 | Unclassified | 767 |
| 488 | Ga0495598_0026687 | 3300046537 | Bacteria | 1586 |
| 489 | Ga0495645_0488976 | 3300046543 | Unclassified | 771 |
| 490 | Ga0495633_0352240 | 3300046558 | Unclassified | 667 |
| 491 | Ga0495656_0064205 | 3300046615 | Bacteria | 1612 |
| 492 | Ga0495588_0466307 | 3300046674 | Bacteria | 662 |
| 493 | Ga0495599_0312814 | 3300046678 | Bacteria | 946 |
| 494 | Ga0495658_0718066 | 3300046683 | Unclassified | 640 |
| 495 | Ga0495636_0500906 | 3300047318 | Bacteria | 587 |
| 496 | Ga0495674_0222210 | 3300047319 | Bacteria | 1561 |
| 497 | Ga0496104_0257541 | 3300048907 | Bacteria | 1658 |
| 498 | Ga0496104_0472315 | 3300048907 | Bacteria | 1166 |
| 499 | Ga0496109_0027094 | 3300048912 | Bacteria | 5115 |
| 500 | Ga0496109_0174091 | 3300048912 | Bacteria | 2020 |
| 501 | Ga0496110_1617677 | 3300048913 | Bacteria | 558 |
| 502 | Ga0496113_0031209 | 3300048916 | Bacteria | 3865 |
| 503 | Ga0496113_0258607 | 3300048916 | Bacteria | 1391 |
| 504 | Ga0496114_0604608 | 3300048917 | Bacteria | 967 |
| 505 | Ga0501296_025560 | 3300049519 | Bacteria | 774 |
| 506 | Ga0501031_0950598 | 3300049568 | Bacteria | 550 |
| 507 | Ga0501038_0231165 | 3300049574 | Bacteria | 1472 |
| 508 | Ga0501039_1040471 | 3300049575 | Bacteria | 635 |
| 509 | Ga0501041_0197209 | 3300049577 | Bacteria | 1262 |
| 510 | Ga0501042_0701312 | 3300049578 | Unclassified | 736 |
| 511 | Ga0501043_1309408 | 3300049579 | Unclassified | 505 |
| 512 | Ga0501072_1342778 | 3300049588 | Bacteria | 554 |
| 513 | Ga0501072_1343573 | 3300049588 | Bacteria | 553 |
| 514 | Ga0501073_0434877 | 3300049589 | Bacteria | 907 |
| 515 | Ga0501076_0515301 | 3300049592 | Unclassified | 986 |
| 516 | Ga0501076_0524112 | 3300049592 | Bacteria | 977 |
| 517 | Ga0501077_0378687 | 3300049593 | Bacteria | 904 |
| 518 | Ga0501202_192227 | 3300049652 | Unclassified | 555 |
| 519 | Ga0501207_010342 | 3300049654 | Bacteria | 1375 |
| 520 | Ga0501216_132157 | 3300049660 | Unclassified | 580 |
| 521 | Ga0501257_173845 | 3300049686 | Unclassified | 606 |
| 522 | Ga0501081_0204551 | 3300049743 | Bacteria | 1433 |
| 523 | nmdc:mga05p37_1154181_c1 | 3300050507 | Bacteria | 805 |
| 524 | nmdc:mga05p37_122217_c1 | 3300050507 | Bacteria | 3198 |
| 525 | nmdc:mga05p37_1281567_c1 | 3300050507 | Bacteria | 749 |
| 526 | nmdc:mga05p37_2088889_c1 | 3300050507 | Bacteria | 531 |
| 527 | nmdc:mga05p37_25392_c1 | 3300050507 | Bacteria | 7205 |
| 528 | nmdc:mga05p37_284354_c1 | 3300050507 | Bacteria | 1971 |
| 529 | nmdc:mga05p37_543844_c1 | 3300050507 | Bacteria | 1324 |
| 530 | nmdc:mga05p37_588114_c1 | 3300050507 | Bacteria | 1259 |
| 531 | nmdc:mga05p37_77896_c1 | 3300050507 | Bacteria | 4081 |
| 532 | nmdc:mga09592_1071885_c1 | 3300050508 | Unclassified | 671 |
| 533 | nmdc:mga09592_10726_c1 | 3300050508 | Bacteria | 7459 |
| 534 | nmdc:mga09592_10824_c2 | 3300050508 | Bacteria | 3363 |
| 535 | nmdc:mga09592_1276253_c1 | 3300050508 | Bacteria | 605 |
| 536 | nmdc:mga09592_2708_c1 | 3300050508 | Bacteria | 14322 |
| 537 | nmdc:mga09592_999746_c1 | 3300050508 | Bacteria | 699 |
| 538 | nmdc:mga0qj67_10168_c1 | 3300050509 | Bacteria | 7025 |
| 539 | nmdc:mga0qj67_136371_c1 | 3300050509 | Bacteria | 1989 |
| 540 | nmdc:mga0qj67_154761_c1 | 3300050509 | Bacteria | 1860 |
| 541 | nmdc:mga0qj67_272953_c1 | 3300050509 | Bacteria | 1371 |
| 542 | nmdc:mga0qj67_37991_c2 | 3300050509 | Bacteria | 3390 |
| 543 | nmdc:mga0qj67_409874_c1 | 3300050509 | Unclassified | 1093 |
| 544 | nmdc:mga06r32_1357207_c1 | 3300050510 | Bacteria | 654 |
| 545 | nmdc:mga06r32_75345_c1 | 3300050510 | Bacteria | 3274 |
| 546 | nmdc:mga06r32_79871_c1 | 3300050510 | Bacteria | 3182 |
| 547 | nmdc:mga08y16_10088_c1 | 3300050511 | Bacteria | 9916 |
| 548 | nmdc:mga08y16_10550_c1 | 3300050511 | Bacteria | 9697 |
| 549 | nmdc:mga08y16_140137_c1 | 3300050511 | Bacteria | 2514 |
| 550 | nmdc:mga08y16_1558_c1 | 3300050511 | Bacteria | 23104 |
| 551 | nmdc:mga08y16_158584_c1 | 3300050511 | Bacteria | 2351 |
| 552 | nmdc:mga08y16_209402_c1 | 3300050511 | Bacteria | 2019 |
| 553 | nmdc:mga08y16_256435_c1 | 3300050511 | Bacteria | 1806 |
| 554 | nmdc:mga08y16_499408_c1 | 3300050511 | Unclassified | 1236 |
| 555 | nmdc:mga08y16_86309_c1 | 3300050511 | Bacteria | 3271 |
| 556 | nmdc:mga0n895_15386_c1 | 3300050512 | Bacteria | 6972 |
| 557 | nmdc:mga0n895_32944_c1 | 3300050512 | Bacteria | 4976 |
| 558 | nmdc:mga0n895_368861_c1 | 3300050512 | Bacteria | 1454 |
| 559 | nmdc:mga0rr50_138461_c1 | 3300050513 | Bacteria | 1956 |
| 560 | nmdc:mga0rr50_706693_c1 | 3300050513 | Bacteria | 860 |
| 561 | nmdc:mga08x19_1079884_c1 | 3300050514 | Unclassified | 570 |
| 562 | nmdc:mga0a205_118878_c1 | 3300050515 | Bacteria | 2541 |
| 563 | nmdc:mga0a205_166964_c1 | 3300050515 | Unclassified | 2097 |
| 564 | nmdc:mga0a205_404076_c1 | 3300050515 | Bacteria | 1230 |
| 565 | nmdc:mga0a205_679082_c1 | 3300050515 | Bacteria | 880 |
| 566 | Ga0501084_1865161 | 3300054114 | Unclassified | 502 |
| 567 | Ga0530510_1053918 | 3300061734 | Unclassified | 623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025960 | Ga0207651_11882977 | Ga0207651_118829771 | 78 |
| 2 | 3300005337 | Ga0070682_100347562 | Ga0070682_1003475621 | 86 |
| 3 | 3300005617 | Ga0068859_100787437 | Ga0068859_1007874371 | 86 |
| 4 | 3300006931 | Ga0097620_100787229 | Ga0097620_1007872292 | 86 |
| 5 | 3300009093 | Ga0105240_10015432 | Ga0105240_100154324 | 86 |
| 6 | 3300009176 | Ga0105242_12241914 | Ga0105242_122419141 | 86 |
| 7 | 3300005295 | Ga0065707_10118375 | Ga0065707_101183752 | 87 |
| 8 | 3300005330 | Ga0070690_100178879 | Ga0070690_1001788792 | 87 |
| 9 | 3300005843 | Ga0068860_101588018 | Ga0068860_1015880182 | 87 |
| 10 | 3300006844 | Ga0075428_100024130 | Ga0075428_1000241304 | 87 |
| 11 | 3300006852 | Ga0075433_10060674 | Ga0075433_100606743 | 87 |
| 12 | 3300010159 | Ga0099796_10241392 | Ga0099796_102413921 | 87 |
| 13 | 3300025940 | Ga0207691_11632382 | Ga0207691_116323821 | 87 |
| 14 | 3300027907 | Ga0207428_10199899 | Ga0207428_101998992 | 87 |
| 15 | 3300005289 | Ga0065704_10658794 | Ga0065704_106587941 | 88 |
| 16 | 3300005331 | Ga0070670_101739731 | Ga0070670_1017397311 | 88 |
| 17 | 3300005340 | Ga0070689_100219776 | Ga0070689_1002197762 | 88 |
| 18 | 3300005347 | Ga0070668_100090405 | Ga0070668_1000904053 | 88 |
| 19 | 3300005353 | Ga0070669_100714246 | Ga0070669_1007142462 | 88 |
| 20 | 3300005354 | Ga0070675_100069390 | Ga0070675_1000693902 | 88 |
| 21 | 3300005365 | Ga0070688_100786295 | Ga0070688_1007862952 | 88 |
| 22 | 3300005367 | Ga0070667_100099133 | Ga0070667_1000991334 | 88 |
| 23 | 3300005456 | Ga0070678_101160205 | Ga0070678_1011602052 | 88 |
| 24 | 3300005457 | Ga0070662_100585745 | Ga0070662_1005857452 | 88 |
| 25 | 3300005543 | Ga0070672_101322209 | Ga0070672_1013222092 | 88 |
| 26 | 3300005544 | Ga0070686_100411412 | Ga0070686_1004114121 | 88 |
| 27 | 3300005544 | Ga0070686_100541762 | Ga0070686_1005417622 | 88 |
| 28 | 3300005548 | Ga0070665_100491356 | Ga0070665_1004913562 | 88 |
| 29 | 3300005549 | Ga0070704_100114053 | Ga0070704_1001140532 | 88 |
| 30 | 3300005578 | Ga0068854_100882347 | Ga0068854_1008823472 | 88 |
| 31 | 3300005617 | Ga0068859_100048797 | Ga0068859_1000487973 | 88 |
| 32 | 3300005617 | Ga0068859_101444286 | Ga0068859_1014442862 | 88 |
| 33 | 3300005617 | Ga0068859_102013246 | Ga0068859_1020132462 | 88 |
| 34 | 3300005618 | Ga0068864_100603003 | Ga0068864_1006030032 | 88 |
| 35 | 3300005719 | Ga0068861_100294418 | Ga0068861_1002944182 | 88 |
| 36 | 3300005719 | Ga0068861_100411480 | Ga0068861_1004114802 | 88 |
| 37 | 3300005843 | Ga0068860_100054699 | Ga0068860_1000546992 | 88 |
| 38 | 3300005844 | Ga0068862_101598092 | Ga0068862_1015980922 | 88 |
| 39 | 3300006844 | Ga0075428_102200606 | Ga0075428_1022006061 | 88 |
| 40 | 3300006846 | Ga0075430_100698472 | Ga0075430_1006984721 | 88 |
| 41 | 3300006880 | Ga0075429_101259609 | Ga0075429_1012596091 | 88 |
| 42 | 3300006881 | Ga0068865_101627352 | Ga0068865_1016273522 | 88 |
| 43 | 3300006931 | Ga0097620_100048797 | Ga0097620_1000487974 | 88 |
| 44 | 3300006931 | Ga0097620_101443996 | Ga0097620_1014439961 | 88 |
| 45 | 3300006931 | Ga0097620_102013397 | Ga0097620_1020133972 | 88 |
| 46 | 3300009094 | Ga0111539_10001176 | Ga0111539_100011763 | 88 |
| 47 | 3300009147 | Ga0114129_10446193 | Ga0114129_104461932 | 88 |
| 48 | 3300009176 | Ga0105242_10556744 | Ga0105242_105567442 | 88 |
| 49 | 3300009177 | Ga0105248_10027232 | Ga0105248_100272323 | 88 |
| 50 | 3300009177 | Ga0105248_11032901 | Ga0105248_110329012 | 88 |
| 51 | 3300013306 | Ga0163162_10264816 | Ga0163162_102648162 | 88 |
| 52 | 3300014326 | Ga0157380_10195247 | Ga0157380_101952472 | 88 |
| 53 | 3300014745 | Ga0157377_10606549 | Ga0157377_106065492 | 88 |
| 54 | 3300025923 | Ga0207681_10438607 | Ga0207681_104386073 | 88 |
| 55 | 3300025923 | Ga0207681_10669713 | Ga0207681_106697132 | 88 |
| 56 | 3300025927 | Ga0207687_11669833 | Ga0207687_116698331 | 88 |
| 57 | 3300025933 | Ga0207706_10127436 | Ga0207706_101274364 | 88 |
| 58 | 3300025933 | Ga0207706_10624306 | Ga0207706_106243062 | 88 |
| 59 | 3300025936 | Ga0207670_10210737 | Ga0207670_102107372 | 88 |
| 60 | 3300025937 | Ga0207669_11585612 | Ga0207669_115856121 | 88 |
| 61 | 3300025938 | Ga0207704_11257604 | Ga0207704_112576042 | 88 |
| 62 | 3300025941 | Ga0207711_10088205 | Ga0207711_100882054 | 88 |
| 63 | 3300025961 | Ga0207712_10590385 | Ga0207712_105903852 | 88 |
| 64 | 3300025972 | Ga0207668_10066538 | Ga0207668_100665383 | 88 |
| 65 | 3300025986 | Ga0207658_10315696 | Ga0207658_103156962 | 88 |
| 66 | 3300026089 | Ga0207648_10172182 | Ga0207648_101721822 | 88 |
| 67 | 3300026095 | Ga0207676_11092619 | Ga0207676_110926192 | 88 |
| 68 | 3300026118 | Ga0207675_100574183 | Ga0207675_1005741831 | 88 |
| 69 | 3300026118 | Ga0207675_100676349 | Ga0207675_1006763493 | 88 |
| 70 | 3300026118 | Ga0207675_101388030 | Ga0207675_1013880302 | 88 |
| 71 | 3300026121 | Ga0207683_11319020 | Ga0207683_113190201 | 88 |
| 72 | 3300027471 | Ga0209995_1033233 | Ga0209995_10332332 | 88 |
| 73 | 3300027695 | Ga0209966_1051884 | Ga0209966_10518842 | 88 |
| 74 | 3300027717 | Ga0209998_10207626 | Ga0209998_102076261 | 88 |
| 75 | 3300027907 | Ga0207428_10018461 | Ga0207428_100184613 | 88 |
| 76 | 3300027907 | Ga0207428_10830411 | Ga0207428_108304112 | 88 |
| 77 | 3300028380 | Ga0268265_11041903 | Ga0268265_110419032 | 88 |
| 78 | 3300028380 | Ga0268265_11937260 | Ga0268265_119372601 | 88 |
| 79 | 3300028381 | Ga0268264_10051047 | Ga0268264_100510472 | 88 |
| 80 | 3300028381 | Ga0268264_11969699 | Ga0268264_119696992 | 88 |
| 81 | 3300030745 | Ga0316182_1112002 | Ga0316182_11120022 | 88 |
| 82 | 3300031548 | Ga0307408_100050590 | Ga0307408_1000505904 | 88 |
| 83 | 3300031731 | Ga0307405_10089035 | Ga0307405_100890353 | 88 |
| 84 | 3300031824 | Ga0307413_10245672 | Ga0307413_102456722 | 88 |
| 85 | 3300031824 | Ga0307413_10874059 | Ga0307413_108740592 | 88 |
| 86 | 3300031852 | Ga0307410_10001474 | Ga0307410_100014745 | 88 |
| 87 | 3300031901 | Ga0307406_10014930 | Ga0307406_100149302 | 88 |
| 88 | 3300031901 | Ga0307406_11866609 | Ga0307406_118666091 | 88 |
| 89 | 3300031903 | Ga0307407_10003122 | Ga0307407_100031225 | 88 |
| 90 | 3300031911 | Ga0307412_10043594 | Ga0307412_100435942 | 88 |
| 91 | 3300031995 | Ga0307409_100138426 | Ga0307409_1001384263 | 88 |
| 92 | 3300031995 | Ga0307409_100572616 | Ga0307409_1005726161 | 88 |
| 93 | 3300032002 | Ga0307416_100050094 | Ga0307416_1000500944 | 88 |
| 94 | 3300032002 | Ga0307416_100053309 | Ga0307416_1000533091 | 88 |
| 95 | 3300032002 | Ga0307416_101219836 | Ga0307416_1012198362 | 88 |
| 96 | 3300032005 | Ga0307411_10004021 | Ga0307411_100040212 | 88 |
| 97 | 3300032126 | Ga0307415_100031497 | Ga0307415_1000314974 | 88 |
| 98 | 3300035724 | Ga0373933_0340623 | Ga0373933_0340623_532_801 | 88 |
| 99 | 3300041408 | Ga0439453_0077842 | Ga0439453_0077842_289_555 | 88 |
| 100 | 3300042156 | Ga0439446_0320156 | Ga0439446_0320156_47_313 | 88 |
| 101 | 3300046454 | Ga0495592_0786021 | Ga0495592_0786021_83_352 | 88 |
| 102 | 3300046462 | Ga0495651_0841472 | Ga0495651_0841472_199_468 | 88 |
| 103 | 3300046536 | Ga0495587_0396249 | Ga0495587_0396249_96_365 | 88 |
| 104 | 3300046543 | Ga0495645_0488976 | Ga0495645_0488976_490_759 | 88 |
| 105 | 3300046678 | Ga0495599_0312814 | Ga0495599_0312814_520_789 | 88 |
| 106 | 3300049589 | Ga0501073_0434877 | Ga0501073_0434877_465_731 | 88 |
| 107 | 3300050507 | nmdc:mga05p37_1281567_c1 | nmdc:mga05p37_1281567_c1_264_530 | 88 |
| 108 | 3300050511 | nmdc:mga08y16_140137_c1 | nmdc:mga08y16_140137_c1_2028_2294 | 88 |
| 109 | 3300050511 | nmdc:mga08y16_1558_c1 | nmdc:mga08y16_1558_c1_20995_21261 | 88 |
| 110 | 2162886012 | MBSR1b_contig_11812573 | MBSR1b_0128.00004520 | 89 |
| 111 | 3300004801 | Ga0058860_12175475 | Ga0058860_121754751 | 89 |
| 112 | 3300005288 | Ga0065714_10292723 | Ga0065714_102927232 | 89 |
| 113 | 3300005289 | Ga0065704_10450404 | Ga0065704_104504042 | 89 |
| 114 | 3300005290 | Ga0065712_10000157 | Ga0065712_100001577 | 89 |
| 115 | 3300005290 | Ga0065712_10099250 | Ga0065712_100992501 | 89 |
| 116 | 3300005290 | Ga0065712_10796277 | Ga0065712_107962771 | 89 |
| 117 | 3300005293 | Ga0065715_10449556 | Ga0065715_104495561 | 89 |
| 118 | 3300005295 | Ga0065707_10100639 | Ga0065707_101006394 | 89 |
| 119 | 3300005295 | Ga0065707_10401373 | Ga0065707_104013732 | 89 |
| 120 | 3300005328 | Ga0070676_10002732 | Ga0070676_100027327 | 89 |
| 121 | 3300005330 | Ga0070690_100138128 | Ga0070690_1001381281 | 89 |
| 122 | 3300005330 | Ga0070690_100266220 | Ga0070690_1002662202 | 89 |
| 123 | 3300005330 | Ga0070690_100321250 | Ga0070690_1003212502 | 89 |
| 124 | 3300005330 | Ga0070690_100663726 | Ga0070690_1006637262 | 89 |
| 125 | 3300005331 | Ga0070670_100095821 | Ga0070670_1000958213 | 89 |
| 126 | 3300005331 | Ga0070670_100435054 | Ga0070670_1004350542 | 89 |
| 127 | 3300005333 | Ga0070677_10003227 | Ga0070677_100032277 | 89 |
| 128 | 3300005333 | Ga0070677_10049033 | Ga0070677_100490332 | 89 |
| 129 | 3300005334 | Ga0068869_100581096 | Ga0068869_1005810962 | 89 |
| 130 | 3300005334 | Ga0068869_100822610 | Ga0068869_1008226101 | 89 |
| 131 | 3300005335 | Ga0070666_10002058 | Ga0070666_100020588 | 89 |
| 132 | 3300005335 | Ga0070666_11110198 | Ga0070666_111101982 | 89 |
| 133 | 3300005335 | Ga0070666_11325561 | Ga0070666_113255612 | 89 |
| 134 | 3300005336 | Ga0070680_100215371 | Ga0070680_1002153712 | 89 |
| 135 | 3300005336 | Ga0070680_100724390 | Ga0070680_1007243902 | 89 |
| 136 | 3300005337 | Ga0070682_100925485 | Ga0070682_1009254851 | 89 |
| 137 | 3300005338 | Ga0068868_100420654 | Ga0068868_1004206542 | 89 |
| 138 | 3300005338 | Ga0068868_101342716 | Ga0068868_1013427162 | 89 |
| 139 | 3300005339 | Ga0070660_101541518 | Ga0070660_1015415182 | 89 |
| 140 | 3300005340 | Ga0070689_100037709 | Ga0070689_1000377092 | 89 |
| 141 | 3300005340 | Ga0070689_100098826 | Ga0070689_1000988262 | 89 |
| 142 | 3300005340 | Ga0070689_100421749 | Ga0070689_1004217492 | 89 |
| 143 | 3300005341 | Ga0070691_10289425 | Ga0070691_102894252 | 89 |
| 144 | 3300005343 | Ga0070687_100010126 | Ga0070687_1000101264 | 89 |
| 145 | 3300005343 | Ga0070687_100600785 | Ga0070687_1006007852 | 89 |
| 146 | 3300005344 | Ga0070661_100018283 | Ga0070661_1000182834 | 89 |
| 147 | 3300005344 | Ga0070661_100285848 | Ga0070661_1002858482 | 89 |
| 148 | 3300005345 | Ga0070692_10046272 | Ga0070692_100462721 | 89 |
| 149 | 3300005345 | Ga0070692_11339184 | Ga0070692_113391842 | 89 |
| 150 | 3300005347 | Ga0070668_100077184 | Ga0070668_1000771844 | 89 |
| 151 | 3300005347 | Ga0070668_100338528 | Ga0070668_1003385282 | 89 |
| 152 | 3300005353 | Ga0070669_100004330 | Ga0070669_1000043301 | 89 |
| 153 | 3300005353 | Ga0070669_100317993 | Ga0070669_1003179931 | 89 |
| 154 | 3300005353 | Ga0070669_100466161 | Ga0070669_1004661612 | 89 |
| 155 | 3300005353 | Ga0070669_101400909 | Ga0070669_1014009091 | 89 |
| 156 | 3300005353 | Ga0070669_101886647 | Ga0070669_1018866471 | 89 |
| 157 | 3300005354 | Ga0070675_100015380 | Ga0070675_1000153802 | 89 |
| 158 | 3300005354 | Ga0070675_100020507 | Ga0070675_1000205074 | 89 |
| 159 | 3300005354 | Ga0070675_100065654 | Ga0070675_1000656544 | 89 |
| 160 | 3300005354 | Ga0070675_100828104 | Ga0070675_1008281042 | 89 |
| 161 | 3300005355 | Ga0070671_101243697 | Ga0070671_1012436971 | 89 |
| 162 | 3300005356 | Ga0070674_100233167 | Ga0070674_1002331672 | 89 |
| 163 | 3300005364 | Ga0070673_100017267 | Ga0070673_1000172672 | 89 |
| 164 | 3300005364 | Ga0070673_100153102 | Ga0070673_1001531023 | 89 |
| 165 | 3300005364 | Ga0070673_100721151 | Ga0070673_1007211512 | 89 |
| 166 | 3300005364 | Ga0070673_100810870 | Ga0070673_1008108701 | 89 |
| 167 | 3300005365 | Ga0070688_100062307 | Ga0070688_1000623072 | 89 |
| 168 | 3300005365 | Ga0070688_100083133 | Ga0070688_1000831332 | 89 |
| 169 | 3300005365 | Ga0070688_100118734 | Ga0070688_1001187343 | 89 |
| 170 | 3300005365 | Ga0070688_100345739 | Ga0070688_1003457392 | 89 |
| 171 | 3300005366 | Ga0070659_100154135 | Ga0070659_1001541352 | 89 |
| 172 | 3300005366 | Ga0070659_100945344 | Ga0070659_1009453441 | 89 |
| 173 | 3300005367 | Ga0070667_100634342 | Ga0070667_1006343422 | 89 |
| 174 | 3300005438 | Ga0070701_10041587 | Ga0070701_100415872 | 89 |
| 175 | 3300005438 | Ga0070701_10316566 | Ga0070701_103165661 | 89 |
| 176 | 3300005439 | Ga0070711_100321012 | Ga0070711_1003210122 | 89 |
| 177 | 3300005440 | Ga0070705_100549046 | Ga0070705_1005490462 | 89 |
| 178 | 3300005440 | Ga0070705_100992109 | Ga0070705_1009921091 | 89 |
| 179 | 3300005441 | Ga0070700_100043287 | Ga0070700_1000432872 | 89 |
| 180 | 3300005441 | Ga0070700_100576587 | Ga0070700_1005765871 | 89 |
| 181 | 3300005441 | Ga0070700_101146552 | Ga0070700_1011465521 | 89 |
| 182 | 3300005444 | Ga0070694_100776216 | Ga0070694_1007762161 | 89 |
| 183 | 3300005444 | Ga0070694_100941101 | Ga0070694_1009411012 | 89 |
| 184 | 3300005444 | Ga0070694_100947348 | Ga0070694_1009473482 | 89 |
| 185 | 3300005445 | Ga0070708_101925431 | Ga0070708_1019254311 | 89 |
| 186 | 3300005455 | Ga0070663_100996421 | Ga0070663_1009964212 | 89 |
| 187 | 3300005456 | Ga0070678_100061768 | Ga0070678_1000617683 | 89 |
| 188 | 3300005456 | Ga0070678_100126106 | Ga0070678_1001261062 | 89 |
| 189 | 3300005456 | Ga0070678_100608849 | Ga0070678_1006088491 | 89 |
| 190 | 3300005456 | Ga0070678_101275804 | Ga0070678_1012758041 | 89 |
| 191 | 3300005456 | Ga0070678_102081309 | Ga0070678_1020813091 | 89 |
| 192 | 3300005457 | Ga0070662_100015586 | Ga0070662_1000155866 | 89 |
| 193 | 3300005458 | Ga0070681_10047573 | Ga0070681_100475732 | 89 |
| 194 | 3300005459 | Ga0068867_100011383 | Ga0068867_1000113835 | 89 |
| 195 | 3300005459 | Ga0068867_100312007 | Ga0068867_1003120072 | 89 |
| 196 | 3300005466 | Ga0070685_10002152 | Ga0070685_100021522 | 89 |
| 197 | 3300005467 | Ga0070706_100071653 | Ga0070706_1000716533 | 89 |
| 198 | 3300005468 | Ga0070707_100075015 | Ga0070707_1000750153 | 89 |
| 199 | 3300005468 | Ga0070707_100350536 | Ga0070707_1003505362 | 89 |
| 200 | 3300005471 | Ga0070698_100069962 | Ga0070698_1000699622 | 89 |
| 201 | 3300005471 | Ga0070698_100992958 | Ga0070698_1009929582 | 89 |
| 202 | 3300005518 | Ga0070699_100283005 | Ga0070699_1002830052 | 89 |
| 203 | 3300005518 | Ga0070699_100760290 | Ga0070699_1007602902 | 89 |
| 204 | 3300005530 | Ga0070679_100091085 | Ga0070679_1000910852 | 89 |
| 205 | 3300005535 | Ga0070684_100403721 | Ga0070684_1004037212 | 89 |
| 206 | 3300005536 | Ga0070697_100173734 | Ga0070697_1001737342 | 89 |
| 207 | 3300005543 | Ga0070672_100048249 | Ga0070672_1000482492 | 89 |
| 208 | 3300005543 | Ga0070672_100090003 | Ga0070672_1000900032 | 89 |
| 209 | 3300005543 | Ga0070672_100409230 | Ga0070672_1004092302 | 89 |
| 210 | 3300005543 | Ga0070672_101243029 | Ga0070672_1012430292 | 89 |
| 211 | 3300005543 | Ga0070672_101363096 | Ga0070672_1013630961 | 89 |
| 212 | 3300005544 | Ga0070686_100030006 | Ga0070686_1000300064 | 89 |
| 213 | 3300005544 | Ga0070686_100332548 | Ga0070686_1003325481 | 89 |
| 214 | 3300005544 | Ga0070686_101206284 | Ga0070686_1012062842 | 89 |
| 215 | 3300005545 | Ga0070695_100321726 | Ga0070695_1003217262 | 89 |
| 216 | 3300005546 | Ga0070696_100223184 | Ga0070696_1002231842 | 89 |
| 217 | 3300005547 | Ga0070693_100740435 | Ga0070693_1007404351 | 89 |
| 218 | 3300005548 | Ga0070665_100083489 | Ga0070665_1000834894 | 89 |
| 219 | 3300005548 | Ga0070665_100610085 | Ga0070665_1006100852 | 89 |
| 220 | 3300005549 | Ga0070704_100063426 | Ga0070704_1000634263 | 89 |
| 221 | 3300005549 | Ga0070704_100215805 | Ga0070704_1002158052 | 89 |
| 222 | 3300005549 | Ga0070704_100296862 | Ga0070704_1002968622 | 89 |
| 223 | 3300005549 | Ga0070704_100902106 | Ga0070704_1009021062 | 89 |
| 224 | 3300005549 | Ga0070704_101826326 | Ga0070704_1018263262 | 89 |
| 225 | 3300005564 | Ga0070664_100006238 | Ga0070664_1000062385 | 89 |
| 226 | 3300005564 | Ga0070664_100059268 | Ga0070664_1000592682 | 89 |
| 227 | 3300005564 | Ga0070664_100106703 | Ga0070664_1001067031 | 89 |
| 228 | 3300005564 | Ga0070664_100943615 | Ga0070664_1009436152 | 89 |
| 229 | 3300005577 | Ga0068857_100215386 | Ga0068857_1002153862 | 89 |
| 230 | 3300005577 | Ga0068857_100671882 | Ga0068857_1006718822 | 89 |
| 231 | 3300005615 | Ga0070702_100774808 | Ga0070702_1007748082 | 89 |
| 232 | 3300005615 | Ga0070702_100939524 | Ga0070702_1009395241 | 89 |
| 233 | 3300005615 | Ga0070702_101649028 | Ga0070702_1016490282 | 89 |
| 234 | 3300005616 | Ga0068852_100050124 | Ga0068852_1000501244 | 89 |
| 235 | 3300005617 | Ga0068859_100188780 | Ga0068859_1001887804 | 89 |
| 236 | 3300005617 | Ga0068859_100243264 | Ga0068859_1002432643 | 89 |
| 237 | 3300005617 | Ga0068859_100274759 | Ga0068859_1002747593 | 89 |
| 238 | 3300005617 | Ga0068859_101175476 | Ga0068859_1011754762 | 89 |
| 239 | 3300005618 | Ga0068864_100111047 | Ga0068864_1001110472 | 89 |
| 240 | 3300005618 | Ga0068864_100261602 | Ga0068864_1002616022 | 89 |
| 241 | 3300005618 | Ga0068864_100310920 | Ga0068864_1003109202 | 89 |
| 242 | 3300005618 | Ga0068864_101133557 | Ga0068864_1011335572 | 89 |
| 243 | 3300005719 | Ga0068861_100003257 | Ga0068861_10000325711 | 89 |
| 244 | 3300005719 | Ga0068861_101027323 | Ga0068861_1010273232 | 89 |
| 245 | 3300005840 | Ga0068870_10000409 | Ga0068870_100004099 | 89 |
| 246 | 3300005840 | Ga0068870_10135116 | Ga0068870_101351162 | 89 |
| 247 | 3300005840 | Ga0068870_10621507 | Ga0068870_106215071 | 89 |
| 248 | 3300005841 | Ga0068863_100042106 | Ga0068863_1000421064 | 89 |
| 249 | 3300005841 | Ga0068863_100609731 | Ga0068863_1006097312 | 89 |
| 250 | 3300005842 | Ga0068858_100210597 | Ga0068858_1002105972 | 89 |
| 251 | 3300005843 | Ga0068860_100257794 | Ga0068860_1002577942 | 89 |
| 252 | 3300005843 | Ga0068860_100550420 | Ga0068860_1005504202 | 89 |
| 253 | 3300005844 | Ga0068862_100006569 | Ga0068862_1000065693 | 89 |
| 254 | 3300005844 | Ga0068862_100037927 | Ga0068862_1000379274 | 89 |
| 255 | 3300005844 | Ga0068862_100291411 | Ga0068862_1002914112 | 89 |
| 256 | 3300005844 | Ga0068862_100909470 | Ga0068862_1009094702 | 89 |
| 257 | 3300005844 | Ga0068862_102071741 | Ga0068862_1020717411 | 89 |
| 258 | 3300006058 | Ga0075432_10115023 | Ga0075432_101150232 | 89 |
| 259 | 3300006237 | Ga0097621_100502328 | Ga0097621_1005023282 | 89 |
| 260 | 3300006237 | Ga0097621_101688942 | Ga0097621_1016889421 | 89 |
| 261 | 3300006358 | Ga0068871_100100507 | Ga0068871_1001005072 | 89 |
| 262 | 3300006358 | Ga0068871_100401166 | Ga0068871_1004011661 | 89 |
| 263 | 3300006358 | Ga0068871_100848087 | Ga0068871_1008480871 | 89 |
| 264 | 3300006844 | Ga0075428_100001700 | Ga0075428_10000170023 | 89 |
| 265 | 3300006844 | Ga0075428_100002416 | Ga0075428_1000024167 | 89 |
| 266 | 3300006844 | Ga0075428_100005624 | Ga0075428_1000056243 | 89 |
| 267 | 3300006844 | Ga0075428_100044304 | Ga0075428_1000443043 | 89 |
| 268 | 3300006844 | Ga0075428_100543122 | Ga0075428_1005431222 | 89 |
| 269 | 3300006844 | Ga0075428_100544505 | Ga0075428_1005445052 | 89 |
| 270 | 3300006844 | Ga0075428_100607190 | Ga0075428_1006071902 | 89 |
| 271 | 3300006846 | Ga0075430_100006849 | Ga0075430_1000068494 | 89 |
| 272 | 3300006846 | Ga0075430_100021061 | Ga0075430_1000210612 | 89 |
| 273 | 3300006846 | Ga0075430_100087556 | Ga0075430_1000875562 | 89 |
| 274 | 3300006846 | Ga0075430_100300438 | Ga0075430_1003004382 | 89 |
| 275 | 3300006846 | Ga0075430_100506955 | Ga0075430_1005069552 | 89 |
| 276 | 3300006847 | Ga0075431_100090492 | Ga0075431_1000904922 | 89 |
| 277 | 3300006847 | Ga0075431_100126365 | Ga0075431_1001263652 | 89 |
| 278 | 3300006847 | Ga0075431_100218140 | Ga0075431_1002181403 | 89 |
| 279 | 3300006847 | Ga0075431_100845498 | Ga0075431_1008454982 | 89 |
| 280 | 3300006852 | Ga0075433_10061911 | Ga0075433_100619112 | 89 |
| 281 | 3300006852 | Ga0075433_10232638 | Ga0075433_102326382 | 89 |
| 282 | 3300006852 | Ga0075433_10432161 | Ga0075433_104321612 | 89 |
| 283 | 3300006852 | Ga0075433_10434379 | Ga0075433_104343792 | 89 |
| 284 | 3300006871 | Ga0075434_100062600 | Ga0075434_1000626004 | 89 |
| 285 | 3300006871 | Ga0075434_100085172 | Ga0075434_1000851723 | 89 |
| 286 | 3300006871 | Ga0075434_101373994 | Ga0075434_1013739942 | 89 |
| 287 | 3300006880 | Ga0075429_100001299 | Ga0075429_10000129911 | 89 |
| 288 | 3300006880 | Ga0075429_100021693 | Ga0075429_1000216933 | 89 |
| 289 | 3300006880 | Ga0075429_100022229 | Ga0075429_1000222293 | 89 |
| 290 | 3300006880 | Ga0075429_100057628 | Ga0075429_1000576284 | 89 |
| 291 | 3300006880 | Ga0075429_100220346 | Ga0075429_1002203462 | 89 |
| 292 | 3300006880 | Ga0075429_100481740 | Ga0075429_1004817401 | 89 |
| 293 | 3300006881 | Ga0068865_100335187 | Ga0068865_1003351872 | 89 |
| 294 | 3300006931 | Ga0097620_100188781 | Ga0097620_1001887814 | 89 |
| 295 | 3300006931 | Ga0097620_100243271 | Ga0097620_1002432712 | 89 |
| 296 | 3300006931 | Ga0097620_100274767 | Ga0097620_1002747673 | 89 |
| 297 | 3300006931 | Ga0097620_101175609 | Ga0097620_1011756092 | 89 |
| 298 | 3300007076 | Ga0075435_100024200 | Ga0075435_1000242004 | 89 |
| 299 | 3300007076 | Ga0075435_101357130 | Ga0075435_1013571302 | 89 |
| 300 | 3300007076 | Ga0075435_101746759 | Ga0075435_1017467591 | 89 |
| 301 | 3300009094 | Ga0111539_10007015 | Ga0111539_100070154 | 89 |
| 302 | 3300009094 | Ga0111539_10011819 | Ga0111539_100118192 | 89 |
| 303 | 3300009094 | Ga0111539_10014042 | Ga0111539_100140424 | 89 |
| 304 | 3300009094 | Ga0111539_10085748 | Ga0111539_100857482 | 89 |
| 305 | 3300009094 | Ga0111539_10330824 | Ga0111539_103308243 | 89 |
| 306 | 3300009094 | Ga0111539_10588410 | Ga0111539_105884102 | 89 |
| 307 | 3300009094 | Ga0111539_10742466 | Ga0111539_107424662 | 89 |
| 308 | 3300009094 | Ga0111539_12448957 | Ga0111539_124489571 | 89 |
| 309 | 3300009098 | Ga0105245_10430399 | Ga0105245_104303992 | 89 |
| 310 | 3300009098 | Ga0105245_11409355 | Ga0105245_114093552 | 89 |
| 311 | 3300009101 | Ga0105247_10551484 | Ga0105247_105514842 | 89 |
| 312 | 3300009147 | Ga0114129_10025293 | Ga0114129_100252934 | 89 |
| 313 | 3300009147 | Ga0114129_10108629 | Ga0114129_101086294 | 89 |
| 314 | 3300009147 | Ga0114129_10253277 | Ga0114129_102532772 | 89 |
| 315 | 3300009147 | Ga0114129_10456680 | Ga0114129_104566802 | 89 |
| 316 | 3300009147 | Ga0114129_10555270 | Ga0114129_105552702 | 89 |
| 317 | 3300009147 | Ga0114129_10579030 | Ga0114129_105790302 | 89 |
| 318 | 3300009147 | Ga0114129_12620998 | Ga0114129_126209982 | 89 |
| 319 | 3300009148 | Ga0105243_11762624 | Ga0105243_117626241 | 89 |
| 320 | 3300009177 | Ga0105248_10630074 | Ga0105248_106300742 | 89 |
| 321 | 3300009177 | Ga0105248_10974505 | Ga0105248_109745051 | 89 |
| 322 | 3300009553 | Ga0105249_10005440 | Ga0105249_100054408 | 89 |
| 323 | 3300009553 | Ga0105249_10940168 | Ga0105249_109401682 | 89 |
| 324 | 3300009553 | Ga0105249_12263548 | Ga0105249_122635482 | 89 |
| 325 | 3300009553 | Ga0105249_12362118 | Ga0105249_123621182 | 89 |
| 326 | 3300011119 | Ga0105246_10041172 | Ga0105246_100411724 | 89 |
| 327 | 3300011119 | Ga0105246_10995656 | Ga0105246_109956562 | 89 |
| 328 | 3300012487 | Ga0157321_1015243 | Ga0157321_10152431 | 89 |
| 329 | 3300012500 | Ga0157314_1009787 | Ga0157314_10097872 | 89 |
| 330 | 3300013102 | Ga0157371_10417344 | Ga0157371_104173442 | 89 |
| 331 | 3300013102 | Ga0157371_11190791 | Ga0157371_111907912 | 89 |
| 332 | 3300013296 | Ga0157374_10362810 | Ga0157374_103628102 | 89 |
| 333 | 3300013306 | Ga0163162_11219367 | Ga0163162_112193672 | 89 |
| 334 | 3300013306 | Ga0163162_11488664 | Ga0163162_114886642 | 89 |
| 335 | 3300013307 | Ga0157372_10428061 | Ga0157372_104280612 | 89 |
| 336 | 3300013307 | Ga0157372_12128408 | Ga0157372_121284082 | 89 |
| 337 | 3300013308 | Ga0157375_10017399 | Ga0157375_100173997 | 89 |
| 338 | 3300013308 | Ga0157375_10363735 | Ga0157375_103637352 | 89 |
| 339 | 3300013308 | Ga0157375_10771455 | Ga0157375_107714552 | 89 |
| 340 | 3300013308 | Ga0157375_11218114 | Ga0157375_112181142 | 89 |
| 341 | 3300013308 | Ga0157375_12298425 | Ga0157375_122984251 | 89 |
| 342 | 3300014325 | Ga0163163_13068646 | Ga0163163_130686461 | 89 |
| 343 | 3300014326 | Ga0157380_10094819 | Ga0157380_100948193 | 89 |
| 344 | 3300014326 | Ga0157380_10199689 | Ga0157380_101996892 | 89 |
| 345 | 3300014326 | Ga0157380_10204076 | Ga0157380_102040762 | 89 |
| 346 | 3300014745 | Ga0157377_10001579 | Ga0157377_100015792 | 89 |
| 347 | 3300014745 | Ga0157377_10012641 | Ga0157377_100126412 | 89 |
| 348 | 3300014745 | Ga0157377_10420179 | Ga0157377_104201792 | 89 |
| 349 | 3300014968 | Ga0157379_10018661 | Ga0157379_100186616 | 89 |
| 350 | 3300014969 | Ga0157376_10354060 | Ga0157376_103540601 | 89 |
| 351 | 3300014969 | Ga0157376_10376103 | Ga0157376_103761032 | 89 |
| 352 | 3300014969 | Ga0157376_11475922 | Ga0157376_114759222 | 89 |
| 353 | 3300017792 | Ga0163161_10018958 | Ga0163161_100189583 | 89 |
| 354 | 3300025290 | Ga0207673_1039471 | Ga0207673_10394712 | 89 |
| 355 | 3300025315 | Ga0207697_10000483 | Ga0207697_1000048311 | 89 |
| 356 | 3300025315 | Ga0207697_10488256 | Ga0207697_104882561 | 89 |
| 357 | 3300025893 | Ga0207682_10005531 | Ga0207682_100055312 | 89 |
| 358 | 3300025893 | Ga0207682_10150156 | Ga0207682_101501563 | 89 |
| 359 | 3300025901 | Ga0207688_10002562 | Ga0207688_100025628 | 89 |
| 360 | 3300025901 | Ga0207688_10479087 | Ga0207688_104790872 | 89 |
| 361 | 3300025903 | Ga0207680_10062643 | Ga0207680_100626433 | 89 |
| 362 | 3300025907 | Ga0207645_10003430 | Ga0207645_100034305 | 89 |
| 363 | 3300025908 | Ga0207643_10002454 | Ga0207643_100024544 | 89 |
| 364 | 3300025908 | Ga0207643_10428439 | Ga0207643_104284392 | 89 |
| 365 | 3300025910 | Ga0207684_10074921 | Ga0207684_100749213 | 89 |
| 366 | 3300025910 | Ga0207684_10308322 | Ga0207684_103083222 | 89 |
| 367 | 3300025916 | Ga0207663_11117817 | Ga0207663_111178171 | 89 |
| 368 | 3300025917 | Ga0207660_10656011 | Ga0207660_106560112 | 89 |
| 369 | 3300025918 | Ga0207662_10010573 | Ga0207662_100105732 | 89 |
| 370 | 3300025918 | Ga0207662_10078343 | Ga0207662_100783432 | 89 |
| 371 | 3300025919 | Ga0207657_10306820 | Ga0207657_103068202 | 89 |
| 372 | 3300025919 | Ga0207657_10988618 | Ga0207657_109886181 | 89 |
| 373 | 3300025920 | Ga0207649_10019427 | Ga0207649_100194274 | 89 |
| 374 | 3300025920 | Ga0207649_10219423 | Ga0207649_102194232 | 89 |
| 375 | 3300025921 | Ga0207652_10104459 | Ga0207652_101044592 | 89 |
| 376 | 3300025922 | Ga0207646_10047830 | Ga0207646_100478302 | 89 |
| 377 | 3300025922 | Ga0207646_10543525 | Ga0207646_105435251 | 89 |
| 378 | 3300025923 | Ga0207681_10011928 | Ga0207681_100119284 | 89 |
| 379 | 3300025923 | Ga0207681_10161591 | Ga0207681_101615912 | 89 |
| 380 | 3300025923 | Ga0207681_10344577 | Ga0207681_103445771 | 89 |
| 381 | 3300025923 | Ga0207681_11602501 | Ga0207681_116025012 | 89 |
| 382 | 3300025923 | Ga0207681_11671005 | Ga0207681_116710051 | 89 |
| 383 | 3300025925 | Ga0207650_10071762 | Ga0207650_100717622 | 89 |
| 384 | 3300025925 | Ga0207650_10411594 | Ga0207650_104115941 | 89 |
| 385 | 3300025925 | Ga0207650_11085101 | Ga0207650_110851011 | 89 |
| 386 | 3300025926 | Ga0207659_10009325 | Ga0207659_100093251 | 89 |
| 387 | 3300025926 | Ga0207659_10011060 | Ga0207659_100110605 | 89 |
| 388 | 3300025926 | Ga0207659_10065358 | Ga0207659_100653582 | 89 |
| 389 | 3300025926 | Ga0207659_10147021 | Ga0207659_101470212 | 89 |
| 390 | 3300025931 | Ga0207644_11827978 | Ga0207644_118279781 | 89 |
| 391 | 3300025932 | Ga0207690_10058404 | Ga0207690_100584042 | 89 |
| 392 | 3300025933 | Ga0207706_10018937 | Ga0207706_100189372 | 89 |
| 393 | 3300025936 | Ga0207670_11072962 | Ga0207670_110729621 | 89 |
| 394 | 3300025937 | Ga0207669_10026677 | Ga0207669_100266774 | 89 |
| 395 | 3300025937 | Ga0207669_10859175 | Ga0207669_108591752 | 89 |
| 396 | 3300025938 | Ga0207704_10519042 | Ga0207704_105190422 | 89 |
| 397 | 3300025938 | Ga0207704_10859357 | Ga0207704_108593571 | 89 |
| 398 | 3300025938 | Ga0207704_11906644 | Ga0207704_119066441 | 89 |
| 399 | 3300025940 | Ga0207691_10003015 | Ga0207691_100030156 | 89 |
| 400 | 3300025940 | Ga0207691_10033543 | Ga0207691_100335434 | 89 |
| 401 | 3300025940 | Ga0207691_10036150 | Ga0207691_100361501 | 89 |
| 402 | 3300025940 | Ga0207691_10745213 | Ga0207691_107452132 | 89 |
| 403 | 3300025941 | Ga0207711_10621459 | Ga0207711_106214592 | 89 |
| 404 | 3300025942 | Ga0207689_10005330 | Ga0207689_100053304 | 89 |
| 405 | 3300025942 | Ga0207689_10146139 | Ga0207689_101461394 | 89 |
| 406 | 3300025960 | Ga0207651_10043416 | Ga0207651_100434164 | 89 |
| 407 | 3300025960 | Ga0207651_10585964 | Ga0207651_105859642 | 89 |
| 408 | 3300025961 | Ga0207712_10169778 | Ga0207712_101697782 | 89 |
| 409 | 3300025961 | Ga0207712_11625460 | Ga0207712_116254601 | 89 |
| 410 | 3300026023 | Ga0207677_10243954 | Ga0207677_102439541 | 89 |
| 411 | 3300026023 | Ga0207677_11100082 | Ga0207677_111000822 | 89 |
| 412 | 3300026035 | Ga0207703_10256353 | Ga0207703_102563532 | 89 |
| 413 | 3300026067 | Ga0207678_10332542 | Ga0207678_103325422 | 89 |
| 414 | 3300026067 | Ga0207678_11585048 | Ga0207678_115850481 | 89 |
| 415 | 3300026075 | Ga0207708_10318851 | Ga0207708_103188512 | 89 |
| 416 | 3300026075 | Ga0207708_10320950 | Ga0207708_103209502 | 89 |
| 417 | 3300026075 | Ga0207708_10789170 | Ga0207708_107891702 | 89 |
| 418 | 3300026078 | Ga0207702_11969302 | Ga0207702_119693022 | 89 |
| 419 | 3300026088 | Ga0207641_10028662 | Ga0207641_100286624 | 89 |
| 420 | 3300026088 | Ga0207641_10128653 | Ga0207641_101286533 | 89 |
| 421 | 3300026089 | Ga0207648_10008442 | Ga0207648_100084424 | 89 |
| 422 | 3300026089 | Ga0207648_10260051 | Ga0207648_102600512 | 89 |
| 423 | 3300026089 | Ga0207648_10360139 | Ga0207648_103601392 | 89 |
| 424 | 3300026095 | Ga0207676_10092442 | Ga0207676_100924424 | 89 |
| 425 | 3300026095 | Ga0207676_10281520 | Ga0207676_102815202 | 89 |
| 426 | 3300026095 | Ga0207676_10299317 | Ga0207676_102993172 | 89 |
| 427 | 3300026095 | Ga0207676_10596798 | Ga0207676_105967982 | 89 |
| 428 | 3300026095 | Ga0207676_11238122 | Ga0207676_112381221 | 89 |
| 429 | 3300026116 | Ga0207674_10068664 | Ga0207674_100686644 | 89 |
| 430 | 3300026118 | Ga0207675_100001490 | Ga0207675_1000014908 | 89 |
| 431 | 3300026118 | Ga0207675_100119983 | Ga0207675_1001199833 | 89 |
| 432 | 3300026121 | Ga0207683_10005514 | Ga0207683_100055148 | 89 |
| 433 | 3300026121 | Ga0207683_10380646 | Ga0207683_103806462 | 89 |
| 434 | 3300026121 | Ga0207683_10643931 | Ga0207683_106439312 | 89 |
| 435 | 3300026142 | Ga0207698_10480637 | Ga0207698_104806372 | 89 |
| 436 | 3300026142 | Ga0207698_12050030 | Ga0207698_120500301 | 89 |
| 437 | 3300027252 | Ga0209973_1035219 | Ga0209973_10352192 | 89 |
| 438 | 3300027614 | Ga0209970_1094118 | Ga0209970_10941181 | 89 |
| 439 | 3300027876 | Ga0209974_10419149 | Ga0209974_104191492 | 89 |
| 440 | 3300027907 | Ga0207428_10000236 | Ga0207428_1000023629 | 89 |
| 441 | 3300027907 | Ga0207428_10039349 | Ga0207428_100393492 | 89 |
| 442 | 3300027907 | Ga0207428_10071417 | Ga0207428_100714172 | 89 |
| 443 | 3300027907 | Ga0207428_10427500 | Ga0207428_104275002 | 89 |
| 444 | 3300028379 | Ga0268266_10206222 | Ga0268266_102062221 | 89 |
| 445 | 3300028380 | Ga0268265_10062056 | Ga0268265_100620564 | 89 |
| 446 | 3300028380 | Ga0268265_10569019 | Ga0268265_105690192 | 89 |
| 447 | 3300028380 | Ga0268265_11015422 | Ga0268265_110154222 | 89 |
| 448 | 3300028380 | Ga0268265_11101254 | Ga0268265_111012542 | 89 |
| 449 | 3300028380 | Ga0268265_12690850 | Ga0268265_126908501 | 89 |
| 450 | 3300028381 | Ga0268264_10203658 | Ga0268264_102036583 | 89 |
| 451 | 3300031548 | Ga0307408_101156895 | Ga0307408_1011568952 | 89 |
| 452 | 3300031548 | Ga0307408_101629401 | Ga0307408_1016294012 | 89 |
| 453 | 3300031824 | Ga0307413_10686555 | Ga0307413_106865552 | 89 |
| 454 | 3300031852 | Ga0307410_10042158 | Ga0307410_100421583 | 89 |
| 455 | 3300031901 | Ga0307406_10411474 | Ga0307406_104114742 | 89 |
| 456 | 3300031903 | Ga0307407_10364498 | Ga0307407_103644982 | 89 |
| 457 | 3300031911 | Ga0307412_10026807 | Ga0307412_100268074 | 89 |
| 458 | 3300031911 | Ga0307412_10406306 | Ga0307412_104063062 | 89 |
| 459 | 3300031995 | Ga0307409_100514974 | Ga0307409_1005149742 | 89 |
| 460 | 3300031995 | Ga0307409_101169846 | Ga0307409_1011698462 | 89 |
| 461 | 3300032002 | Ga0307416_100012197 | Ga0307416_1000121976 | 89 |
| 462 | 3300032002 | Ga0307416_100806477 | Ga0307416_1008064772 | 89 |
| 463 | 3300032002 | Ga0307416_101366798 | Ga0307416_1013667981 | 89 |
| 464 | 3300032002 | Ga0307416_102579622 | Ga0307416_1025796221 | 89 |
| 465 | 3300032005 | Ga0307411_10756651 | Ga0307411_107566512 | 89 |
| 466 | 3300032126 | Ga0307415_100082865 | Ga0307415_1000828653 | 89 |
| 467 | 3300032126 | Ga0307415_100887134 | Ga0307415_1008871342 | 89 |
| 468 | 3300034818 | Ga0373950_0052900 | Ga0373950_0052900_283_552 | 89 |
| 469 | 3300034957 | Ga0373938_0247345 | Ga0373938_0247345_202_471 | 89 |
| 470 | 3300035088 | Ga0373940_0025660 | Ga0373940_0025660_689_958 | 89 |
| 471 | 3300035112 | Ga0373932_0026007 | Ga0373932_0026007_1206_1475 | 89 |
| 472 | 3300035242 | Ga0373962_0174023 | Ga0373962_0174023_245_514 | 89 |
| 473 | 3300035691 | Ga0373931_0573605 | Ga0373931_0573605_205_474 | 89 |
| 474 | 3300038443 | Ga0395901_1213230 | Ga0395901_1213230_381_662 | 89 |
| 475 | 3300042003 | Ga0439443_018376 | Ga0439443_018376_316_585 | 89 |
| 476 | 3300042122 | Ga0450920_039213 | Ga0450920_039213_404_673 | 89 |
| 477 | 3300042125 | Ga0450923_100863 | Ga0450923_100863_35_304 | 89 |
| 478 | 3300042127 | Ga0450890_033880 | Ga0450890_033880_137_406 | 89 |
| 479 | 3300042184 | Ga0450908_018712 | Ga0450908_018712_15_284 | 89 |
| 480 | 3300042184 | Ga0450908_030068 | Ga0450908_030068_221_490 | 89 |
| 481 | 3300042436 | Ga0439435_0107464 | Ga0439435_0107464_151_420 | 89 |
| 482 | 3300042436 | Ga0439435_0185199 | Ga0439435_0185199_193_462 | 89 |
| 483 | 3300042437 | Ga0439444_0071978 | Ga0439444_0071978_382_651 | 89 |
| 484 | 3300042438 | Ga0439459_0012378 | Ga0439459_0012378_385_654 | 89 |
| 485 | 3300042439 | Ga0439464_0130179 | Ga0439464_0130179_49_318 | 89 |
| 486 | 3300042461 | Ga0439460_0286741 | Ga0439460_0286741_73_345 | 89 |
| 487 | 3300042461 | Ga0439460_0318293 | Ga0439460_0318293_58_336 | 89 |
| 488 | 3300042993 | Ga0439440_0044918 | Ga0439440_0044918_258_527 | 89 |
| 489 | 3300044673 | Ga0453683_0152923 | Ga0453683_0152923_174_470 | 89 |
| 490 | 3300045051 | Ga0451576_1477861 | Ga0451576_1477861_319_588 | 89 |
| 491 | 3300045051 | Ga0451576_1833955 | Ga0451576_1833955_55_324 | 89 |
| 492 | 3300046455 | Ga0495603_0555086 | Ga0495603_0555086_108_377 | 89 |
| 493 | 3300046499 | Ga0495594_0301321 | Ga0495594_0301321_621_890 | 89 |
| 494 | 3300046537 | Ga0495598_0026687 | Ga0495598_0026687_664_933 | 89 |
| 495 | 3300046558 | Ga0495633_0352240 | Ga0495633_0352240_120_389 | 89 |
| 496 | 3300046615 | Ga0495656_0064205 | Ga0495656_0064205_117_386 | 89 |
| 497 | 3300046674 | Ga0495588_0466307 | Ga0495588_0466307_75_344 | 89 |
| 498 | 3300046683 | Ga0495658_0718066 | Ga0495658_0718066_160_429 | 89 |
| 499 | 3300047318 | Ga0495636_0500906 | Ga0495636_0500906_71_340 | 89 |
| 500 | 3300047319 | Ga0495674_0222210 | Ga0495674_0222210_738_1022 | 89 |
| 501 | 3300048907 | Ga0496104_0257541 | Ga0496104_0257541_335_604 | 89 |
| 502 | 3300048907 | Ga0496104_0472315 | Ga0496104_0472315_831_1100 | 89 |
| 503 | 3300048912 | Ga0496109_0027094 | Ga0496109_0027094_3576_3845 | 89 |
| 504 | 3300048912 | Ga0496109_0174091 | Ga0496109_0174091_121_405 | 89 |
| 505 | 3300048913 | Ga0496110_1617677 | Ga0496110_1617677_223_492 | 89 |
| 506 | 3300048916 | Ga0496113_0031209 | Ga0496113_0031209_1587_1856 | 89 |
| 507 | 3300048916 | Ga0496113_0258607 | Ga0496113_0258607_337_606 | 89 |
| 508 | 3300048917 | Ga0496114_0604608 | Ga0496114_0604608_600_869 | 89 |
| 509 | 3300049519 | Ga0501296_025560 | Ga0501296_025560_118_387 | 89 |
| 510 | 3300049568 | Ga0501031_0950598 | Ga0501031_0950598_205_474 | 89 |
| 511 | 3300049574 | Ga0501038_0231165 | Ga0501038_0231165_501_770 | 89 |
| 512 | 3300049575 | Ga0501039_1040471 | Ga0501039_1040471_273_560 | 89 |
| 513 | 3300049577 | Ga0501041_0197209 | Ga0501041_0197209_808_1095 | 89 |
| 514 | 3300049578 | Ga0501042_0701312 | Ga0501042_0701312_345_614 | 89 |
| 515 | 3300049579 | Ga0501043_1309408 | Ga0501043_1309408_100_369 | 89 |
| 516 | 3300049588 | Ga0501072_1342778 | Ga0501072_1342778_157_426 | 89 |
| 517 | 3300049588 | Ga0501072_1343573 | Ga0501072_1343573_159_428 | 89 |
| 518 | 3300049592 | Ga0501076_0515301 | Ga0501076_0515301_592_861 | 89 |
| 519 | 3300049592 | Ga0501076_0524112 | Ga0501076_0524112_231_518 | 89 |
| 520 | 3300049593 | Ga0501077_0378687 | Ga0501077_0378687_171_458 | 89 |
| 521 | 3300049652 | Ga0501202_192227 | Ga0501202_192227_60_332 | 89 |
| 522 | 3300049654 | Ga0501207_010342 | Ga0501207_010342_986_1255 | 89 |
| 523 | 3300049660 | Ga0501216_132157 | Ga0501216_132157_243_512 | 89 |
| 524 | 3300049686 | Ga0501257_173845 | Ga0501257_173845_238_510 | 89 |
| 525 | 3300049743 | Ga0501081_0204551 | Ga0501081_0204551_1119_1388 | 89 |
| 526 | 3300050507 | nmdc:mga05p37_1154181_c1 | nmdc:mga05p37_1154181_c1_339_611 | 89 |
| 527 | 3300050507 | nmdc:mga05p37_122217_c1 | nmdc:mga05p37_122217_c1_1955_2224 | 89 |
| 528 | 3300050507 | nmdc:mga05p37_2088889_c1 | nmdc:mga05p37_2088889_c1_241_510 | 89 |
| 529 | 3300050507 | nmdc:mga05p37_25392_c1 | nmdc:mga05p37_25392_c1_4102_4371 | 89 |
| 530 | 3300050507 | nmdc:mga05p37_284354_c1 | nmdc:mga05p37_284354_c1_458_727 | 89 |
| 531 | 3300050507 | nmdc:mga05p37_543844_c1 | nmdc:mga05p37_543844_c1_545_829 | 89 |
| 532 | 3300050507 | nmdc:mga05p37_588114_c1 | nmdc:mga05p37_588114_c1_335_604 | 89 |
| 533 | 3300050507 | nmdc:mga05p37_77896_c1 | nmdc:mga05p37_77896_c1_2974_3243 | 89 |
| 534 | 3300050508 | nmdc:mga09592_1071885_c1 | nmdc:mga09592_1071885_c1_218_487 | 89 |
| 535 | 3300050508 | nmdc:mga09592_10726_c1 | nmdc:mga09592_10726_c1_3052_3321 | 89 |
| 536 | 3300050508 | nmdc:mga09592_10824_c2 | nmdc:mga09592_10824_c2_1433_1702 | 89 |
| 537 | 3300050508 | nmdc:mga09592_1276253_c1 | nmdc:mga09592_1276253_c1_19_288 | 89 |
| 538 | 3300050508 | nmdc:mga09592_2708_c1 | nmdc:mga09592_2708_c1_11891_12160 | 89 |
| 539 | 3300050508 | nmdc:mga09592_999746_c1 | nmdc:mga09592_999746_c1_394_663 | 89 |
| 540 | 3300050509 | nmdc:mga0qj67_10168_c1 | nmdc:mga0qj67_10168_c1_2578_2847 | 89 |
| 541 | 3300050509 | nmdc:mga0qj67_136371_c1 | nmdc:mga0qj67_136371_c1_430_699 | 89 |
| 542 | 3300050509 | nmdc:mga0qj67_154761_c1 | nmdc:mga0qj67_154761_c1_1533_1802 | 89 |
| 543 | 3300050509 | nmdc:mga0qj67_272953_c1 | nmdc:mga0qj67_272953_c1_1054_1326 | 89 |
| 544 | 3300050509 | nmdc:mga0qj67_37991_c2 | nmdc:mga0qj67_37991_c2_1002_1271 | 89 |
| 545 | 3300050509 | nmdc:mga0qj67_409874_c1 | nmdc:mga0qj67_409874_c1_579_848 | 89 |
| 546 | 3300050510 | nmdc:mga06r32_1357207_c1 | nmdc:mga06r32_1357207_c1_68_337 | 89 |
| 547 | 3300050510 | nmdc:mga06r32_75345_c1 | nmdc:mga06r32_75345_c1_147_416 | 89 |
| 548 | 3300050510 | nmdc:mga06r32_79871_c1 | nmdc:mga06r32_79871_c1_1920_2192 | 89 |
| 549 | 3300050511 | nmdc:mga08y16_10088_c1 | nmdc:mga08y16_10088_c1_7432_7701 | 89 |
| 550 | 3300050511 | nmdc:mga08y16_10550_c1 | nmdc:mga08y16_10550_c1_6439_6708 | 89 |
| 551 | 3300050511 | nmdc:mga08y16_158584_c1 | nmdc:mga08y16_158584_c1_813_1082 | 89 |
| 552 | 3300050511 | nmdc:mga08y16_209402_c1 | nmdc:mga08y16_209402_c1_623_892 | 89 |
| 553 | 3300050511 | nmdc:mga08y16_256435_c1 | nmdc:mga08y16_256435_c1_15_284 | 89 |
| 554 | 3300050511 | nmdc:mga08y16_499408_c1 | nmdc:mga08y16_499408_c1_57_329 | 89 |
| 555 | 3300050511 | nmdc:mga08y16_86309_c1 | nmdc:mga08y16_86309_c1_621_890 | 89 |
| 556 | 3300050512 | nmdc:mga0n895_15386_c1 | nmdc:mga0n895_15386_c1_2392_2661 | 89 |
| 557 | 3300050512 | nmdc:mga0n895_32944_c1 | nmdc:mga0n895_32944_c1_1081_1350 | 89 |
| 558 | 3300050512 | nmdc:mga0n895_368861_c1 | nmdc:mga0n895_368861_c1_1141_1425 | 89 |
| 559 | 3300050513 | nmdc:mga0rr50_138461_c1 | nmdc:mga0rr50_138461_c1_520_804 | 89 |
| 560 | 3300050513 | nmdc:mga0rr50_706693_c1 | nmdc:mga0rr50_706693_c1_227_496 | 89 |
| 561 | 3300050514 | nmdc:mga08x19_1079884_c1 | nmdc:mga08x19_1079884_c1_115_384 | 89 |
| 562 | 3300050515 | nmdc:mga0a205_118878_c1 | nmdc:mga0a205_118878_c1_592_861 | 89 |
| 563 | 3300050515 | nmdc:mga0a205_166964_c1 | nmdc:mga0a205_166964_c1_481_750 | 89 |
| 564 | 3300050515 | nmdc:mga0a205_404076_c1 | nmdc:mga0a205_404076_c1_646_930 | 89 |
| 565 | 3300050515 | nmdc:mga0a205_679082_c1 | nmdc:mga0a205_679082_c1_341_610 | 89 |
| 566 | 3300054114 | Ga0501084_1865161 | Ga0501084_1865161_121_390 | 89 |
| 567 | 3300061734 | Ga0530510_1053918 | Ga0530510_1053918_213_482 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4k51-assembly2.cif.gz_B | crystal structure of the pci domain of eif3a | 0.9868 | 29 | 61 |
| 4u1c-assembly1.cif.gz_A | crystal structure of the eif3a/eif3c pci-domain heterodimer | 0.9804 | 20 | 60 |
| 7dgq-assembly1.cif.gz_A9 | activity optimized supercomplex state1 | 0.9258 | 24 | 64 |
| 5gpn-assembly1.cif.gz_0 | architecture of mammalian respirasome | 0.9258 | 24 | 64 |
| 5luf-assembly1.cif.gz_z | cryo-em of bovine respirasome | 0.9258 | 24 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4k51B00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; | 0.9868 | 29 | 61 | 1.25.40.860 |
| 4u1cA01 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;UVR domain | 0.9804 | 20 | 60 | 4.10.860.10 |
| af_A4I5D2_109_274_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.9709 | 14 | 61 | 1.25.10.10 |
| af_K7LI90_496_807_1.20.120.670 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase | 0.9653 | 23 | 60 | 1.20.120.670 |
| af_Q54DW5_515_797_1.20.120.670 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase | 0.9627 | 25 | 62 | 1.20.120.670 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645BS02-F1-model_v4 | 30S ribosomal protein S20 | 0.978 | 21 | 89 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
| AF-X0VFS6-F1-model_v4 | 30S ribosomal protein S20 | 0.9779 | 17 | 88 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-H5SRE3-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9778 | 21 | 86 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0C1H3Z2-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.974 | 25 | 87 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-X0SC26-F1-model_v4 | 30S ribosomal protein S20 | 0.9702 | 20 | 87 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar