F464520

General Info

Members Datasets Scaffolds Average Seq Length
567 241 567 89

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_11882977|Ga0207651_118829771
Length 92
Sequence MGVRWRPVTTKRGPVAKRTKSALKANRQNIKRREANRQIRASLDDNDVDGAKTALSQTVSIVDKMATKGIIHRNTAGRYKSRLASRLTKASA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
95 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
182 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
183 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
184 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
185 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
227 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
228 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
229 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11812573 2162886012 Unclassified 836
2 Ga0058860_12175475 3300004801 Bacteria 515
3 Ga0065714_10292723 3300005288 Bacteria 705
4 Ga0065704_10450404 3300005289 Bacteria 706
5 Ga0065704_10658794 3300005289 Bacteria 568
6 Ga0065712_10000157 3300005290 Bacteria 58547
7 Ga0065712_10099250 3300005290 Unclassified 2090
8 Ga0065712_10796277 3300005290 Unclassified 506
9 Ga0065715_10449556 3300005293 Unclassified 827
10 Ga0065707_10100639 3300005295 Unclassified 2916
11 Ga0065707_10118375 3300005295 Bacteria 2187
12 Ga0065707_10401373 3300005295 Bacteria 852
13 Ga0070676_10002732 3300005328 Bacteria 9099
14 Ga0070690_100138128 3300005330 Unclassified 1652
15 Ga0070690_100178879 3300005330 Bacteria 1465
16 Ga0070690_100266220 3300005330 Unclassified 1217
17 Ga0070690_100321250 3300005330 Bacteria 1115
18 Ga0070690_100663726 3300005330 Bacteria 797
19 Ga0070670_100095821 3300005331 Bacteria 2553
20 Ga0070670_100435054 3300005331 Bacteria 1161
21 Ga0070670_101739731 3300005331 Bacteria 574
22 Ga0070677_10003227 3300005333 Bacteria 5248
23 Ga0070677_10049033 3300005333 Bacteria 1699
24 Ga0068869_100581096 3300005334 Bacteria 944
25 Ga0068869_100822610 3300005334 Bacteria 800
26 Ga0070666_10002058 3300005335 Bacteria 12205
27 Ga0070666_11110198 3300005335 Unclassified 588
28 Ga0070666_11325561 3300005335 Unclassified 537
29 Ga0070680_100215371 3300005336 Bacteria 1621
30 Ga0070680_100724390 3300005336 Bacteria 856
31 Ga0070682_100347562 3300005337 Bacteria 1104
32 Ga0070682_100925485 3300005337 Bacteria 718
33 Ga0068868_100420654 3300005338 Bacteria 1157
34 Ga0068868_101342716 3300005338 Bacteria 665
35 Ga0070660_101541518 3300005339 Bacteria 565
36 Ga0070689_100037709 3300005340 Bacteria 3696
37 Ga0070689_100098826 3300005340 Bacteria 2309
38 Ga0070689_100219776 3300005340 Unclassified 1558
39 Ga0070689_100421749 3300005340 Unclassified 1131
40 Ga0070691_10289425 3300005341 Bacteria 891
41 Ga0070687_100010126 3300005343 Bacteria 4062
42 Ga0070687_100600785 3300005343 Unclassified 756
43 Ga0070661_100018283 3300005344 Bacteria 4982
44 Ga0070661_100285848 3300005344 Unclassified 1280
45 Ga0070692_10046272 3300005345 Bacteria 2248
46 Ga0070692_11339184 3300005345 Unclassified 515
47 Ga0070668_100077184 3300005347 Bacteria 2604
48 Ga0070668_100090405 3300005347 Unclassified 2412
49 Ga0070668_100338528 3300005347 Bacteria 1270
50 Ga0070669_100004330 3300005353 Bacteria 10253
51 Ga0070669_100317993 3300005353 Bacteria 1256
52 Ga0070669_100466161 3300005353 Bacteria 1043
53 Ga0070669_100714246 3300005353 Bacteria 847
54 Ga0070669_101400909 3300005353 Unclassified 607
55 Ga0070669_101886647 3300005353 Bacteria 522
56 Ga0070675_100015380 3300005354 Bacteria 6048
57 Ga0070675_100020507 3300005354 Bacteria 5273
58 Ga0070675_100065654 3300005354 Bacteria 3001
59 Ga0070675_100069390 3300005354 Bacteria 2920
60 Ga0070675_100828104 3300005354 Bacteria 846
61 Ga0070671_101243697 3300005355 Unclassified 656
62 Ga0070674_100233167 3300005356 Unclassified 1437
63 Ga0070673_100017267 3300005364 Bacteria 5125
64 Ga0070673_100153102 3300005364 Bacteria 1954
65 Ga0070673_100721151 3300005364 Bacteria 917
66 Ga0070673_100810870 3300005364 Bacteria 865
67 Ga0070688_100062307 3300005365 Bacteria 2361
68 Ga0070688_100083133 3300005365 Unclassified 2077
69 Ga0070688_100118734 3300005365 Bacteria 1768
70 Ga0070688_100345739 3300005365 Unclassified 1087
71 Ga0070688_100786295 3300005365 Bacteria 743
72 Ga0070659_100154135 3300005366 Unclassified 1875
73 Ga0070659_100945344 3300005366 Unclassified 755
74 Ga0070667_100099133 3300005367 Unclassified 2515
75 Ga0070667_100634342 3300005367 Bacteria 986
76 Ga0070701_10041587 3300005438 Bacteria 2343
77 Ga0070701_10316566 3300005438 Unclassified 964
78 Ga0070711_100321012 3300005439 Unclassified 1237
79 Ga0070705_100549046 3300005440 Bacteria 885
80 Ga0070705_100992109 3300005440 Unclassified 681
81 Ga0070700_100043287 3300005441 Bacteria 2769
82 Ga0070700_100576587 3300005441 Bacteria 878
83 Ga0070700_101146552 3300005441 Bacteria 647
84 Ga0070694_100776216 3300005444 Unclassified 784
85 Ga0070694_100941101 3300005444 Unclassified 715
86 Ga0070694_100947348 3300005444 Bacteria 713
87 Ga0070708_101925431 3300005445 Bacteria 548
88 Ga0070663_100996421 3300005455 Bacteria 728
89 Ga0070678_100061768 3300005456 Bacteria 2763
90 Ga0070678_100126106 3300005456 Bacteria 2027
91 Ga0070678_100608849 3300005456 Unclassified 976
92 Ga0070678_101160205 3300005456 Unclassified 715
93 Ga0070678_101275804 3300005456 Unclassified 683
94 Ga0070678_102081309 3300005456 Bacteria 537
95 Ga0070662_100015586 3300005457 Bacteria 5093
96 Ga0070662_100585745 3300005457 Unclassified 937
97 Ga0070681_10047573 3300005458 Bacteria 4288
98 Ga0068867_100011383 3300005459 Bacteria 6277
99 Ga0068867_100312007 3300005459 Bacteria 1300
100 Ga0070685_10002152 3300005466 Bacteria 10148
101 Ga0070706_100071653 3300005467 Bacteria 3205
102 Ga0070707_100075015 3300005468 Bacteria 3262
103 Ga0070707_100350536 3300005468 Unclassified 1434
104 Ga0070698_100069962 3300005471 Bacteria 3522
105 Ga0070698_100992958 3300005471 Unclassified 786
106 Ga0070699_100283005 3300005518 Bacteria 1485
107 Ga0070699_100760290 3300005518 Bacteria 886
108 Ga0070679_100091085 3300005530 Unclassified 3037
109 Ga0070684_100403721 3300005535 Unclassified 1260
110 Ga0070697_100173734 3300005536 Unclassified 1824
111 Ga0070672_100048249 3300005543 Unclassified 3308
112 Ga0070672_100090003 3300005543 Unclassified 2474
113 Ga0070672_100409230 3300005543 Unclassified 1164
114 Ga0070672_101243029 3300005543 Unclassified 664
115 Ga0070672_101322209 3300005543 Unclassified 644
116 Ga0070672_101363096 3300005543 Bacteria 634
117 Ga0070686_100030006 3300005544 Bacteria 3313
118 Ga0070686_100332548 3300005544 Bacteria 1136
119 Ga0070686_100411412 3300005544 Unclassified 1031
120 Ga0070686_100541762 3300005544 Unclassified 909
121 Ga0070686_101206284 3300005544 Unclassified 629
122 Ga0070695_100321726 3300005545 Bacteria 1150
123 Ga0070696_100223184 3300005546 Bacteria 1415
124 Ga0070693_100740435 3300005547 Unclassified 723
125 Ga0070665_100083489 3300005548 Bacteria 3199
126 Ga0070665_100491356 3300005548 Bacteria 1238
127 Ga0070665_100610085 3300005548 Unclassified 1104
128 Ga0070704_100063426 3300005549 Bacteria 2652
129 Ga0070704_100114053 3300005549 Bacteria 2062
130 Ga0070704_100215805 3300005549 Unclassified 1557
131 Ga0070704_100296862 3300005549 Bacteria 1345
132 Ga0070704_100902106 3300005549 Bacteria 795
133 Ga0070704_101826326 3300005549 Bacteria 563
134 Ga0070664_100006238 3300005564 Bacteria 9630
135 Ga0070664_100059268 3300005564 Bacteria 3256
136 Ga0070664_100106703 3300005564 Unclassified 2441
137 Ga0070664_100943615 3300005564 Bacteria 810
138 Ga0068857_100215386 3300005577 Unclassified 1753
139 Ga0068857_100671882 3300005577 Bacteria 983
140 Ga0068854_100882347 3300005578 Bacteria 785
141 Ga0070702_100774808 3300005615 Bacteria 739
142 Ga0070702_100939524 3300005615 Bacteria 680
143 Ga0070702_101649028 3300005615 Bacteria 532
144 Ga0068852_100050124 3300005616 Bacteria 3576
145 Ga0068859_100048797 3300005617 Unclassified 4253
146 Ga0068859_100188780 3300005617 Bacteria 2145
147 Ga0068859_100243264 3300005617 Bacteria 1889
148 Ga0068859_100274759 3300005617 Unclassified 1777
149 Ga0068859_100787437 3300005617 Unclassified 1039
150 Ga0068859_101175476 3300005617 Unclassified 845
151 Ga0068859_101444286 3300005617 Unclassified 759
152 Ga0068859_102013246 3300005617 Bacteria 638
153 Ga0068864_100111047 3300005618 Bacteria 2442
154 Ga0068864_100261602 3300005618 Unclassified 1610
155 Ga0068864_100310920 3300005618 Unclassified 1477
156 Ga0068864_100603003 3300005618 Bacteria 1066
157 Ga0068864_101133557 3300005618 Unclassified 779
158 Ga0068861_100003257 3300005719 Bacteria 10742
159 Ga0068861_100294418 3300005719 Bacteria 1403
160 Ga0068861_100411480 3300005719 Unclassified 1203
161 Ga0068861_101027323 3300005719 Unclassified 788
162 Ga0068870_10000409 3300005840 Bacteria 16148
163 Ga0068870_10135116 3300005840 Unclassified 1437
164 Ga0068870_10621507 3300005840 Bacteria 736
165 Ga0068863_100042106 3300005841 Bacteria 4340
166 Ga0068863_100609731 3300005841 Unclassified 1081
167 Ga0068858_100210597 3300005842 Unclassified 1839
168 Ga0068860_100054699 3300005843 Bacteria 3794
169 Ga0068860_100257794 3300005843 Unclassified 1699
170 Ga0068860_100550420 3300005843 Bacteria 1156
171 Ga0068860_101588018 3300005843 Unclassified 676
172 Ga0068862_100006569 3300005844 Bacteria 9648
173 Ga0068862_100037927 3300005844 Bacteria 4086
174 Ga0068862_100291411 3300005844 Bacteria 1499
175 Ga0068862_100909470 3300005844 Bacteria 866
176 Ga0068862_101598092 3300005844 Unclassified 659
177 Ga0068862_102071741 3300005844 Bacteria 580
178 Ga0075432_10115023 3300006058 Bacteria 1006
179 Ga0097621_100502328 3300006237 Bacteria 1098
180 Ga0097621_101688942 3300006237 Unclassified 603
181 Ga0068871_100100507 3300006358 Unclassified 2423
182 Ga0068871_100401166 3300006358 Unclassified 1221
183 Ga0068871_100848087 3300006358 Bacteria 844
184 Ga0075428_100001700 3300006844 Bacteria 23477
185 Ga0075428_100002416 3300006844 Bacteria 20297
186 Ga0075428_100005624 3300006844 Bacteria 13924
187 Ga0075428_100024130 3300006844 Bacteria 6728
188 Ga0075428_100044304 3300006844 Bacteria 4890
189 Ga0075428_100543122 3300006844 Bacteria 1242
190 Ga0075428_100544505 3300006844 Bacteria 1241
191 Ga0075428_100607190 3300006844 Unclassified 1168
192 Ga0075428_102200606 3300006844 Unclassified 569
193 Ga0075430_100006849 3300006846 Bacteria 9607
194 Ga0075430_100021061 3300006846 Bacteria 5543
195 Ga0075430_100087556 3300006846 Bacteria 2606
196 Ga0075430_100300438 3300006846 Unclassified 1328
197 Ga0075430_100506955 3300006846 Bacteria 996
198 Ga0075430_100698472 3300006846 Bacteria 836
199 Ga0075431_100090492 3300006847 Bacteria 3158
200 Ga0075431_100126365 3300006847 Bacteria 2638
201 Ga0075431_100218140 3300006847 Unclassified 1946
202 Ga0075431_100845498 3300006847 Bacteria 887
203 Ga0075433_10060674 3300006852 Bacteria 3312
204 Ga0075433_10061911 3300006852 Unclassified 3278
205 Ga0075433_10232638 3300006852 Bacteria 1636
206 Ga0075433_10432161 3300006852 Bacteria 1161
207 Ga0075433_10434379 3300006852 Bacteria 1158
208 Ga0075434_100062600 3300006871 Unclassified 3704
209 Ga0075434_100085172 3300006871 Bacteria 3160
210 Ga0075434_101373994 3300006871 Unclassified 716
211 Ga0075429_100001299 3300006880 Bacteria 20353
212 Ga0075429_100021693 3300006880 Bacteria 5567
213 Ga0075429_100022229 3300006880 Bacteria 5502
214 Ga0075429_100057628 3300006880 Bacteria 3382
215 Ga0075429_100220346 3300006880 Bacteria 1662
216 Ga0075429_100481740 3300006880 Unclassified 1087
217 Ga0075429_101259609 3300006880 Unclassified 645
218 Ga0068865_100335187 3300006881 Bacteria 1221
219 Ga0068865_101627352 3300006881 Unclassified 581
220 Ga0097620_100048797 3300006931 Unclassified 4253
221 Ga0097620_100188781 3300006931 Bacteria 2145
222 Ga0097620_100243271 3300006931 Bacteria 1889
223 Ga0097620_100274767 3300006931 Unclassified 1777
224 Ga0097620_100787229 3300006931 Unclassified 1039
225 Ga0097620_101175609 3300006931 Unclassified 845
226 Ga0097620_101443996 3300006931 Unclassified 759
227 Ga0097620_102013397 3300006931 Bacteria 638
228 Ga0075435_100024200 3300007076 Bacteria 4708
229 Ga0075435_101357130 3300007076 Unclassified 623
230 Ga0075435_101746759 3300007076 Unclassified 546
231 Ga0105240_10015432 3300009093 Bacteria 10387
232 Ga0111539_10001176 3300009094 Bacteria 34725
233 Ga0111539_10007015 3300009094 Bacteria 14452
234 Ga0111539_10011819 3300009094 Bacteria 10944
235 Ga0111539_10014042 3300009094 Bacteria 10007
236 Ga0111539_10085748 3300009094 Bacteria 3701
237 Ga0111539_10330824 3300009094 Bacteria 1773
238 Ga0111539_10588410 3300009094 Bacteria 1296
239 Ga0111539_10742466 3300009094 Bacteria 1142
240 Ga0111539_12448957 3300009094 Bacteria 605
241 Ga0105245_10430399 3300009098 Bacteria 1324
242 Ga0105245_11409355 3300009098 Unclassified 747
243 Ga0105247_10551484 3300009101 Unclassified 848
244 Ga0114129_10025293 3300009147 Bacteria 8411
245 Ga0114129_10108629 3300009147 Bacteria 3830
246 Ga0114129_10253277 3300009147 Bacteria 2362
247 Ga0114129_10446193 3300009147 Unclassified 1697
248 Ga0114129_10456680 3300009147 Bacteria 1675
249 Ga0114129_10555270 3300009147 Unclassified 1493
250 Ga0114129_10579030 3300009147 Unclassified 1457
251 Ga0114129_12620998 3300009147 Bacteria 601
252 Ga0105243_11762624 3300009148 Bacteria 649
253 Ga0105242_10556744 3300009176 Unclassified 1100
254 Ga0105242_12241914 3300009176 Unclassified 592
255 Ga0105248_10027232 3300009177 Bacteria 6360
256 Ga0105248_10630074 3300009177 Bacteria 1210
257 Ga0105248_10974505 3300009177 Bacteria 958
258 Ga0105248_11032901 3300009177 Unclassified 929
259 Ga0105249_10005440 3300009553 Bacteria 10995
260 Ga0105249_10940168 3300009553 Bacteria 932
261 Ga0105249_12263548 3300009553 Unclassified 616
262 Ga0105249_12362118 3300009553 Bacteria 604
263 Ga0099796_10241392 3300010159 Bacteria 747
264 Ga0105246_10041172 3300011119 Bacteria 3121
265 Ga0105246_10995656 3300011119 Bacteria 758
266 Ga0157321_1015243 3300012487 Unclassified 647
267 Ga0157314_1009787 3300012500 Unclassified 817
268 Ga0157371_10417344 3300013102 Unclassified 983
269 Ga0157371_11190791 3300013102 Bacteria 587
270 Ga0157374_10362810 3300013296 Bacteria 1441
271 Ga0163162_10264816 3300013306 Bacteria 1850
272 Ga0163162_11219367 3300013306 Bacteria 854
273 Ga0163162_11488664 3300013306 Bacteria 771
274 Ga0157372_10428061 3300013307 Unclassified 1543
275 Ga0157372_12128408 3300013307 Bacteria 645
276 Ga0157375_10017399 3300013308 Bacteria 6486
277 Ga0157375_10363735 3300013308 Unclassified 1613
278 Ga0157375_10771455 3300013308 Bacteria 1112
279 Ga0157375_11218114 3300013308 Unclassified 883
280 Ga0157375_12298425 3300013308 Unclassified 643
281 Ga0163163_13068646 3300014325 Bacteria 521
282 Ga0157380_10094819 3300014326 Unclassified 2471
283 Ga0157380_10195247 3300014326 Bacteria 1791
284 Ga0157380_10199689 3300014326 Bacteria 1773
285 Ga0157380_10204076 3300014326 Unclassified 1756
286 Ga0157377_10001579 3300014745 Bacteria 9911
287 Ga0157377_10012641 3300014745 Bacteria 4249
288 Ga0157377_10420179 3300014745 Bacteria 915
289 Ga0157377_10606549 3300014745 Bacteria 782
290 Ga0157379_10018661 3300014968 Bacteria 6114
291 Ga0157376_10354060 3300014969 Bacteria 1406
292 Ga0157376_10376103 3300014969 Bacteria 1367
293 Ga0157376_11475922 3300014969 Unclassified 713
294 Ga0163161_10018958 3300017792 Bacteria 4823
295 Ga0207673_1039471 3300025290 Bacteria 662
296 Ga0207697_10000483 3300025315 Bacteria 22534
297 Ga0207697_10488256 3300025315 Bacteria 544
298 Ga0207682_10005531 3300025893 Bacteria 5143
299 Ga0207682_10150156 3300025893 Bacteria 1050
300 Ga0207688_10002562 3300025901 Bacteria 9831
301 Ga0207688_10479087 3300025901 Bacteria 778
302 Ga0207680_10062643 3300025903 Unclassified 2273
303 Ga0207645_10003430 3300025907 Bacteria 12048
304 Ga0207643_10002454 3300025908 Bacteria 10012
305 Ga0207643_10428439 3300025908 Bacteria 839
306 Ga0207684_10074921 3300025910 Bacteria 2876
307 Ga0207684_10308322 3300025910 Bacteria 1365
308 Ga0207663_11117817 3300025916 Unclassified 634
309 Ga0207660_10656011 3300025917 Bacteria 856
310 Ga0207662_10010573 3300025918 Bacteria 5101
311 Ga0207662_10078343 3300025918 Bacteria 2011
312 Ga0207657_10306820 3300025919 Bacteria 1257
313 Ga0207657_10988618 3300025919 Bacteria 646
314 Ga0207649_10019427 3300025920 Bacteria 3883
315 Ga0207649_10219423 3300025920 Unclassified 1353
316 Ga0207652_10104459 3300025921 Unclassified 2506
317 Ga0207646_10047830 3300025922 Bacteria 3836
318 Ga0207646_10543525 3300025922 Unclassified 1045
319 Ga0207681_10011928 3300025923 Bacteria 5352
320 Ga0207681_10161591 3300025923 Bacteria 1689
321 Ga0207681_10344577 3300025923 Bacteria 1191
322 Ga0207681_10438607 3300025923 Bacteria 1061
323 Ga0207681_10669713 3300025923 Bacteria 861
324 Ga0207681_11602501 3300025923 Unclassified 545
325 Ga0207681_11671005 3300025923 Bacteria 532
326 Ga0207650_10071762 3300025925 Unclassified 2605
327 Ga0207650_10411594 3300025925 Bacteria 1121
328 Ga0207650_11085101 3300025925 Unclassified 681
329 Ga0207659_10009325 3300025926 Bacteria 6128
330 Ga0207659_10011060 3300025926 Bacteria 5689
331 Ga0207659_10065358 3300025926 Unclassified 2636
332 Ga0207659_10147021 3300025926 Unclassified 1836
333 Ga0207687_11669833 3300025927 Unclassified 546
334 Ga0207644_11827978 3300025931 Bacteria 508
335 Ga0207690_10058404 3300025932 Unclassified 2609
336 Ga0207706_10018937 3300025933 Bacteria 6191
337 Ga0207706_10127436 3300025933 Bacteria 2238
338 Ga0207706_10624306 3300025933 Unclassified 924
339 Ga0207670_10210737 3300025936 Unclassified 1482
340 Ga0207670_11072962 3300025936 Unclassified 679
341 Ga0207669_10026677 3300025937 Unclassified 3148
342 Ga0207669_10859175 3300025937 Bacteria 756
343 Ga0207669_11585612 3300025937 Unclassified 559
344 Ga0207704_10519042 3300025938 Bacteria 963
345 Ga0207704_10859357 3300025938 Bacteria 761
346 Ga0207704_11257604 3300025938 Unclassified 632
347 Ga0207704_11906644 3300025938 Unclassified 511
348 Ga0207691_10003015 3300025940 Bacteria 16440
349 Ga0207691_10033543 3300025940 Bacteria 4779
350 Ga0207691_10036150 3300025940 Bacteria 4577
351 Ga0207691_10745213 3300025940 Unclassified 825
352 Ga0207691_11632382 3300025940 Unclassified 523
353 Ga0207711_10088205 3300025941 Unclassified 2723
354 Ga0207711_10621459 3300025941 Unclassified 1008
355 Ga0207689_10005330 3300025942 Bacteria 11529
356 Ga0207689_10146139 3300025942 Bacteria 1948
357 Ga0207651_10043416 3300025960 Unclassified 3000
358 Ga0207651_10585964 3300025960 Bacteria 973
359 Ga0207651_11882977 3300025960 Unclassified 538
360 Ga0207712_10169778 3300025961 Unclassified 1704
361 Ga0207712_10590385 3300025961 Unclassified 960
362 Ga0207712_11625460 3300025961 Bacteria 579
363 Ga0207668_10066538 3300025972 Unclassified 2555
364 Ga0207658_10315696 3300025986 Bacteria 1351
365 Ga0207677_10243954 3300026023 Unclassified 1455
366 Ga0207677_11100082 3300026023 Bacteria 724
367 Ga0207703_10256353 3300026035 Unclassified 1579
368 Ga0207678_10332542 3300026067 Bacteria 1308
369 Ga0207678_11585048 3300026067 Unclassified 577
370 Ga0207708_10318851 3300026075 Bacteria 1268
371 Ga0207708_10320950 3300026075 Bacteria 1264
372 Ga0207708_10789170 3300026075 Bacteria 817
373 Ga0207702_11969302 3300026078 Unclassified 575
374 Ga0207641_10028662 3300026088 Bacteria 4601
375 Ga0207641_10128653 3300026088 Bacteria 2271
376 Ga0207648_10008442 3300026089 Bacteria 9976
377 Ga0207648_10172182 3300026089 Bacteria 1914
378 Ga0207648_10260051 3300026089 Bacteria 1549
379 Ga0207648_10360139 3300026089 Bacteria 1312
380 Ga0207676_10092442 3300026095 Bacteria 2488
381 Ga0207676_10281520 3300026095 Unclassified 1510
382 Ga0207676_10299317 3300026095 Unclassified 1468
383 Ga0207676_10596798 3300026095 Unclassified 1060
384 Ga0207676_11092619 3300026095 Bacteria 788
385 Ga0207676_11238122 3300026095 Unclassified 740
386 Ga0207674_10068664 3300026116 Bacteria 3566
387 Ga0207675_100001490 3300026118 Bacteria 23487
388 Ga0207675_100119983 3300026118 Bacteria 2487
389 Ga0207675_100574183 3300026118 Unclassified 1129
390 Ga0207675_100676349 3300026118 Unclassified 1040
391 Ga0207675_101388030 3300026118 Bacteria 723
392 Ga0207683_10005514 3300026121 Bacteria 10845
393 Ga0207683_10380646 3300026121 Bacteria 1297
394 Ga0207683_10643931 3300026121 Unclassified 982
395 Ga0207683_11319020 3300026121 Unclassified 668
396 Ga0207698_10480637 3300026142 Bacteria 1205
397 Ga0207698_12050030 3300026142 Unclassified 586
398 Ga0209973_1035219 3300027252 Bacteria 719
399 Ga0209995_1033233 3300027471 Unclassified 866
400 Ga0209970_1094118 3300027614 Unclassified 570
401 Ga0209966_1051884 3300027695 Unclassified 874
402 Ga0209998_10207626 3300027717 Unclassified 513
403 Ga0209974_10419149 3300027876 Bacteria 528
404 Ga0207428_10000236 3300027907 Bacteria 75764
405 Ga0207428_10018461 3300027907 Bacteria 5956
406 Ga0207428_10039349 3300027907 Bacteria 3840
407 Ga0207428_10071417 3300027907 Bacteria 2726
408 Ga0207428_10199899 3300027907 Bacteria 1504
409 Ga0207428_10427500 3300027907 Bacteria 967
410 Ga0207428_10830411 3300027907 Unclassified 655
411 Ga0268266_10206222 3300028379 Unclassified 1801
412 Ga0268265_10062056 3300028380 Unclassified 2870
413 Ga0268265_10569019 3300028380 Bacteria 1078
414 Ga0268265_11015422 3300028380 Bacteria 820
415 Ga0268265_11041903 3300028380 Unclassified 810
416 Ga0268265_11101254 3300028380 Bacteria 788
417 Ga0268265_11937260 3300028380 Bacteria 596
418 Ga0268265_12690850 3300028380 Bacteria 503
419 Ga0268264_10051047 3300028381 Unclassified 3445
420 Ga0268264_10203658 3300028381 Unclassified 1812
421 Ga0268264_11969699 3300028381 Unclassified 593
422 Ga0316182_1112002 3300030745 Bacteria 786
423 Ga0307408_100050590 3300031548 Bacteria 2989
424 Ga0307408_101156895 3300031548 Bacteria 720
425 Ga0307408_101629401 3300031548 Bacteria 613
426 Ga0307405_10089035 3300031731 Unclassified 2038
427 Ga0307413_10245672 3300031824 Unclassified 1324
428 Ga0307413_10686555 3300031824 Bacteria 849
429 Ga0307413_10874059 3300031824 Unclassified 761
430 Ga0307410_10001474 3300031852 Bacteria 10647
431 Ga0307410_10042158 3300031852 Bacteria 3015
432 Ga0307406_10014930 3300031901 Bacteria 4481
433 Ga0307406_10411474 3300031901 Bacteria 1075
434 Ga0307406_11866609 3300031901 Unclassified 535
435 Ga0307407_10003122 3300031903 Bacteria 6703
436 Ga0307407_10364498 3300031903 Bacteria 1027
437 Ga0307412_10026807 3300031911 Bacteria 3587
438 Ga0307412_10043594 3300031911 Bacteria 2922
439 Ga0307412_10406306 3300031911 Bacteria 1110
440 Ga0307409_100138426 3300031995 Bacteria 2093
441 Ga0307409_100514974 3300031995 Bacteria 1168
442 Ga0307409_100572616 3300031995 Unclassified 1112
443 Ga0307409_101169846 3300031995 Bacteria 792
444 Ga0307416_100012197 3300032002 Bacteria 5775
445 Ga0307416_100050094 3300032002 Bacteria 3326
446 Ga0307416_100053309 3300032002 Unclassified 3244
447 Ga0307416_100806477 3300032002 Unclassified 1035
448 Ga0307416_101219836 3300032002 Unclassified 858
449 Ga0307416_101366798 3300032002 Unclassified 814
450 Ga0307416_102579622 3300032002 Unclassified 606
451 Ga0307411_10004021 3300032005 Bacteria 6954
452 Ga0307411_10756651 3300032005 Bacteria 852
453 Ga0307415_100031497 3300032126 Bacteria 3417
454 Ga0307415_100082865 3300032126 Bacteria 2296
455 Ga0307415_100887134 3300032126 Bacteria 821
456 Ga0373950_0052900 3300034818 Unclassified 801
457 Ga0373938_0247345 3300034957 Unclassified 509
458 Ga0373940_0025660 3300035088 Unclassified 1536
459 Ga0373932_0026007 3300035112 Unclassified 1589
460 Ga0373962_0174023 3300035242 Unclassified 716
461 Ga0373931_0573605 3300035691 Unclassified 735
462 Ga0373933_0340623 3300035724 Unclassified 973
463 Ga0395901_1213230 3300038443 Bacteria 720
464 Ga0439453_0077842 3300041408 Unclassified 711
465 Ga0439443_018376 3300042003 Unclassified 1082
466 Ga0450920_039213 3300042122 Bacteria 943
467 Ga0450923_100863 3300042125 Bacteria 666
468 Ga0450890_033880 3300042127 Bacteria 736
469 Ga0439446_0320156 3300042156 Unclassified 548
470 Ga0450908_018712 3300042184 Bacteria 1222
471 Ga0450908_030068 3300042184 Bacteria 944
472 Ga0439435_0107464 3300042436 Bacteria 863
473 Ga0439435_0185199 3300042436 Unclassified 681
474 Ga0439444_0071978 3300042437 Unclassified 742
475 Ga0439459_0012378 3300042438 Bacteria 1519
476 Ga0439464_0130179 3300042439 Unclassified 779
477 Ga0439460_0286741 3300042461 Unclassified 574
478 Ga0439460_0318293 3300042461 Unclassified 546
479 Ga0439440_0044918 3300042993 Unclassified 1088
480 Ga0453683_0152923 3300044673 Bacteria 1458
481 Ga0451576_1477861 3300045051 Unclassified 706
482 Ga0451576_1833955 3300045051 Unclassified 626
483 Ga0495592_0786021 3300046454 Unclassified 566
484 Ga0495603_0555086 3300046455 Unclassified 658
485 Ga0495651_0841472 3300046462 Unclassified 564
486 Ga0495594_0301321 3300046499 Unclassified 913
487 Ga0495587_0396249 3300046536 Unclassified 767
488 Ga0495598_0026687 3300046537 Bacteria 1586
489 Ga0495645_0488976 3300046543 Unclassified 771
490 Ga0495633_0352240 3300046558 Unclassified 667
491 Ga0495656_0064205 3300046615 Bacteria 1612
492 Ga0495588_0466307 3300046674 Bacteria 662
493 Ga0495599_0312814 3300046678 Bacteria 946
494 Ga0495658_0718066 3300046683 Unclassified 640
495 Ga0495636_0500906 3300047318 Bacteria 587
496 Ga0495674_0222210 3300047319 Bacteria 1561
497 Ga0496104_0257541 3300048907 Bacteria 1658
498 Ga0496104_0472315 3300048907 Bacteria 1166
499 Ga0496109_0027094 3300048912 Bacteria 5115
500 Ga0496109_0174091 3300048912 Bacteria 2020
501 Ga0496110_1617677 3300048913 Bacteria 558
502 Ga0496113_0031209 3300048916 Bacteria 3865
503 Ga0496113_0258607 3300048916 Bacteria 1391
504 Ga0496114_0604608 3300048917 Bacteria 967
505 Ga0501296_025560 3300049519 Bacteria 774
506 Ga0501031_0950598 3300049568 Bacteria 550
507 Ga0501038_0231165 3300049574 Bacteria 1472
508 Ga0501039_1040471 3300049575 Bacteria 635
509 Ga0501041_0197209 3300049577 Bacteria 1262
510 Ga0501042_0701312 3300049578 Unclassified 736
511 Ga0501043_1309408 3300049579 Unclassified 505
512 Ga0501072_1342778 3300049588 Bacteria 554
513 Ga0501072_1343573 3300049588 Bacteria 553
514 Ga0501073_0434877 3300049589 Bacteria 907
515 Ga0501076_0515301 3300049592 Unclassified 986
516 Ga0501076_0524112 3300049592 Bacteria 977
517 Ga0501077_0378687 3300049593 Bacteria 904
518 Ga0501202_192227 3300049652 Unclassified 555
519 Ga0501207_010342 3300049654 Bacteria 1375
520 Ga0501216_132157 3300049660 Unclassified 580
521 Ga0501257_173845 3300049686 Unclassified 606
522 Ga0501081_0204551 3300049743 Bacteria 1433
523 nmdc:mga05p37_1154181_c1 3300050507 Bacteria 805
524 nmdc:mga05p37_122217_c1 3300050507 Bacteria 3198
525 nmdc:mga05p37_1281567_c1 3300050507 Bacteria 749
526 nmdc:mga05p37_2088889_c1 3300050507 Bacteria 531
527 nmdc:mga05p37_25392_c1 3300050507 Bacteria 7205
528 nmdc:mga05p37_284354_c1 3300050507 Bacteria 1971
529 nmdc:mga05p37_543844_c1 3300050507 Bacteria 1324
530 nmdc:mga05p37_588114_c1 3300050507 Bacteria 1259
531 nmdc:mga05p37_77896_c1 3300050507 Bacteria 4081
532 nmdc:mga09592_1071885_c1 3300050508 Unclassified 671
533 nmdc:mga09592_10726_c1 3300050508 Bacteria 7459
534 nmdc:mga09592_10824_c2 3300050508 Bacteria 3363
535 nmdc:mga09592_1276253_c1 3300050508 Bacteria 605
536 nmdc:mga09592_2708_c1 3300050508 Bacteria 14322
537 nmdc:mga09592_999746_c1 3300050508 Bacteria 699
538 nmdc:mga0qj67_10168_c1 3300050509 Bacteria 7025
539 nmdc:mga0qj67_136371_c1 3300050509 Bacteria 1989
540 nmdc:mga0qj67_154761_c1 3300050509 Bacteria 1860
541 nmdc:mga0qj67_272953_c1 3300050509 Bacteria 1371
542 nmdc:mga0qj67_37991_c2 3300050509 Bacteria 3390
543 nmdc:mga0qj67_409874_c1 3300050509 Unclassified 1093
544 nmdc:mga06r32_1357207_c1 3300050510 Bacteria 654
545 nmdc:mga06r32_75345_c1 3300050510 Bacteria 3274
546 nmdc:mga06r32_79871_c1 3300050510 Bacteria 3182
547 nmdc:mga08y16_10088_c1 3300050511 Bacteria 9916
548 nmdc:mga08y16_10550_c1 3300050511 Bacteria 9697
549 nmdc:mga08y16_140137_c1 3300050511 Bacteria 2514
550 nmdc:mga08y16_1558_c1 3300050511 Bacteria 23104
551 nmdc:mga08y16_158584_c1 3300050511 Bacteria 2351
552 nmdc:mga08y16_209402_c1 3300050511 Bacteria 2019
553 nmdc:mga08y16_256435_c1 3300050511 Bacteria 1806
554 nmdc:mga08y16_499408_c1 3300050511 Unclassified 1236
555 nmdc:mga08y16_86309_c1 3300050511 Bacteria 3271
556 nmdc:mga0n895_15386_c1 3300050512 Bacteria 6972
557 nmdc:mga0n895_32944_c1 3300050512 Bacteria 4976
558 nmdc:mga0n895_368861_c1 3300050512 Bacteria 1454
559 nmdc:mga0rr50_138461_c1 3300050513 Bacteria 1956
560 nmdc:mga0rr50_706693_c1 3300050513 Bacteria 860
561 nmdc:mga08x19_1079884_c1 3300050514 Unclassified 570
562 nmdc:mga0a205_118878_c1 3300050515 Bacteria 2541
563 nmdc:mga0a205_166964_c1 3300050515 Unclassified 2097
564 nmdc:mga0a205_404076_c1 3300050515 Bacteria 1230
565 nmdc:mga0a205_679082_c1 3300050515 Bacteria 880
566 Ga0501084_1865161 3300054114 Unclassified 502
567 Ga0530510_1053918 3300061734 Unclassified 623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025960 Ga0207651_11882977 Ga0207651_118829771 78
2 3300005337 Ga0070682_100347562 Ga0070682_1003475621 86
3 3300005617 Ga0068859_100787437 Ga0068859_1007874371 86
4 3300006931 Ga0097620_100787229 Ga0097620_1007872292 86
5 3300009093 Ga0105240_10015432 Ga0105240_100154324 86
6 3300009176 Ga0105242_12241914 Ga0105242_122419141 86
7 3300005295 Ga0065707_10118375 Ga0065707_101183752 87
8 3300005330 Ga0070690_100178879 Ga0070690_1001788792 87
9 3300005843 Ga0068860_101588018 Ga0068860_1015880182 87
10 3300006844 Ga0075428_100024130 Ga0075428_1000241304 87
11 3300006852 Ga0075433_10060674 Ga0075433_100606743 87
12 3300010159 Ga0099796_10241392 Ga0099796_102413921 87
13 3300025940 Ga0207691_11632382 Ga0207691_116323821 87
14 3300027907 Ga0207428_10199899 Ga0207428_101998992 87
15 3300005289 Ga0065704_10658794 Ga0065704_106587941 88
16 3300005331 Ga0070670_101739731 Ga0070670_1017397311 88
17 3300005340 Ga0070689_100219776 Ga0070689_1002197762 88
18 3300005347 Ga0070668_100090405 Ga0070668_1000904053 88
19 3300005353 Ga0070669_100714246 Ga0070669_1007142462 88
20 3300005354 Ga0070675_100069390 Ga0070675_1000693902 88
21 3300005365 Ga0070688_100786295 Ga0070688_1007862952 88
22 3300005367 Ga0070667_100099133 Ga0070667_1000991334 88
23 3300005456 Ga0070678_101160205 Ga0070678_1011602052 88
24 3300005457 Ga0070662_100585745 Ga0070662_1005857452 88
25 3300005543 Ga0070672_101322209 Ga0070672_1013222092 88
26 3300005544 Ga0070686_100411412 Ga0070686_1004114121 88
27 3300005544 Ga0070686_100541762 Ga0070686_1005417622 88
28 3300005548 Ga0070665_100491356 Ga0070665_1004913562 88
29 3300005549 Ga0070704_100114053 Ga0070704_1001140532 88
30 3300005578 Ga0068854_100882347 Ga0068854_1008823472 88
31 3300005617 Ga0068859_100048797 Ga0068859_1000487973 88
32 3300005617 Ga0068859_101444286 Ga0068859_1014442862 88
33 3300005617 Ga0068859_102013246 Ga0068859_1020132462 88
34 3300005618 Ga0068864_100603003 Ga0068864_1006030032 88
35 3300005719 Ga0068861_100294418 Ga0068861_1002944182 88
36 3300005719 Ga0068861_100411480 Ga0068861_1004114802 88
37 3300005843 Ga0068860_100054699 Ga0068860_1000546992 88
38 3300005844 Ga0068862_101598092 Ga0068862_1015980922 88
39 3300006844 Ga0075428_102200606 Ga0075428_1022006061 88
40 3300006846 Ga0075430_100698472 Ga0075430_1006984721 88
41 3300006880 Ga0075429_101259609 Ga0075429_1012596091 88
42 3300006881 Ga0068865_101627352 Ga0068865_1016273522 88
43 3300006931 Ga0097620_100048797 Ga0097620_1000487974 88
44 3300006931 Ga0097620_101443996 Ga0097620_1014439961 88
45 3300006931 Ga0097620_102013397 Ga0097620_1020133972 88
46 3300009094 Ga0111539_10001176 Ga0111539_100011763 88
47 3300009147 Ga0114129_10446193 Ga0114129_104461932 88
48 3300009176 Ga0105242_10556744 Ga0105242_105567442 88
49 3300009177 Ga0105248_10027232 Ga0105248_100272323 88
50 3300009177 Ga0105248_11032901 Ga0105248_110329012 88
51 3300013306 Ga0163162_10264816 Ga0163162_102648162 88
52 3300014326 Ga0157380_10195247 Ga0157380_101952472 88
53 3300014745 Ga0157377_10606549 Ga0157377_106065492 88
54 3300025923 Ga0207681_10438607 Ga0207681_104386073 88
55 3300025923 Ga0207681_10669713 Ga0207681_106697132 88
56 3300025927 Ga0207687_11669833 Ga0207687_116698331 88
57 3300025933 Ga0207706_10127436 Ga0207706_101274364 88
58 3300025933 Ga0207706_10624306 Ga0207706_106243062 88
59 3300025936 Ga0207670_10210737 Ga0207670_102107372 88
60 3300025937 Ga0207669_11585612 Ga0207669_115856121 88
61 3300025938 Ga0207704_11257604 Ga0207704_112576042 88
62 3300025941 Ga0207711_10088205 Ga0207711_100882054 88
63 3300025961 Ga0207712_10590385 Ga0207712_105903852 88
64 3300025972 Ga0207668_10066538 Ga0207668_100665383 88
65 3300025986 Ga0207658_10315696 Ga0207658_103156962 88
66 3300026089 Ga0207648_10172182 Ga0207648_101721822 88
67 3300026095 Ga0207676_11092619 Ga0207676_110926192 88
68 3300026118 Ga0207675_100574183 Ga0207675_1005741831 88
69 3300026118 Ga0207675_100676349 Ga0207675_1006763493 88
70 3300026118 Ga0207675_101388030 Ga0207675_1013880302 88
71 3300026121 Ga0207683_11319020 Ga0207683_113190201 88
72 3300027471 Ga0209995_1033233 Ga0209995_10332332 88
73 3300027695 Ga0209966_1051884 Ga0209966_10518842 88
74 3300027717 Ga0209998_10207626 Ga0209998_102076261 88
75 3300027907 Ga0207428_10018461 Ga0207428_100184613 88
76 3300027907 Ga0207428_10830411 Ga0207428_108304112 88
77 3300028380 Ga0268265_11041903 Ga0268265_110419032 88
78 3300028380 Ga0268265_11937260 Ga0268265_119372601 88
79 3300028381 Ga0268264_10051047 Ga0268264_100510472 88
80 3300028381 Ga0268264_11969699 Ga0268264_119696992 88
81 3300030745 Ga0316182_1112002 Ga0316182_11120022 88
82 3300031548 Ga0307408_100050590 Ga0307408_1000505904 88
83 3300031731 Ga0307405_10089035 Ga0307405_100890353 88
84 3300031824 Ga0307413_10245672 Ga0307413_102456722 88
85 3300031824 Ga0307413_10874059 Ga0307413_108740592 88
86 3300031852 Ga0307410_10001474 Ga0307410_100014745 88
87 3300031901 Ga0307406_10014930 Ga0307406_100149302 88
88 3300031901 Ga0307406_11866609 Ga0307406_118666091 88
89 3300031903 Ga0307407_10003122 Ga0307407_100031225 88
90 3300031911 Ga0307412_10043594 Ga0307412_100435942 88
91 3300031995 Ga0307409_100138426 Ga0307409_1001384263 88
92 3300031995 Ga0307409_100572616 Ga0307409_1005726161 88
93 3300032002 Ga0307416_100050094 Ga0307416_1000500944 88
94 3300032002 Ga0307416_100053309 Ga0307416_1000533091 88
95 3300032002 Ga0307416_101219836 Ga0307416_1012198362 88
96 3300032005 Ga0307411_10004021 Ga0307411_100040212 88
97 3300032126 Ga0307415_100031497 Ga0307415_1000314974 88
98 3300035724 Ga0373933_0340623 Ga0373933_0340623_532_801 88
99 3300041408 Ga0439453_0077842 Ga0439453_0077842_289_555 88
100 3300042156 Ga0439446_0320156 Ga0439446_0320156_47_313 88
101 3300046454 Ga0495592_0786021 Ga0495592_0786021_83_352 88
102 3300046462 Ga0495651_0841472 Ga0495651_0841472_199_468 88
103 3300046536 Ga0495587_0396249 Ga0495587_0396249_96_365 88
104 3300046543 Ga0495645_0488976 Ga0495645_0488976_490_759 88
105 3300046678 Ga0495599_0312814 Ga0495599_0312814_520_789 88
106 3300049589 Ga0501073_0434877 Ga0501073_0434877_465_731 88
107 3300050507 nmdc:mga05p37_1281567_c1 nmdc:mga05p37_1281567_c1_264_530 88
108 3300050511 nmdc:mga08y16_140137_c1 nmdc:mga08y16_140137_c1_2028_2294 88
109 3300050511 nmdc:mga08y16_1558_c1 nmdc:mga08y16_1558_c1_20995_21261 88
110 2162886012 MBSR1b_contig_11812573 MBSR1b_0128.00004520 89
111 3300004801 Ga0058860_12175475 Ga0058860_121754751 89
112 3300005288 Ga0065714_10292723 Ga0065714_102927232 89
113 3300005289 Ga0065704_10450404 Ga0065704_104504042 89
114 3300005290 Ga0065712_10000157 Ga0065712_100001577 89
115 3300005290 Ga0065712_10099250 Ga0065712_100992501 89
116 3300005290 Ga0065712_10796277 Ga0065712_107962771 89
117 3300005293 Ga0065715_10449556 Ga0065715_104495561 89
118 3300005295 Ga0065707_10100639 Ga0065707_101006394 89
119 3300005295 Ga0065707_10401373 Ga0065707_104013732 89
120 3300005328 Ga0070676_10002732 Ga0070676_100027327 89
121 3300005330 Ga0070690_100138128 Ga0070690_1001381281 89
122 3300005330 Ga0070690_100266220 Ga0070690_1002662202 89
123 3300005330 Ga0070690_100321250 Ga0070690_1003212502 89
124 3300005330 Ga0070690_100663726 Ga0070690_1006637262 89
125 3300005331 Ga0070670_100095821 Ga0070670_1000958213 89
126 3300005331 Ga0070670_100435054 Ga0070670_1004350542 89
127 3300005333 Ga0070677_10003227 Ga0070677_100032277 89
128 3300005333 Ga0070677_10049033 Ga0070677_100490332 89
129 3300005334 Ga0068869_100581096 Ga0068869_1005810962 89
130 3300005334 Ga0068869_100822610 Ga0068869_1008226101 89
131 3300005335 Ga0070666_10002058 Ga0070666_100020588 89
132 3300005335 Ga0070666_11110198 Ga0070666_111101982 89
133 3300005335 Ga0070666_11325561 Ga0070666_113255612 89
134 3300005336 Ga0070680_100215371 Ga0070680_1002153712 89
135 3300005336 Ga0070680_100724390 Ga0070680_1007243902 89
136 3300005337 Ga0070682_100925485 Ga0070682_1009254851 89
137 3300005338 Ga0068868_100420654 Ga0068868_1004206542 89
138 3300005338 Ga0068868_101342716 Ga0068868_1013427162 89
139 3300005339 Ga0070660_101541518 Ga0070660_1015415182 89
140 3300005340 Ga0070689_100037709 Ga0070689_1000377092 89
141 3300005340 Ga0070689_100098826 Ga0070689_1000988262 89
142 3300005340 Ga0070689_100421749 Ga0070689_1004217492 89
143 3300005341 Ga0070691_10289425 Ga0070691_102894252 89
144 3300005343 Ga0070687_100010126 Ga0070687_1000101264 89
145 3300005343 Ga0070687_100600785 Ga0070687_1006007852 89
146 3300005344 Ga0070661_100018283 Ga0070661_1000182834 89
147 3300005344 Ga0070661_100285848 Ga0070661_1002858482 89
148 3300005345 Ga0070692_10046272 Ga0070692_100462721 89
149 3300005345 Ga0070692_11339184 Ga0070692_113391842 89
150 3300005347 Ga0070668_100077184 Ga0070668_1000771844 89
151 3300005347 Ga0070668_100338528 Ga0070668_1003385282 89
152 3300005353 Ga0070669_100004330 Ga0070669_1000043301 89
153 3300005353 Ga0070669_100317993 Ga0070669_1003179931 89
154 3300005353 Ga0070669_100466161 Ga0070669_1004661612 89
155 3300005353 Ga0070669_101400909 Ga0070669_1014009091 89
156 3300005353 Ga0070669_101886647 Ga0070669_1018866471 89
157 3300005354 Ga0070675_100015380 Ga0070675_1000153802 89
158 3300005354 Ga0070675_100020507 Ga0070675_1000205074 89
159 3300005354 Ga0070675_100065654 Ga0070675_1000656544 89
160 3300005354 Ga0070675_100828104 Ga0070675_1008281042 89
161 3300005355 Ga0070671_101243697 Ga0070671_1012436971 89
162 3300005356 Ga0070674_100233167 Ga0070674_1002331672 89
163 3300005364 Ga0070673_100017267 Ga0070673_1000172672 89
164 3300005364 Ga0070673_100153102 Ga0070673_1001531023 89
165 3300005364 Ga0070673_100721151 Ga0070673_1007211512 89
166 3300005364 Ga0070673_100810870 Ga0070673_1008108701 89
167 3300005365 Ga0070688_100062307 Ga0070688_1000623072 89
168 3300005365 Ga0070688_100083133 Ga0070688_1000831332 89
169 3300005365 Ga0070688_100118734 Ga0070688_1001187343 89
170 3300005365 Ga0070688_100345739 Ga0070688_1003457392 89
171 3300005366 Ga0070659_100154135 Ga0070659_1001541352 89
172 3300005366 Ga0070659_100945344 Ga0070659_1009453441 89
173 3300005367 Ga0070667_100634342 Ga0070667_1006343422 89
174 3300005438 Ga0070701_10041587 Ga0070701_100415872 89
175 3300005438 Ga0070701_10316566 Ga0070701_103165661 89
176 3300005439 Ga0070711_100321012 Ga0070711_1003210122 89
177 3300005440 Ga0070705_100549046 Ga0070705_1005490462 89
178 3300005440 Ga0070705_100992109 Ga0070705_1009921091 89
179 3300005441 Ga0070700_100043287 Ga0070700_1000432872 89
180 3300005441 Ga0070700_100576587 Ga0070700_1005765871 89
181 3300005441 Ga0070700_101146552 Ga0070700_1011465521 89
182 3300005444 Ga0070694_100776216 Ga0070694_1007762161 89
183 3300005444 Ga0070694_100941101 Ga0070694_1009411012 89
184 3300005444 Ga0070694_100947348 Ga0070694_1009473482 89
185 3300005445 Ga0070708_101925431 Ga0070708_1019254311 89
186 3300005455 Ga0070663_100996421 Ga0070663_1009964212 89
187 3300005456 Ga0070678_100061768 Ga0070678_1000617683 89
188 3300005456 Ga0070678_100126106 Ga0070678_1001261062 89
189 3300005456 Ga0070678_100608849 Ga0070678_1006088491 89
190 3300005456 Ga0070678_101275804 Ga0070678_1012758041 89
191 3300005456 Ga0070678_102081309 Ga0070678_1020813091 89
192 3300005457 Ga0070662_100015586 Ga0070662_1000155866 89
193 3300005458 Ga0070681_10047573 Ga0070681_100475732 89
194 3300005459 Ga0068867_100011383 Ga0068867_1000113835 89
195 3300005459 Ga0068867_100312007 Ga0068867_1003120072 89
196 3300005466 Ga0070685_10002152 Ga0070685_100021522 89
197 3300005467 Ga0070706_100071653 Ga0070706_1000716533 89
198 3300005468 Ga0070707_100075015 Ga0070707_1000750153 89
199 3300005468 Ga0070707_100350536 Ga0070707_1003505362 89
200 3300005471 Ga0070698_100069962 Ga0070698_1000699622 89
201 3300005471 Ga0070698_100992958 Ga0070698_1009929582 89
202 3300005518 Ga0070699_100283005 Ga0070699_1002830052 89
203 3300005518 Ga0070699_100760290 Ga0070699_1007602902 89
204 3300005530 Ga0070679_100091085 Ga0070679_1000910852 89
205 3300005535 Ga0070684_100403721 Ga0070684_1004037212 89
206 3300005536 Ga0070697_100173734 Ga0070697_1001737342 89
207 3300005543 Ga0070672_100048249 Ga0070672_1000482492 89
208 3300005543 Ga0070672_100090003 Ga0070672_1000900032 89
209 3300005543 Ga0070672_100409230 Ga0070672_1004092302 89
210 3300005543 Ga0070672_101243029 Ga0070672_1012430292 89
211 3300005543 Ga0070672_101363096 Ga0070672_1013630961 89
212 3300005544 Ga0070686_100030006 Ga0070686_1000300064 89
213 3300005544 Ga0070686_100332548 Ga0070686_1003325481 89
214 3300005544 Ga0070686_101206284 Ga0070686_1012062842 89
215 3300005545 Ga0070695_100321726 Ga0070695_1003217262 89
216 3300005546 Ga0070696_100223184 Ga0070696_1002231842 89
217 3300005547 Ga0070693_100740435 Ga0070693_1007404351 89
218 3300005548 Ga0070665_100083489 Ga0070665_1000834894 89
219 3300005548 Ga0070665_100610085 Ga0070665_1006100852 89
220 3300005549 Ga0070704_100063426 Ga0070704_1000634263 89
221 3300005549 Ga0070704_100215805 Ga0070704_1002158052 89
222 3300005549 Ga0070704_100296862 Ga0070704_1002968622 89
223 3300005549 Ga0070704_100902106 Ga0070704_1009021062 89
224 3300005549 Ga0070704_101826326 Ga0070704_1018263262 89
225 3300005564 Ga0070664_100006238 Ga0070664_1000062385 89
226 3300005564 Ga0070664_100059268 Ga0070664_1000592682 89
227 3300005564 Ga0070664_100106703 Ga0070664_1001067031 89
228 3300005564 Ga0070664_100943615 Ga0070664_1009436152 89
229 3300005577 Ga0068857_100215386 Ga0068857_1002153862 89
230 3300005577 Ga0068857_100671882 Ga0068857_1006718822 89
231 3300005615 Ga0070702_100774808 Ga0070702_1007748082 89
232 3300005615 Ga0070702_100939524 Ga0070702_1009395241 89
233 3300005615 Ga0070702_101649028 Ga0070702_1016490282 89
234 3300005616 Ga0068852_100050124 Ga0068852_1000501244 89
235 3300005617 Ga0068859_100188780 Ga0068859_1001887804 89
236 3300005617 Ga0068859_100243264 Ga0068859_1002432643 89
237 3300005617 Ga0068859_100274759 Ga0068859_1002747593 89
238 3300005617 Ga0068859_101175476 Ga0068859_1011754762 89
239 3300005618 Ga0068864_100111047 Ga0068864_1001110472 89
240 3300005618 Ga0068864_100261602 Ga0068864_1002616022 89
241 3300005618 Ga0068864_100310920 Ga0068864_1003109202 89
242 3300005618 Ga0068864_101133557 Ga0068864_1011335572 89
243 3300005719 Ga0068861_100003257 Ga0068861_10000325711 89
244 3300005719 Ga0068861_101027323 Ga0068861_1010273232 89
245 3300005840 Ga0068870_10000409 Ga0068870_100004099 89
246 3300005840 Ga0068870_10135116 Ga0068870_101351162 89
247 3300005840 Ga0068870_10621507 Ga0068870_106215071 89
248 3300005841 Ga0068863_100042106 Ga0068863_1000421064 89
249 3300005841 Ga0068863_100609731 Ga0068863_1006097312 89
250 3300005842 Ga0068858_100210597 Ga0068858_1002105972 89
251 3300005843 Ga0068860_100257794 Ga0068860_1002577942 89
252 3300005843 Ga0068860_100550420 Ga0068860_1005504202 89
253 3300005844 Ga0068862_100006569 Ga0068862_1000065693 89
254 3300005844 Ga0068862_100037927 Ga0068862_1000379274 89
255 3300005844 Ga0068862_100291411 Ga0068862_1002914112 89
256 3300005844 Ga0068862_100909470 Ga0068862_1009094702 89
257 3300005844 Ga0068862_102071741 Ga0068862_1020717411 89
258 3300006058 Ga0075432_10115023 Ga0075432_101150232 89
259 3300006237 Ga0097621_100502328 Ga0097621_1005023282 89
260 3300006237 Ga0097621_101688942 Ga0097621_1016889421 89
261 3300006358 Ga0068871_100100507 Ga0068871_1001005072 89
262 3300006358 Ga0068871_100401166 Ga0068871_1004011661 89
263 3300006358 Ga0068871_100848087 Ga0068871_1008480871 89
264 3300006844 Ga0075428_100001700 Ga0075428_10000170023 89
265 3300006844 Ga0075428_100002416 Ga0075428_1000024167 89
266 3300006844 Ga0075428_100005624 Ga0075428_1000056243 89
267 3300006844 Ga0075428_100044304 Ga0075428_1000443043 89
268 3300006844 Ga0075428_100543122 Ga0075428_1005431222 89
269 3300006844 Ga0075428_100544505 Ga0075428_1005445052 89
270 3300006844 Ga0075428_100607190 Ga0075428_1006071902 89
271 3300006846 Ga0075430_100006849 Ga0075430_1000068494 89
272 3300006846 Ga0075430_100021061 Ga0075430_1000210612 89
273 3300006846 Ga0075430_100087556 Ga0075430_1000875562 89
274 3300006846 Ga0075430_100300438 Ga0075430_1003004382 89
275 3300006846 Ga0075430_100506955 Ga0075430_1005069552 89
276 3300006847 Ga0075431_100090492 Ga0075431_1000904922 89
277 3300006847 Ga0075431_100126365 Ga0075431_1001263652 89
278 3300006847 Ga0075431_100218140 Ga0075431_1002181403 89
279 3300006847 Ga0075431_100845498 Ga0075431_1008454982 89
280 3300006852 Ga0075433_10061911 Ga0075433_100619112 89
281 3300006852 Ga0075433_10232638 Ga0075433_102326382 89
282 3300006852 Ga0075433_10432161 Ga0075433_104321612 89
283 3300006852 Ga0075433_10434379 Ga0075433_104343792 89
284 3300006871 Ga0075434_100062600 Ga0075434_1000626004 89
285 3300006871 Ga0075434_100085172 Ga0075434_1000851723 89
286 3300006871 Ga0075434_101373994 Ga0075434_1013739942 89
287 3300006880 Ga0075429_100001299 Ga0075429_10000129911 89
288 3300006880 Ga0075429_100021693 Ga0075429_1000216933 89
289 3300006880 Ga0075429_100022229 Ga0075429_1000222293 89
290 3300006880 Ga0075429_100057628 Ga0075429_1000576284 89
291 3300006880 Ga0075429_100220346 Ga0075429_1002203462 89
292 3300006880 Ga0075429_100481740 Ga0075429_1004817401 89
293 3300006881 Ga0068865_100335187 Ga0068865_1003351872 89
294 3300006931 Ga0097620_100188781 Ga0097620_1001887814 89
295 3300006931 Ga0097620_100243271 Ga0097620_1002432712 89
296 3300006931 Ga0097620_100274767 Ga0097620_1002747673 89
297 3300006931 Ga0097620_101175609 Ga0097620_1011756092 89
298 3300007076 Ga0075435_100024200 Ga0075435_1000242004 89
299 3300007076 Ga0075435_101357130 Ga0075435_1013571302 89
300 3300007076 Ga0075435_101746759 Ga0075435_1017467591 89
301 3300009094 Ga0111539_10007015 Ga0111539_100070154 89
302 3300009094 Ga0111539_10011819 Ga0111539_100118192 89
303 3300009094 Ga0111539_10014042 Ga0111539_100140424 89
304 3300009094 Ga0111539_10085748 Ga0111539_100857482 89
305 3300009094 Ga0111539_10330824 Ga0111539_103308243 89
306 3300009094 Ga0111539_10588410 Ga0111539_105884102 89
307 3300009094 Ga0111539_10742466 Ga0111539_107424662 89
308 3300009094 Ga0111539_12448957 Ga0111539_124489571 89
309 3300009098 Ga0105245_10430399 Ga0105245_104303992 89
310 3300009098 Ga0105245_11409355 Ga0105245_114093552 89
311 3300009101 Ga0105247_10551484 Ga0105247_105514842 89
312 3300009147 Ga0114129_10025293 Ga0114129_100252934 89
313 3300009147 Ga0114129_10108629 Ga0114129_101086294 89
314 3300009147 Ga0114129_10253277 Ga0114129_102532772 89
315 3300009147 Ga0114129_10456680 Ga0114129_104566802 89
316 3300009147 Ga0114129_10555270 Ga0114129_105552702 89
317 3300009147 Ga0114129_10579030 Ga0114129_105790302 89
318 3300009147 Ga0114129_12620998 Ga0114129_126209982 89
319 3300009148 Ga0105243_11762624 Ga0105243_117626241 89
320 3300009177 Ga0105248_10630074 Ga0105248_106300742 89
321 3300009177 Ga0105248_10974505 Ga0105248_109745051 89
322 3300009553 Ga0105249_10005440 Ga0105249_100054408 89
323 3300009553 Ga0105249_10940168 Ga0105249_109401682 89
324 3300009553 Ga0105249_12263548 Ga0105249_122635482 89
325 3300009553 Ga0105249_12362118 Ga0105249_123621182 89
326 3300011119 Ga0105246_10041172 Ga0105246_100411724 89
327 3300011119 Ga0105246_10995656 Ga0105246_109956562 89
328 3300012487 Ga0157321_1015243 Ga0157321_10152431 89
329 3300012500 Ga0157314_1009787 Ga0157314_10097872 89
330 3300013102 Ga0157371_10417344 Ga0157371_104173442 89
331 3300013102 Ga0157371_11190791 Ga0157371_111907912 89
332 3300013296 Ga0157374_10362810 Ga0157374_103628102 89
333 3300013306 Ga0163162_11219367 Ga0163162_112193672 89
334 3300013306 Ga0163162_11488664 Ga0163162_114886642 89
335 3300013307 Ga0157372_10428061 Ga0157372_104280612 89
336 3300013307 Ga0157372_12128408 Ga0157372_121284082 89
337 3300013308 Ga0157375_10017399 Ga0157375_100173997 89
338 3300013308 Ga0157375_10363735 Ga0157375_103637352 89
339 3300013308 Ga0157375_10771455 Ga0157375_107714552 89
340 3300013308 Ga0157375_11218114 Ga0157375_112181142 89
341 3300013308 Ga0157375_12298425 Ga0157375_122984251 89
342 3300014325 Ga0163163_13068646 Ga0163163_130686461 89
343 3300014326 Ga0157380_10094819 Ga0157380_100948193 89
344 3300014326 Ga0157380_10199689 Ga0157380_101996892 89
345 3300014326 Ga0157380_10204076 Ga0157380_102040762 89
346 3300014745 Ga0157377_10001579 Ga0157377_100015792 89
347 3300014745 Ga0157377_10012641 Ga0157377_100126412 89
348 3300014745 Ga0157377_10420179 Ga0157377_104201792 89
349 3300014968 Ga0157379_10018661 Ga0157379_100186616 89
350 3300014969 Ga0157376_10354060 Ga0157376_103540601 89
351 3300014969 Ga0157376_10376103 Ga0157376_103761032 89
352 3300014969 Ga0157376_11475922 Ga0157376_114759222 89
353 3300017792 Ga0163161_10018958 Ga0163161_100189583 89
354 3300025290 Ga0207673_1039471 Ga0207673_10394712 89
355 3300025315 Ga0207697_10000483 Ga0207697_1000048311 89
356 3300025315 Ga0207697_10488256 Ga0207697_104882561 89
357 3300025893 Ga0207682_10005531 Ga0207682_100055312 89
358 3300025893 Ga0207682_10150156 Ga0207682_101501563 89
359 3300025901 Ga0207688_10002562 Ga0207688_100025628 89
360 3300025901 Ga0207688_10479087 Ga0207688_104790872 89
361 3300025903 Ga0207680_10062643 Ga0207680_100626433 89
362 3300025907 Ga0207645_10003430 Ga0207645_100034305 89
363 3300025908 Ga0207643_10002454 Ga0207643_100024544 89
364 3300025908 Ga0207643_10428439 Ga0207643_104284392 89
365 3300025910 Ga0207684_10074921 Ga0207684_100749213 89
366 3300025910 Ga0207684_10308322 Ga0207684_103083222 89
367 3300025916 Ga0207663_11117817 Ga0207663_111178171 89
368 3300025917 Ga0207660_10656011 Ga0207660_106560112 89
369 3300025918 Ga0207662_10010573 Ga0207662_100105732 89
370 3300025918 Ga0207662_10078343 Ga0207662_100783432 89
371 3300025919 Ga0207657_10306820 Ga0207657_103068202 89
372 3300025919 Ga0207657_10988618 Ga0207657_109886181 89
373 3300025920 Ga0207649_10019427 Ga0207649_100194274 89
374 3300025920 Ga0207649_10219423 Ga0207649_102194232 89
375 3300025921 Ga0207652_10104459 Ga0207652_101044592 89
376 3300025922 Ga0207646_10047830 Ga0207646_100478302 89
377 3300025922 Ga0207646_10543525 Ga0207646_105435251 89
378 3300025923 Ga0207681_10011928 Ga0207681_100119284 89
379 3300025923 Ga0207681_10161591 Ga0207681_101615912 89
380 3300025923 Ga0207681_10344577 Ga0207681_103445771 89
381 3300025923 Ga0207681_11602501 Ga0207681_116025012 89
382 3300025923 Ga0207681_11671005 Ga0207681_116710051 89
383 3300025925 Ga0207650_10071762 Ga0207650_100717622 89
384 3300025925 Ga0207650_10411594 Ga0207650_104115941 89
385 3300025925 Ga0207650_11085101 Ga0207650_110851011 89
386 3300025926 Ga0207659_10009325 Ga0207659_100093251 89
387 3300025926 Ga0207659_10011060 Ga0207659_100110605 89
388 3300025926 Ga0207659_10065358 Ga0207659_100653582 89
389 3300025926 Ga0207659_10147021 Ga0207659_101470212 89
390 3300025931 Ga0207644_11827978 Ga0207644_118279781 89
391 3300025932 Ga0207690_10058404 Ga0207690_100584042 89
392 3300025933 Ga0207706_10018937 Ga0207706_100189372 89
393 3300025936 Ga0207670_11072962 Ga0207670_110729621 89
394 3300025937 Ga0207669_10026677 Ga0207669_100266774 89
395 3300025937 Ga0207669_10859175 Ga0207669_108591752 89
396 3300025938 Ga0207704_10519042 Ga0207704_105190422 89
397 3300025938 Ga0207704_10859357 Ga0207704_108593571 89
398 3300025938 Ga0207704_11906644 Ga0207704_119066441 89
399 3300025940 Ga0207691_10003015 Ga0207691_100030156 89
400 3300025940 Ga0207691_10033543 Ga0207691_100335434 89
401 3300025940 Ga0207691_10036150 Ga0207691_100361501 89
402 3300025940 Ga0207691_10745213 Ga0207691_107452132 89
403 3300025941 Ga0207711_10621459 Ga0207711_106214592 89
404 3300025942 Ga0207689_10005330 Ga0207689_100053304 89
405 3300025942 Ga0207689_10146139 Ga0207689_101461394 89
406 3300025960 Ga0207651_10043416 Ga0207651_100434164 89
407 3300025960 Ga0207651_10585964 Ga0207651_105859642 89
408 3300025961 Ga0207712_10169778 Ga0207712_101697782 89
409 3300025961 Ga0207712_11625460 Ga0207712_116254601 89
410 3300026023 Ga0207677_10243954 Ga0207677_102439541 89
411 3300026023 Ga0207677_11100082 Ga0207677_111000822 89
412 3300026035 Ga0207703_10256353 Ga0207703_102563532 89
413 3300026067 Ga0207678_10332542 Ga0207678_103325422 89
414 3300026067 Ga0207678_11585048 Ga0207678_115850481 89
415 3300026075 Ga0207708_10318851 Ga0207708_103188512 89
416 3300026075 Ga0207708_10320950 Ga0207708_103209502 89
417 3300026075 Ga0207708_10789170 Ga0207708_107891702 89
418 3300026078 Ga0207702_11969302 Ga0207702_119693022 89
419 3300026088 Ga0207641_10028662 Ga0207641_100286624 89
420 3300026088 Ga0207641_10128653 Ga0207641_101286533 89
421 3300026089 Ga0207648_10008442 Ga0207648_100084424 89
422 3300026089 Ga0207648_10260051 Ga0207648_102600512 89
423 3300026089 Ga0207648_10360139 Ga0207648_103601392 89
424 3300026095 Ga0207676_10092442 Ga0207676_100924424 89
425 3300026095 Ga0207676_10281520 Ga0207676_102815202 89
426 3300026095 Ga0207676_10299317 Ga0207676_102993172 89
427 3300026095 Ga0207676_10596798 Ga0207676_105967982 89
428 3300026095 Ga0207676_11238122 Ga0207676_112381221 89
429 3300026116 Ga0207674_10068664 Ga0207674_100686644 89
430 3300026118 Ga0207675_100001490 Ga0207675_1000014908 89
431 3300026118 Ga0207675_100119983 Ga0207675_1001199833 89
432 3300026121 Ga0207683_10005514 Ga0207683_100055148 89
433 3300026121 Ga0207683_10380646 Ga0207683_103806462 89
434 3300026121 Ga0207683_10643931 Ga0207683_106439312 89
435 3300026142 Ga0207698_10480637 Ga0207698_104806372 89
436 3300026142 Ga0207698_12050030 Ga0207698_120500301 89
437 3300027252 Ga0209973_1035219 Ga0209973_10352192 89
438 3300027614 Ga0209970_1094118 Ga0209970_10941181 89
439 3300027876 Ga0209974_10419149 Ga0209974_104191492 89
440 3300027907 Ga0207428_10000236 Ga0207428_1000023629 89
441 3300027907 Ga0207428_10039349 Ga0207428_100393492 89
442 3300027907 Ga0207428_10071417 Ga0207428_100714172 89
443 3300027907 Ga0207428_10427500 Ga0207428_104275002 89
444 3300028379 Ga0268266_10206222 Ga0268266_102062221 89
445 3300028380 Ga0268265_10062056 Ga0268265_100620564 89
446 3300028380 Ga0268265_10569019 Ga0268265_105690192 89
447 3300028380 Ga0268265_11015422 Ga0268265_110154222 89
448 3300028380 Ga0268265_11101254 Ga0268265_111012542 89
449 3300028380 Ga0268265_12690850 Ga0268265_126908501 89
450 3300028381 Ga0268264_10203658 Ga0268264_102036583 89
451 3300031548 Ga0307408_101156895 Ga0307408_1011568952 89
452 3300031548 Ga0307408_101629401 Ga0307408_1016294012 89
453 3300031824 Ga0307413_10686555 Ga0307413_106865552 89
454 3300031852 Ga0307410_10042158 Ga0307410_100421583 89
455 3300031901 Ga0307406_10411474 Ga0307406_104114742 89
456 3300031903 Ga0307407_10364498 Ga0307407_103644982 89
457 3300031911 Ga0307412_10026807 Ga0307412_100268074 89
458 3300031911 Ga0307412_10406306 Ga0307412_104063062 89
459 3300031995 Ga0307409_100514974 Ga0307409_1005149742 89
460 3300031995 Ga0307409_101169846 Ga0307409_1011698462 89
461 3300032002 Ga0307416_100012197 Ga0307416_1000121976 89
462 3300032002 Ga0307416_100806477 Ga0307416_1008064772 89
463 3300032002 Ga0307416_101366798 Ga0307416_1013667981 89
464 3300032002 Ga0307416_102579622 Ga0307416_1025796221 89
465 3300032005 Ga0307411_10756651 Ga0307411_107566512 89
466 3300032126 Ga0307415_100082865 Ga0307415_1000828653 89
467 3300032126 Ga0307415_100887134 Ga0307415_1008871342 89
468 3300034818 Ga0373950_0052900 Ga0373950_0052900_283_552 89
469 3300034957 Ga0373938_0247345 Ga0373938_0247345_202_471 89
470 3300035088 Ga0373940_0025660 Ga0373940_0025660_689_958 89
471 3300035112 Ga0373932_0026007 Ga0373932_0026007_1206_1475 89
472 3300035242 Ga0373962_0174023 Ga0373962_0174023_245_514 89
473 3300035691 Ga0373931_0573605 Ga0373931_0573605_205_474 89
474 3300038443 Ga0395901_1213230 Ga0395901_1213230_381_662 89
475 3300042003 Ga0439443_018376 Ga0439443_018376_316_585 89
476 3300042122 Ga0450920_039213 Ga0450920_039213_404_673 89
477 3300042125 Ga0450923_100863 Ga0450923_100863_35_304 89
478 3300042127 Ga0450890_033880 Ga0450890_033880_137_406 89
479 3300042184 Ga0450908_018712 Ga0450908_018712_15_284 89
480 3300042184 Ga0450908_030068 Ga0450908_030068_221_490 89
481 3300042436 Ga0439435_0107464 Ga0439435_0107464_151_420 89
482 3300042436 Ga0439435_0185199 Ga0439435_0185199_193_462 89
483 3300042437 Ga0439444_0071978 Ga0439444_0071978_382_651 89
484 3300042438 Ga0439459_0012378 Ga0439459_0012378_385_654 89
485 3300042439 Ga0439464_0130179 Ga0439464_0130179_49_318 89
486 3300042461 Ga0439460_0286741 Ga0439460_0286741_73_345 89
487 3300042461 Ga0439460_0318293 Ga0439460_0318293_58_336 89
488 3300042993 Ga0439440_0044918 Ga0439440_0044918_258_527 89
489 3300044673 Ga0453683_0152923 Ga0453683_0152923_174_470 89
490 3300045051 Ga0451576_1477861 Ga0451576_1477861_319_588 89
491 3300045051 Ga0451576_1833955 Ga0451576_1833955_55_324 89
492 3300046455 Ga0495603_0555086 Ga0495603_0555086_108_377 89
493 3300046499 Ga0495594_0301321 Ga0495594_0301321_621_890 89
494 3300046537 Ga0495598_0026687 Ga0495598_0026687_664_933 89
495 3300046558 Ga0495633_0352240 Ga0495633_0352240_120_389 89
496 3300046615 Ga0495656_0064205 Ga0495656_0064205_117_386 89
497 3300046674 Ga0495588_0466307 Ga0495588_0466307_75_344 89
498 3300046683 Ga0495658_0718066 Ga0495658_0718066_160_429 89
499 3300047318 Ga0495636_0500906 Ga0495636_0500906_71_340 89
500 3300047319 Ga0495674_0222210 Ga0495674_0222210_738_1022 89
501 3300048907 Ga0496104_0257541 Ga0496104_0257541_335_604 89
502 3300048907 Ga0496104_0472315 Ga0496104_0472315_831_1100 89
503 3300048912 Ga0496109_0027094 Ga0496109_0027094_3576_3845 89
504 3300048912 Ga0496109_0174091 Ga0496109_0174091_121_405 89
505 3300048913 Ga0496110_1617677 Ga0496110_1617677_223_492 89
506 3300048916 Ga0496113_0031209 Ga0496113_0031209_1587_1856 89
507 3300048916 Ga0496113_0258607 Ga0496113_0258607_337_606 89
508 3300048917 Ga0496114_0604608 Ga0496114_0604608_600_869 89
509 3300049519 Ga0501296_025560 Ga0501296_025560_118_387 89
510 3300049568 Ga0501031_0950598 Ga0501031_0950598_205_474 89
511 3300049574 Ga0501038_0231165 Ga0501038_0231165_501_770 89
512 3300049575 Ga0501039_1040471 Ga0501039_1040471_273_560 89
513 3300049577 Ga0501041_0197209 Ga0501041_0197209_808_1095 89
514 3300049578 Ga0501042_0701312 Ga0501042_0701312_345_614 89
515 3300049579 Ga0501043_1309408 Ga0501043_1309408_100_369 89
516 3300049588 Ga0501072_1342778 Ga0501072_1342778_157_426 89
517 3300049588 Ga0501072_1343573 Ga0501072_1343573_159_428 89
518 3300049592 Ga0501076_0515301 Ga0501076_0515301_592_861 89
519 3300049592 Ga0501076_0524112 Ga0501076_0524112_231_518 89
520 3300049593 Ga0501077_0378687 Ga0501077_0378687_171_458 89
521 3300049652 Ga0501202_192227 Ga0501202_192227_60_332 89
522 3300049654 Ga0501207_010342 Ga0501207_010342_986_1255 89
523 3300049660 Ga0501216_132157 Ga0501216_132157_243_512 89
524 3300049686 Ga0501257_173845 Ga0501257_173845_238_510 89
525 3300049743 Ga0501081_0204551 Ga0501081_0204551_1119_1388 89
526 3300050507 nmdc:mga05p37_1154181_c1 nmdc:mga05p37_1154181_c1_339_611 89
527 3300050507 nmdc:mga05p37_122217_c1 nmdc:mga05p37_122217_c1_1955_2224 89
528 3300050507 nmdc:mga05p37_2088889_c1 nmdc:mga05p37_2088889_c1_241_510 89
529 3300050507 nmdc:mga05p37_25392_c1 nmdc:mga05p37_25392_c1_4102_4371 89
530 3300050507 nmdc:mga05p37_284354_c1 nmdc:mga05p37_284354_c1_458_727 89
531 3300050507 nmdc:mga05p37_543844_c1 nmdc:mga05p37_543844_c1_545_829 89
532 3300050507 nmdc:mga05p37_588114_c1 nmdc:mga05p37_588114_c1_335_604 89
533 3300050507 nmdc:mga05p37_77896_c1 nmdc:mga05p37_77896_c1_2974_3243 89
534 3300050508 nmdc:mga09592_1071885_c1 nmdc:mga09592_1071885_c1_218_487 89
535 3300050508 nmdc:mga09592_10726_c1 nmdc:mga09592_10726_c1_3052_3321 89
536 3300050508 nmdc:mga09592_10824_c2 nmdc:mga09592_10824_c2_1433_1702 89
537 3300050508 nmdc:mga09592_1276253_c1 nmdc:mga09592_1276253_c1_19_288 89
538 3300050508 nmdc:mga09592_2708_c1 nmdc:mga09592_2708_c1_11891_12160 89
539 3300050508 nmdc:mga09592_999746_c1 nmdc:mga09592_999746_c1_394_663 89
540 3300050509 nmdc:mga0qj67_10168_c1 nmdc:mga0qj67_10168_c1_2578_2847 89
541 3300050509 nmdc:mga0qj67_136371_c1 nmdc:mga0qj67_136371_c1_430_699 89
542 3300050509 nmdc:mga0qj67_154761_c1 nmdc:mga0qj67_154761_c1_1533_1802 89
543 3300050509 nmdc:mga0qj67_272953_c1 nmdc:mga0qj67_272953_c1_1054_1326 89
544 3300050509 nmdc:mga0qj67_37991_c2 nmdc:mga0qj67_37991_c2_1002_1271 89
545 3300050509 nmdc:mga0qj67_409874_c1 nmdc:mga0qj67_409874_c1_579_848 89
546 3300050510 nmdc:mga06r32_1357207_c1 nmdc:mga06r32_1357207_c1_68_337 89
547 3300050510 nmdc:mga06r32_75345_c1 nmdc:mga06r32_75345_c1_147_416 89
548 3300050510 nmdc:mga06r32_79871_c1 nmdc:mga06r32_79871_c1_1920_2192 89
549 3300050511 nmdc:mga08y16_10088_c1 nmdc:mga08y16_10088_c1_7432_7701 89
550 3300050511 nmdc:mga08y16_10550_c1 nmdc:mga08y16_10550_c1_6439_6708 89
551 3300050511 nmdc:mga08y16_158584_c1 nmdc:mga08y16_158584_c1_813_1082 89
552 3300050511 nmdc:mga08y16_209402_c1 nmdc:mga08y16_209402_c1_623_892 89
553 3300050511 nmdc:mga08y16_256435_c1 nmdc:mga08y16_256435_c1_15_284 89
554 3300050511 nmdc:mga08y16_499408_c1 nmdc:mga08y16_499408_c1_57_329 89
555 3300050511 nmdc:mga08y16_86309_c1 nmdc:mga08y16_86309_c1_621_890 89
556 3300050512 nmdc:mga0n895_15386_c1 nmdc:mga0n895_15386_c1_2392_2661 89
557 3300050512 nmdc:mga0n895_32944_c1 nmdc:mga0n895_32944_c1_1081_1350 89
558 3300050512 nmdc:mga0n895_368861_c1 nmdc:mga0n895_368861_c1_1141_1425 89
559 3300050513 nmdc:mga0rr50_138461_c1 nmdc:mga0rr50_138461_c1_520_804 89
560 3300050513 nmdc:mga0rr50_706693_c1 nmdc:mga0rr50_706693_c1_227_496 89
561 3300050514 nmdc:mga08x19_1079884_c1 nmdc:mga08x19_1079884_c1_115_384 89
562 3300050515 nmdc:mga0a205_118878_c1 nmdc:mga0a205_118878_c1_592_861 89
563 3300050515 nmdc:mga0a205_166964_c1 nmdc:mga0a205_166964_c1_481_750 89
564 3300050515 nmdc:mga0a205_404076_c1 nmdc:mga0a205_404076_c1_646_930 89
565 3300050515 nmdc:mga0a205_679082_c1 nmdc:mga0a205_679082_c1_341_610 89
566 3300054114 Ga0501084_1865161 Ga0501084_1865161_121_390 89
567 3300061734 Ga0530510_1053918 Ga0530510_1053918_213_482 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

17

88

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k51-assembly2.cif.gz_B crystal structure of the pci domain of eif3a 0.9868 29 61
4u1c-assembly1.cif.gz_A crystal structure of the eif3a/eif3c pci-domain heterodimer 0.9804 20 60
7dgq-assembly1.cif.gz_A9 activity optimized supercomplex state1 0.9258 24 64
5gpn-assembly1.cif.gz_0 architecture of mammalian respirasome 0.9258 24 64
5luf-assembly1.cif.gz_z cryo-em of bovine respirasome 0.9258 24 64
ID Description Score Start End Superfamily
4k51B00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.9868 29 61 1.25.40.860
4u1cA01 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;UVR domain 0.9804 20 60 4.10.860.10
af_A4I5D2_109_274_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9709 14 61 1.25.10.10
af_K7LI90_496_807_1.20.120.670 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9653 23 60 1.20.120.670
af_Q54DW5_515_797_1.20.120.670 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9627 25 62 1.20.120.670
ID Description Score Start End GO Terms
AF-A0A645BS02-F1-model_v4 30S ribosomal protein S20 0.978 21 89 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-X0VFS6-F1-model_v4 30S ribosomal protein S20 0.9779 17 88 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-H5SRE3-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9778 21 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0C1H3Z2-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.974 25 87 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X0SC26-F1-model_v4 30S ribosomal protein S20 0.9702 20 87 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
92.59 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map